--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:52:00 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/aroE/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1116.47         -1119.77
2      -1116.44         -1119.22
--------------------------------------
TOTAL    -1116.45         -1119.53
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.895727    0.093830    0.350791    1.510121    0.862087   1501.00   1501.00    1.000
r(A<->C){all}   0.156590    0.019248    0.000087    0.434955    0.115089    242.32    326.47    1.005
r(A<->G){all}   0.177462    0.021775    0.000082    0.475991    0.141194    195.28    238.03    1.000
r(A<->T){all}   0.173051    0.020877    0.000284    0.460668    0.137895    247.74    251.17    1.000
r(C<->G){all}   0.164295    0.020790    0.000030    0.472423    0.123937     61.37     90.88    1.000
r(C<->T){all}   0.167562    0.020277    0.000046    0.451709    0.128064    206.54    228.65    1.000
r(G<->T){all}   0.161040    0.019518    0.000066    0.453383    0.121080    217.09    276.33    1.009
pi(A){all}      0.151888    0.000152    0.127020    0.175163    0.151506    948.51   1173.51    1.000
pi(C){all}      0.276488    0.000231    0.247005    0.305820    0.276550   1308.81   1316.66    1.000
pi(G){all}      0.361305    0.000278    0.326140    0.390665    0.360952   1100.72   1167.60    1.000
pi(T){all}      0.210318    0.000198    0.184503    0.238991    0.210261   1160.02   1327.65    1.002
alpha{1,2}      0.421111    0.244078    0.000309    1.356907    0.254858    976.15   1066.86    1.000
alpha{3}        0.445313    0.212993    0.000188    1.405540    0.291608   1282.77   1293.91    1.000
pinvar{all}     0.998209    0.000005    0.994181    0.999999    0.998940   1311.05   1369.35    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1083.793902
Model 2: PositiveSelection	-1083.793721
Model 0: one-ratio	-1083.793718
Model 7: beta	-1083.79403
Model 8: beta&w>1	-1083.793718


Model 0 vs 1	3.67999999980384E-4

Model 2 vs 1	3.619999997681589E-4

Model 8 vs 7	6.240000002435409E-4
>C1
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C2
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C3
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C4
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C5
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C6
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=278 

C1              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C2              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C3              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C4              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C5              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C6              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
                **************************************************

C1              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C2              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C3              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C4              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C5              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C6              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
                **************************************************

C1              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C2              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C3              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C4              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C5              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C6              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
                **************************************************

C1              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C2              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C3              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C4              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C5              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C6              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
                **************************************************

C1              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C2              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C3              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C4              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C5              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C6              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
                **************************************************

C1              HQAFAQVEQFTGMPAPREAMACALAGLH
C2              HQAFAQVEQFTGMPAPREAMACALAGLH
C3              HQAFAQVEQFTGMPAPREAMACALAGLH
C4              HQAFAQVEQFTGMPAPREAMACALAGLH
C5              HQAFAQVEQFTGMPAPREAMACALAGLH
C6              HQAFAQVEQFTGMPAPREAMACALAGLH
                ****************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  278 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  278 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [8340]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [8340]--->[8340]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.831 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C2              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C3              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C4              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C5              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C6              VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
                **************************************************

C1              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C2              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C3              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C4              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C5              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C6              AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
                **************************************************

C1              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C2              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C3              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C4              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C5              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C6              TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
                **************************************************

C1              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C2              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C3              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C4              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C5              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C6              TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
                **************************************************

C1              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C2              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C3              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C4              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C5              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C6              VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
                **************************************************

C1              HQAFAQVEQFTGMPAPREAMACALAGLH
C2              HQAFAQVEQFTGMPAPREAMACALAGLH
C3              HQAFAQVEQFTGMPAPREAMACALAGLH
C4              HQAFAQVEQFTGMPAPREAMACALAGLH
C5              HQAFAQVEQFTGMPAPREAMACALAGLH
C6              HQAFAQVEQFTGMPAPREAMACALAGLH
                ****************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C2              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C3              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C4              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C5              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C6              GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
                **************************************************

C1              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C2              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C3              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C4              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C5              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C6              TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
                **************************************************

C1              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C2              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C3              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C4              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C5              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C6              ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
                **************************************************

C1              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C2              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C3              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C4              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C5              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C6              GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
                **************************************************

C1              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C2              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C3              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C4              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C5              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C6              CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
                **************************************************

C1              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C2              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C3              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C4              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C5              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C6              AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
                **************************************************

C1              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C2              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C3              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C4              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C5              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C6              ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
                **************************************************

C1              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C2              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C3              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C4              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C5              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C6              GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
                **************************************************

C1              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C2              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C3              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C4              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C5              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C6              CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
                **************************************************

C1              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C2              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C3              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C4              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C5              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C6              ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
                **************************************************

C1              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C2              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C3              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C4              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C5              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C6              CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
                **************************************************

C1              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C2              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C3              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C4              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C5              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C6              GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
                **************************************************

C1              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C2              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C3              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C4              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C5              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C6              GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
                **************************************************

C1              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C2              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C3              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C4              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C5              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C6              GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
                **************************************************

C1              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C2              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C3              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C4              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C5              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C6              CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
                **************************************************

C1              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C2              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C3              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C4              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C5              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C6              CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
                **************************************************

C1              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C2              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C3              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C4              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C5              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C6              AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
                **********************************



>C1
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C2
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C3
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C4
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C5
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C6
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C1
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C2
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C3
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C4
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C5
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C6
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 834 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579773039
      Setting output file names to "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1874064387
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8317723847
      Seed = 328786654
      Swapseed = 1579773039
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1866.531867 -- -24.965149
         Chain 2 -- -1866.531976 -- -24.965149
         Chain 3 -- -1866.531867 -- -24.965149
         Chain 4 -- -1866.531976 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1866.531867 -- -24.965149
         Chain 2 -- -1866.531976 -- -24.965149
         Chain 3 -- -1866.531976 -- -24.965149
         Chain 4 -- -1866.531976 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1866.532] (-1866.532) (-1866.532) (-1866.532) * [-1866.532] (-1866.532) (-1866.532) (-1866.532) 
        500 -- (-1142.935) (-1144.387) [-1128.310] (-1139.721) * (-1143.242) [-1122.959] (-1121.584) (-1170.442) -- 0:00:00
       1000 -- (-1131.831) [-1123.777] (-1130.196) (-1126.019) * (-1129.714) (-1121.219) [-1128.304] (-1143.733) -- 0:00:00
       1500 -- (-1127.445) (-1128.299) [-1125.712] (-1121.182) * (-1131.573) (-1123.053) [-1124.544] (-1130.926) -- 0:00:00
       2000 -- (-1122.850) [-1131.786] (-1127.596) (-1129.290) * (-1129.593) (-1123.948) (-1126.174) [-1125.934] -- 0:00:00
       2500 -- (-1122.794) (-1124.794) [-1123.848] (-1124.924) * (-1138.275) (-1125.273) (-1127.133) [-1122.914] -- 0:00:00
       3000 -- (-1123.854) (-1129.168) [-1123.216] (-1126.968) * (-1128.922) (-1124.148) (-1125.909) [-1127.124] -- 0:00:00
       3500 -- [-1130.507] (-1128.203) (-1132.203) (-1128.011) * (-1123.389) (-1123.522) (-1131.993) [-1124.157] -- 0:00:00
       4000 -- (-1121.148) (-1130.674) [-1123.829] (-1126.379) * (-1133.271) (-1126.553) (-1125.866) [-1124.151] -- 0:00:00
       4500 -- [-1123.851] (-1126.896) (-1127.647) (-1122.140) * (-1131.885) (-1123.334) [-1122.645] (-1128.068) -- 0:00:00
       5000 -- (-1117.462) [-1130.021] (-1124.685) (-1123.333) * (-1122.257) (-1126.898) [-1120.490] (-1124.819) -- 0:00:00

      Average standard deviation of split frequencies: 0.081983

       5500 -- [-1128.931] (-1127.837) (-1128.043) (-1131.566) * [-1134.211] (-1128.522) (-1125.690) (-1119.892) -- 0:00:00
       6000 -- (-1123.594) [-1129.296] (-1122.473) (-1117.844) * [-1128.819] (-1131.215) (-1125.988) (-1125.875) -- 0:00:00
       6500 -- (-1128.013) (-1125.193) [-1121.319] (-1127.855) * (-1128.026) (-1136.537) [-1125.403] (-1125.564) -- 0:00:00
       7000 -- (-1123.454) (-1124.620) (-1126.190) [-1120.487] * [-1125.083] (-1136.482) (-1121.603) (-1132.875) -- 0:02:21
       7500 -- (-1125.881) [-1117.060] (-1128.136) (-1130.543) * [-1134.040] (-1133.588) (-1125.940) (-1126.667) -- 0:02:12
       8000 -- [-1124.165] (-1124.436) (-1125.216) (-1133.156) * [-1127.327] (-1132.624) (-1122.854) (-1130.848) -- 0:02:04
       8500 -- (-1125.923) [-1122.435] (-1128.714) (-1134.334) * (-1123.775) (-1136.479) (-1123.766) [-1126.685] -- 0:01:56
       9000 -- (-1126.781) [-1122.409] (-1130.608) (-1129.069) * (-1127.981) [-1129.780] (-1125.458) (-1122.492) -- 0:01:50
       9500 -- (-1126.467) [-1125.280] (-1126.772) (-1122.005) * [-1121.883] (-1127.138) (-1123.808) (-1127.146) -- 0:01:44
      10000 -- (-1125.485) (-1127.283) [-1122.784] (-1123.017) * (-1120.255) [-1127.048] (-1120.671) (-1123.565) -- 0:01:39

      Average standard deviation of split frequencies: 0.061030

      10500 -- (-1125.591) [-1124.635] (-1129.189) (-1132.533) * (-1142.408) [-1124.792] (-1123.264) (-1121.218) -- 0:01:34
      11000 -- (-1128.862) (-1127.188) (-1123.303) [-1129.217] * (-1125.934) [-1129.704] (-1127.209) (-1127.853) -- 0:01:29
      11500 -- (-1121.860) (-1128.739) [-1127.154] (-1125.687) * (-1121.346) (-1131.251) [-1125.353] (-1130.673) -- 0:01:25
      12000 -- (-1127.722) (-1123.855) [-1121.255] (-1128.409) * (-1124.387) (-1131.987) [-1126.302] (-1130.618) -- 0:01:22
      12500 -- [-1126.162] (-1126.616) (-1125.685) (-1127.414) * (-1118.675) (-1130.122) (-1129.607) [-1124.173] -- 0:01:19
      13000 -- (-1129.171) [-1125.111] (-1131.025) (-1121.179) * (-1118.688) [-1128.265] (-1129.867) (-1130.324) -- 0:01:15
      13500 -- (-1125.998) (-1133.344) (-1122.850) [-1125.644] * (-1117.797) (-1135.225) (-1127.936) [-1124.008] -- 0:01:13
      14000 -- (-1129.295) (-1134.733) [-1125.765] (-1129.219) * (-1117.449) [-1127.832] (-1120.523) (-1129.693) -- 0:01:10
      14500 -- [-1127.892] (-1126.736) (-1126.466) (-1125.835) * (-1116.940) [-1124.932] (-1118.984) (-1125.981) -- 0:01:07
      15000 -- [-1124.532] (-1121.762) (-1125.059) (-1122.360) * [-1116.133] (-1123.154) (-1118.906) (-1133.410) -- 0:01:05

      Average standard deviation of split frequencies: 0.076257

      15500 -- (-1121.202) (-1129.344) (-1123.702) [-1127.685] * (-1121.610) [-1123.916] (-1116.707) (-1144.819) -- 0:01:03
      16000 -- (-1125.714) (-1135.316) [-1122.036] (-1123.261) * (-1119.509) [-1126.283] (-1119.282) (-1135.370) -- 0:01:01
      16500 -- (-1129.179) (-1134.709) (-1121.142) [-1120.146] * (-1118.552) (-1128.135) [-1116.723] (-1120.329) -- 0:00:59
      17000 -- [-1122.708] (-1141.242) (-1123.732) (-1121.677) * (-1116.406) [-1127.567] (-1116.723) (-1119.235) -- 0:00:57
      17500 -- (-1125.827) (-1127.286) [-1128.801] (-1128.853) * (-1115.785) (-1120.960) (-1120.112) [-1118.066] -- 0:00:56
      18000 -- [-1123.506] (-1132.863) (-1133.656) (-1125.164) * (-1117.371) (-1124.139) [-1117.760] (-1122.590) -- 0:00:54
      18500 -- (-1124.351) [-1125.250] (-1121.897) (-1129.434) * (-1120.836) [-1128.125] (-1115.775) (-1118.416) -- 0:00:53
      19000 -- (-1125.860) [-1127.327] (-1128.427) (-1128.751) * (-1118.366) (-1124.677) [-1119.298] (-1117.931) -- 0:00:51
      19500 -- (-1123.703) (-1134.181) [-1125.568] (-1129.928) * (-1118.410) (-1127.115) [-1115.394] (-1117.002) -- 0:00:50
      20000 -- (-1124.192) (-1124.174) [-1121.477] (-1126.262) * (-1117.961) (-1130.194) [-1115.295] (-1116.166) -- 0:00:49

      Average standard deviation of split frequencies: 0.063361

      20500 -- (-1127.623) (-1123.385) [-1123.815] (-1144.277) * (-1120.062) [-1129.972] (-1115.405) (-1116.218) -- 0:00:47
      21000 -- (-1122.022) (-1125.184) [-1127.125] (-1129.997) * [-1117.607] (-1125.497) (-1117.091) (-1115.408) -- 0:00:46
      21500 -- [-1126.483] (-1124.309) (-1124.089) (-1124.627) * [-1117.994] (-1124.690) (-1118.836) (-1117.902) -- 0:00:45
      22000 -- (-1129.898) (-1128.915) [-1123.710] (-1122.835) * (-1118.380) (-1122.796) [-1117.142] (-1116.759) -- 0:00:44
      22500 -- (-1136.745) (-1127.366) [-1127.425] (-1130.763) * [-1116.485] (-1118.864) (-1116.862) (-1117.187) -- 0:00:43
      23000 -- (-1125.095) (-1132.025) [-1127.314] (-1122.240) * (-1116.332) (-1121.510) (-1117.318) [-1116.703] -- 0:01:24
      23500 -- [-1122.107] (-1136.967) (-1137.981) (-1129.928) * (-1117.356) (-1123.781) (-1118.000) [-1115.873] -- 0:01:23
      24000 -- [-1127.835] (-1124.914) (-1120.967) (-1132.432) * [-1115.251] (-1126.040) (-1116.194) (-1117.816) -- 0:01:21
      24500 -- (-1130.345) [-1127.052] (-1135.290) (-1126.084) * (-1116.584) (-1123.889) (-1116.902) [-1117.279] -- 0:01:19
      25000 -- [-1123.740] (-1133.356) (-1123.750) (-1138.917) * (-1117.603) [-1122.801] (-1117.124) (-1117.753) -- 0:01:18

      Average standard deviation of split frequencies: 0.061488

      25500 -- (-1126.143) (-1124.276) (-1133.435) [-1121.958] * (-1116.142) (-1142.389) (-1116.777) [-1116.891] -- 0:01:16
      26000 -- [-1120.721] (-1134.248) (-1128.568) (-1132.403) * (-1116.964) (-1132.405) (-1121.641) [-1116.861] -- 0:01:14
      26500 -- (-1129.012) (-1128.781) (-1128.470) [-1125.104] * (-1116.248) (-1132.472) (-1116.902) [-1118.282] -- 0:01:13
      27000 -- [-1127.940] (-1128.903) (-1128.426) (-1129.389) * [-1117.752] (-1132.144) (-1118.417) (-1118.173) -- 0:01:12
      27500 -- (-1130.481) (-1125.634) (-1123.083) [-1127.148] * (-1117.780) (-1124.734) [-1117.833] (-1117.101) -- 0:01:10
      28000 -- [-1124.590] (-1130.709) (-1121.846) (-1136.214) * (-1118.202) (-1120.849) (-1116.794) [-1117.117] -- 0:01:09
      28500 -- (-1133.760) (-1129.612) [-1119.816] (-1127.138) * (-1117.425) (-1129.897) [-1116.391] (-1119.647) -- 0:01:08
      29000 -- (-1125.765) (-1123.921) (-1132.117) [-1125.812] * [-1117.521] (-1122.388) (-1115.790) (-1117.427) -- 0:01:06
      29500 -- (-1128.417) (-1126.315) [-1123.131] (-1123.025) * (-1119.766) (-1129.774) (-1125.280) [-1116.923] -- 0:01:05
      30000 -- [-1129.127] (-1126.851) (-1134.051) (-1136.732) * [-1116.666] (-1123.010) (-1117.146) (-1116.913) -- 0:01:04

      Average standard deviation of split frequencies: 0.048212

      30500 -- (-1126.137) [-1129.652] (-1121.899) (-1130.093) * (-1117.865) (-1135.932) (-1118.137) [-1117.625] -- 0:01:03
      31000 -- [-1124.863] (-1128.077) (-1119.261) (-1125.526) * [-1115.443] (-1132.328) (-1118.735) (-1119.580) -- 0:01:02
      31500 -- (-1123.419) (-1129.524) [-1123.102] (-1121.269) * (-1115.905) (-1121.668) [-1118.899] (-1116.141) -- 0:01:01
      32000 -- (-1135.030) (-1128.342) (-1126.060) [-1129.613] * (-1115.730) (-1128.291) (-1117.023) [-1115.931] -- 0:01:00
      32500 -- [-1126.663] (-1127.525) (-1122.022) (-1127.445) * (-1117.627) (-1123.963) [-1116.846] (-1116.002) -- 0:00:59
      33000 -- (-1124.204) (-1137.143) [-1123.075] (-1121.637) * (-1117.875) (-1128.942) [-1118.718] (-1117.594) -- 0:00:58
      33500 -- [-1130.249] (-1133.321) (-1124.140) (-1129.610) * [-1118.190] (-1121.653) (-1117.231) (-1118.031) -- 0:00:57
      34000 -- (-1130.683) (-1131.784) [-1128.339] (-1127.856) * (-1122.288) [-1125.243] (-1115.702) (-1118.914) -- 0:00:56
      34500 -- (-1124.818) (-1124.210) (-1127.346) [-1120.017] * (-1123.034) (-1133.046) (-1116.180) [-1121.463] -- 0:00:55
      35000 -- (-1130.469) (-1125.432) (-1132.619) [-1124.436] * (-1121.960) (-1135.354) [-1121.954] (-1120.280) -- 0:00:55

      Average standard deviation of split frequencies: 0.046176

      35500 -- [-1126.414] (-1126.071) (-1124.077) (-1141.225) * [-1117.725] (-1125.951) (-1119.561) (-1116.525) -- 0:00:54
      36000 -- (-1121.419) (-1125.041) (-1131.442) [-1121.181] * (-1119.516) (-1125.675) (-1116.966) [-1118.517] -- 0:00:53
      36500 -- (-1126.493) [-1121.462] (-1125.783) (-1126.928) * (-1120.126) [-1133.345] (-1117.533) (-1119.697) -- 0:00:52
      37000 -- [-1126.306] (-1117.705) (-1129.423) (-1124.544) * (-1117.592) (-1126.026) [-1117.945] (-1117.710) -- 0:00:52
      37500 -- (-1126.491) (-1115.646) [-1125.318] (-1128.397) * [-1117.993] (-1134.745) (-1118.857) (-1117.932) -- 0:00:51
      38000 -- (-1145.252) (-1116.313) (-1133.497) [-1120.903] * [-1118.025] (-1121.762) (-1118.445) (-1116.553) -- 0:00:50
      38500 -- (-1124.918) (-1115.993) [-1120.779] (-1124.906) * (-1116.708) (-1125.064) (-1120.077) [-1118.991] -- 0:00:49
      39000 -- (-1118.399) (-1115.820) (-1125.116) [-1125.727] * (-1116.434) [-1128.121] (-1121.129) (-1116.368) -- 0:01:13
      39500 -- (-1115.857) (-1115.735) (-1128.898) [-1118.650] * (-1119.536) [-1124.366] (-1118.615) (-1116.111) -- 0:01:12
      40000 -- (-1120.242) [-1116.219] (-1124.070) (-1124.441) * (-1118.396) (-1124.487) (-1118.091) [-1116.238] -- 0:01:12

      Average standard deviation of split frequencies: 0.044919

      40500 -- (-1118.671) (-1118.384) (-1138.135) [-1130.626] * (-1117.946) [-1123.958] (-1118.207) (-1116.062) -- 0:01:11
      41000 -- [-1116.236] (-1115.641) (-1158.928) (-1125.851) * [-1116.756] (-1127.025) (-1117.490) (-1119.081) -- 0:01:10
      41500 -- (-1118.176) (-1118.692) [-1119.079] (-1125.905) * (-1118.003) (-1128.961) [-1117.344] (-1118.264) -- 0:01:09
      42000 -- (-1116.519) (-1121.265) (-1115.371) [-1122.209] * (-1116.468) (-1132.658) [-1116.542] (-1117.917) -- 0:01:08
      42500 -- (-1117.757) [-1117.292] (-1117.350) (-1122.739) * (-1118.889) (-1125.178) [-1120.290] (-1115.906) -- 0:01:07
      43000 -- [-1119.182] (-1117.195) (-1117.068) (-1126.921) * (-1118.888) (-1126.136) (-1117.575) [-1117.362] -- 0:01:06
      43500 -- (-1119.597) (-1115.251) [-1116.584] (-1121.525) * (-1118.259) (-1130.575) [-1116.876] (-1118.797) -- 0:01:05
      44000 -- (-1119.384) (-1115.546) [-1117.390] (-1127.394) * (-1115.727) (-1127.697) [-1116.608] (-1116.276) -- 0:01:05
      44500 -- (-1115.373) (-1120.582) [-1118.736] (-1126.765) * (-1116.451) (-1129.544) [-1119.743] (-1118.235) -- 0:01:04
      45000 -- (-1116.879) (-1119.271) (-1117.409) [-1125.991] * [-1116.451] (-1123.957) (-1116.051) (-1116.626) -- 0:01:03

      Average standard deviation of split frequencies: 0.039374

      45500 -- (-1117.294) (-1115.520) [-1116.752] (-1122.332) * (-1115.351) (-1129.692) [-1117.639] (-1116.439) -- 0:01:02
      46000 -- (-1116.390) (-1115.955) [-1117.230] (-1128.492) * (-1117.658) (-1124.532) [-1116.488] (-1116.436) -- 0:01:02
      46500 -- [-1115.343] (-1117.837) (-1117.115) (-1125.021) * (-1117.065) (-1127.534) [-1117.578] (-1116.491) -- 0:01:01
      47000 -- (-1117.576) [-1116.708] (-1116.199) (-1128.040) * [-1117.876] (-1123.018) (-1117.304) (-1116.489) -- 0:01:00
      47500 -- (-1118.999) (-1119.836) [-1116.333] (-1124.295) * (-1117.015) (-1133.025) [-1115.723] (-1115.215) -- 0:01:00
      48000 -- (-1118.180) (-1116.411) (-1116.471) [-1141.831] * (-1121.390) (-1125.941) (-1117.155) [-1115.769] -- 0:00:59
      48500 -- (-1123.013) (-1119.552) [-1115.404] (-1122.420) * [-1117.137] (-1132.222) (-1118.392) (-1115.647) -- 0:00:58
      49000 -- (-1117.142) (-1118.292) (-1116.506) [-1123.851] * (-1116.306) [-1123.937] (-1119.397) (-1115.777) -- 0:00:58
      49500 -- [-1116.788] (-1119.191) (-1117.431) (-1132.920) * (-1116.575) (-1122.251) (-1120.817) [-1118.593] -- 0:00:57
      50000 -- (-1115.650) (-1117.755) (-1120.179) [-1121.691] * [-1116.512] (-1126.587) (-1122.825) (-1119.825) -- 0:00:57

      Average standard deviation of split frequencies: 0.034115

      50500 -- (-1118.248) (-1118.338) (-1118.229) [-1120.652] * (-1117.048) [-1130.026] (-1116.877) (-1117.951) -- 0:00:56
      51000 -- [-1117.270] (-1117.678) (-1116.958) (-1126.900) * (-1116.938) [-1127.331] (-1115.855) (-1120.474) -- 0:00:55
      51500 -- (-1115.410) (-1117.657) (-1115.795) [-1123.003] * (-1116.358) (-1128.939) [-1115.678] (-1123.286) -- 0:00:55
      52000 -- (-1115.489) (-1116.429) (-1115.809) [-1125.844] * [-1116.927] (-1125.287) (-1115.462) (-1120.159) -- 0:00:54
      52500 -- (-1116.390) (-1117.863) [-1115.333] (-1127.887) * (-1117.255) [-1128.280] (-1115.464) (-1118.726) -- 0:00:54
      53000 -- (-1117.266) (-1118.343) [-1116.153] (-1122.157) * (-1117.224) (-1122.694) (-1120.129) [-1117.309] -- 0:00:53
      53500 -- (-1123.063) (-1119.554) [-1120.152] (-1133.035) * (-1120.327) [-1122.176] (-1116.849) (-1121.151) -- 0:00:53
      54000 -- [-1116.939] (-1117.495) (-1121.409) (-1127.251) * (-1118.040) (-1129.054) (-1116.767) [-1120.905] -- 0:00:52
      54500 -- (-1117.702) (-1117.236) [-1117.813] (-1123.147) * (-1116.600) [-1129.800] (-1118.383) (-1117.150) -- 0:00:52
      55000 -- [-1117.219] (-1117.508) (-1117.582) (-1125.600) * (-1121.174) (-1125.200) [-1115.353] (-1115.950) -- 0:01:08

      Average standard deviation of split frequencies: 0.038128

      55500 -- (-1118.034) (-1119.848) [-1116.172] (-1135.070) * (-1118.967) (-1131.316) [-1117.292] (-1118.585) -- 0:01:08
      56000 -- (-1118.260) (-1119.226) [-1115.738] (-1130.953) * [-1118.632] (-1127.826) (-1121.697) (-1118.140) -- 0:01:07
      56500 -- (-1115.466) [-1121.361] (-1117.357) (-1134.350) * [-1117.774] (-1129.804) (-1119.162) (-1116.425) -- 0:01:06
      57000 -- (-1118.733) (-1119.663) (-1118.421) [-1121.868] * (-1117.594) (-1123.441) (-1124.012) [-1117.465] -- 0:01:06
      57500 -- (-1121.215) [-1117.733] (-1119.372) (-1124.065) * [-1117.595] (-1123.061) (-1119.898) (-1119.215) -- 0:01:05
      58000 -- [-1119.076] (-1119.354) (-1122.627) (-1130.983) * (-1116.990) [-1125.965] (-1119.644) (-1116.844) -- 0:01:04
      58500 -- (-1117.675) [-1117.110] (-1120.440) (-1140.017) * (-1117.629) (-1123.477) [-1121.354] (-1119.469) -- 0:01:04
      59000 -- (-1116.529) (-1115.867) (-1116.882) [-1137.033] * (-1117.076) (-1127.163) [-1117.793] (-1118.407) -- 0:01:03
      59500 -- (-1128.853) (-1115.983) (-1117.273) [-1121.886] * [-1116.505] (-1129.874) (-1117.555) (-1116.647) -- 0:01:03
      60000 -- (-1119.450) (-1118.542) (-1115.433) [-1126.191] * (-1117.333) [-1130.957] (-1117.653) (-1116.621) -- 0:01:02

      Average standard deviation of split frequencies: 0.033240

      60500 -- (-1116.962) (-1116.449) [-1116.047] (-1149.301) * [-1118.230] (-1130.901) (-1118.953) (-1117.152) -- 0:01:02
      61000 -- [-1122.347] (-1115.995) (-1118.555) (-1121.626) * (-1116.467) [-1123.999] (-1119.729) (-1118.260) -- 0:01:01
      61500 -- [-1116.117] (-1116.110) (-1116.161) (-1118.967) * (-1116.222) (-1128.760) (-1118.755) [-1120.540] -- 0:01:01
      62000 -- (-1117.430) [-1114.996] (-1115.064) (-1115.370) * [-1116.872] (-1135.188) (-1117.386) (-1121.965) -- 0:01:00
      62500 -- (-1115.194) [-1115.314] (-1117.574) (-1115.463) * [-1119.370] (-1126.195) (-1120.585) (-1117.201) -- 0:01:00
      63000 -- (-1115.502) (-1115.332) [-1116.780] (-1115.965) * (-1119.094) (-1146.155) [-1118.756] (-1122.561) -- 0:00:59
      63500 -- [-1115.758] (-1116.150) (-1116.787) (-1119.421) * (-1119.074) [-1122.897] (-1116.954) (-1121.655) -- 0:00:58
      64000 -- [-1119.079] (-1116.955) (-1115.971) (-1119.654) * [-1118.760] (-1131.526) (-1117.819) (-1117.958) -- 0:00:58
      64500 -- (-1116.452) (-1120.319) [-1118.521] (-1117.726) * (-1119.996) (-1121.151) (-1118.249) [-1118.986] -- 0:00:58
      65000 -- (-1116.586) (-1117.238) (-1117.038) [-1116.870] * (-1119.237) (-1119.910) (-1116.723) [-1115.686] -- 0:00:57

      Average standard deviation of split frequencies: 0.025713

      65500 -- (-1121.015) (-1116.359) (-1116.416) [-1116.329] * (-1117.832) (-1116.788) (-1117.001) [-1117.164] -- 0:00:57
      66000 -- (-1116.276) (-1116.125) [-1116.727] (-1115.878) * (-1117.390) [-1116.706] (-1116.657) (-1118.823) -- 0:00:56
      66500 -- (-1117.263) (-1117.030) (-1117.489) [-1116.335] * (-1115.796) (-1115.470) (-1117.407) [-1116.076] -- 0:00:56
      67000 -- [-1116.407] (-1116.879) (-1116.025) (-1118.839) * (-1117.627) [-1117.239] (-1117.743) (-1117.480) -- 0:00:55
      67500 -- (-1115.513) [-1116.236] (-1116.978) (-1118.540) * [-1121.236] (-1117.282) (-1115.598) (-1118.678) -- 0:00:55
      68000 -- [-1116.997] (-1117.659) (-1116.811) (-1120.790) * (-1125.346) [-1115.970] (-1117.551) (-1118.759) -- 0:00:54
      68500 -- [-1117.555] (-1118.371) (-1117.182) (-1117.574) * (-1119.828) (-1116.582) [-1119.160] (-1118.513) -- 0:00:54
      69000 -- (-1117.072) (-1118.892) [-1119.864] (-1119.333) * [-1118.593] (-1116.574) (-1121.593) (-1119.358) -- 0:00:53
      69500 -- (-1120.820) (-1117.489) (-1119.006) [-1119.139] * (-1117.370) [-1116.598] (-1115.285) (-1116.421) -- 0:00:53
      70000 -- [-1117.918] (-1115.789) (-1122.130) (-1118.195) * (-1117.158) (-1115.793) (-1117.372) [-1116.635] -- 0:00:53

      Average standard deviation of split frequencies: 0.026016

      70500 -- (-1118.616) (-1117.350) (-1115.382) [-1115.684] * (-1117.049) (-1115.284) (-1116.029) [-1116.121] -- 0:00:52
      71000 -- [-1118.098] (-1121.764) (-1118.060) (-1116.975) * [-1116.545] (-1115.445) (-1117.623) (-1115.162) -- 0:01:05
      71500 -- (-1119.614) (-1116.991) [-1116.058] (-1115.792) * (-1115.332) (-1116.696) (-1115.676) [-1118.440] -- 0:01:04
      72000 -- (-1117.996) (-1117.495) (-1115.527) [-1115.288] * [-1117.109] (-1116.591) (-1116.523) (-1116.758) -- 0:01:04
      72500 -- (-1117.939) [-1116.587] (-1119.252) (-1115.298) * (-1117.831) [-1117.132] (-1116.685) (-1115.331) -- 0:01:03
      73000 -- (-1118.294) (-1118.041) (-1123.002) [-1116.498] * (-1118.465) [-1115.850] (-1117.815) (-1115.636) -- 0:01:03
      73500 -- (-1116.126) (-1118.768) (-1119.922) [-1117.825] * (-1117.276) (-1116.147) (-1119.115) [-1115.977] -- 0:01:03
      74000 -- [-1122.320] (-1116.234) (-1123.561) (-1118.134) * (-1117.724) [-1119.127] (-1119.416) (-1117.078) -- 0:01:02
      74500 -- (-1115.525) (-1117.070) (-1119.128) [-1116.996] * (-1117.184) [-1118.995] (-1117.532) (-1118.068) -- 0:01:02
      75000 -- (-1117.293) (-1120.371) (-1117.229) [-1119.386] * (-1117.972) [-1117.398] (-1117.564) (-1116.814) -- 0:01:01

      Average standard deviation of split frequencies: 0.027292

      75500 -- (-1117.401) (-1117.276) [-1118.299] (-1117.431) * (-1118.391) [-1117.828] (-1117.326) (-1116.264) -- 0:01:01
      76000 -- (-1117.591) [-1117.200] (-1116.123) (-1116.412) * [-1114.962] (-1118.360) (-1115.755) (-1117.034) -- 0:01:00
      76500 -- (-1118.605) [-1115.589] (-1115.873) (-1116.036) * [-1116.711] (-1116.133) (-1116.952) (-1117.541) -- 0:01:00
      77000 -- [-1117.572] (-1115.619) (-1117.840) (-1118.986) * (-1114.821) (-1117.451) [-1116.350] (-1117.930) -- 0:00:59
      77500 -- (-1117.053) (-1115.676) (-1117.768) [-1115.498] * (-1114.819) [-1115.865] (-1117.210) (-1117.710) -- 0:00:59
      78000 -- (-1117.739) (-1116.622) (-1116.014) [-1118.438] * (-1117.695) (-1115.048) [-1115.484] (-1119.542) -- 0:00:59
      78500 -- (-1117.500) [-1116.651] (-1116.020) (-1116.462) * [-1117.872] (-1115.687) (-1115.484) (-1121.331) -- 0:00:58
      79000 -- (-1119.523) (-1116.122) (-1121.230) [-1116.486] * (-1118.566) (-1117.239) (-1118.282) [-1116.781] -- 0:00:58
      79500 -- (-1118.138) (-1119.251) [-1115.464] (-1118.745) * (-1117.577) (-1118.244) [-1116.755] (-1115.666) -- 0:00:57
      80000 -- (-1117.220) (-1117.868) [-1120.690] (-1115.387) * (-1119.400) (-1117.193) (-1116.584) [-1117.538] -- 0:00:57

      Average standard deviation of split frequencies: 0.026451

      80500 -- [-1117.307] (-1115.263) (-1119.912) (-1124.032) * [-1116.593] (-1115.750) (-1117.621) (-1116.564) -- 0:00:57
      81000 -- (-1117.125) [-1119.481] (-1118.465) (-1121.217) * (-1117.538) (-1115.398) [-1117.622] (-1115.624) -- 0:00:56
      81500 -- (-1117.177) (-1116.449) [-1119.254] (-1118.062) * (-1118.073) [-1115.663] (-1119.370) (-1116.773) -- 0:00:56
      82000 -- (-1117.180) (-1115.414) [-1115.640] (-1120.612) * [-1116.386] (-1115.581) (-1118.406) (-1122.092) -- 0:00:55
      82500 -- (-1118.057) [-1116.498] (-1115.922) (-1117.144) * (-1116.281) [-1118.848] (-1117.603) (-1119.116) -- 0:00:55
      83000 -- (-1119.637) (-1116.990) (-1117.463) [-1118.010] * [-1116.641] (-1131.825) (-1115.215) (-1118.278) -- 0:00:55
      83500 -- (-1118.149) [-1116.592] (-1118.912) (-1118.459) * (-1117.690) (-1118.882) [-1115.482] (-1121.264) -- 0:00:54
      84000 -- (-1115.967) (-1115.967) (-1117.025) [-1128.086] * (-1117.942) (-1116.873) (-1116.453) [-1120.691] -- 0:00:54
      84500 -- [-1117.250] (-1117.671) (-1120.377) (-1125.493) * (-1115.680) [-1117.656] (-1117.858) (-1115.538) -- 0:00:54
      85000 -- (-1118.453) (-1117.029) (-1115.806) [-1117.953] * (-1118.200) (-1116.723) [-1116.914] (-1115.651) -- 0:00:53

      Average standard deviation of split frequencies: 0.024522

      85500 -- [-1119.400] (-1115.602) (-1120.556) (-1115.366) * [-1115.378] (-1120.099) (-1119.958) (-1118.112) -- 0:00:53
      86000 -- [-1116.261] (-1118.719) (-1118.659) (-1116.427) * (-1116.210) (-1116.585) [-1116.353] (-1118.171) -- 0:00:53
      86500 -- (-1116.020) (-1116.517) [-1115.651] (-1115.756) * (-1115.357) [-1116.720] (-1116.166) (-1119.049) -- 0:00:52
      87000 -- (-1118.505) (-1117.726) [-1115.083] (-1118.484) * [-1117.302] (-1116.644) (-1116.763) (-1116.105) -- 0:00:52
      87500 -- (-1116.624) (-1117.005) [-1115.527] (-1116.106) * (-1119.228) [-1116.367] (-1116.005) (-1117.217) -- 0:01:02
      88000 -- (-1117.033) [-1116.053] (-1115.740) (-1117.350) * (-1116.339) (-1116.361) (-1117.016) [-1115.639] -- 0:01:02
      88500 -- [-1115.451] (-1118.604) (-1119.725) (-1119.003) * [-1117.603] (-1116.747) (-1117.402) (-1115.036) -- 0:01:01
      89000 -- [-1120.903] (-1116.675) (-1117.890) (-1118.795) * (-1117.340) [-1115.307] (-1116.191) (-1116.774) -- 0:01:01
      89500 -- (-1121.452) [-1120.336] (-1116.323) (-1116.537) * (-1116.824) (-1116.212) (-1116.083) [-1116.288] -- 0:01:01
      90000 -- (-1119.868) (-1122.721) [-1117.947] (-1118.177) * (-1120.105) (-1118.203) (-1121.159) [-1119.837] -- 0:01:00

      Average standard deviation of split frequencies: 0.025723

      90500 -- (-1115.893) [-1123.506] (-1116.984) (-1115.927) * (-1120.016) [-1116.368] (-1117.828) (-1116.409) -- 0:01:00
      91000 -- [-1116.708] (-1119.829) (-1117.581) (-1115.368) * (-1121.662) (-1116.774) [-1118.220] (-1119.520) -- 0:00:59
      91500 -- [-1116.867] (-1118.957) (-1119.654) (-1115.606) * (-1116.106) (-1116.229) (-1116.444) [-1119.001] -- 0:00:59
      92000 -- [-1118.521] (-1116.866) (-1115.831) (-1115.904) * (-1116.892) [-1117.397] (-1117.035) (-1118.835) -- 0:00:59
      92500 -- (-1118.338) (-1117.239) (-1115.831) [-1116.346] * (-1115.589) (-1118.923) [-1115.984] (-1117.883) -- 0:00:58
      93000 -- (-1119.482) (-1115.725) (-1117.530) [-1115.871] * (-1116.253) (-1116.346) [-1116.264] (-1116.695) -- 0:00:58
      93500 -- (-1120.022) [-1118.672] (-1118.795) (-1116.988) * (-1116.733) (-1115.248) [-1116.192] (-1118.481) -- 0:00:58
      94000 -- [-1117.223] (-1118.555) (-1120.083) (-1115.238) * [-1115.476] (-1116.164) (-1118.014) (-1117.505) -- 0:00:57
      94500 -- (-1116.644) (-1116.303) [-1117.067] (-1120.711) * (-1115.053) (-1115.356) [-1115.628] (-1119.607) -- 0:00:57
      95000 -- (-1116.329) (-1115.969) [-1117.430] (-1118.375) * [-1116.320] (-1115.866) (-1118.622) (-1116.376) -- 0:00:57

      Average standard deviation of split frequencies: 0.024061

      95500 -- (-1117.793) (-1116.793) [-1117.474] (-1118.378) * [-1116.287] (-1115.347) (-1115.864) (-1118.508) -- 0:00:56
      96000 -- (-1115.975) (-1116.079) [-1119.206] (-1117.052) * (-1120.739) (-1115.384) [-1116.146] (-1116.521) -- 0:00:56
      96500 -- [-1115.225] (-1116.765) (-1116.304) (-1118.615) * (-1117.573) (-1115.776) (-1118.035) [-1115.634] -- 0:00:56
      97000 -- [-1115.426] (-1117.275) (-1116.363) (-1118.618) * (-1117.339) (-1116.494) (-1123.454) [-1116.260] -- 0:00:55
      97500 -- (-1115.320) (-1117.645) (-1118.718) [-1119.183] * [-1118.493] (-1119.081) (-1119.613) (-1124.871) -- 0:00:55
      98000 -- [-1116.124] (-1115.292) (-1120.024) (-1127.291) * (-1117.811) (-1117.794) [-1116.941] (-1120.310) -- 0:00:55
      98500 -- (-1118.190) [-1115.233] (-1118.983) (-1120.112) * (-1119.662) [-1117.687] (-1118.176) (-1117.707) -- 0:00:54
      99000 -- (-1117.057) (-1116.200) (-1116.328) [-1117.554] * (-1117.683) (-1116.929) (-1119.812) [-1117.089] -- 0:00:54
      99500 -- (-1117.253) (-1116.963) [-1115.050] (-1116.149) * (-1117.675) (-1119.583) [-1119.646] (-1120.435) -- 0:00:54
      100000 -- [-1115.198] (-1117.769) (-1120.738) (-1115.896) * (-1118.313) [-1117.543] (-1118.584) (-1117.800) -- 0:00:54

      Average standard deviation of split frequencies: 0.021196

      100500 -- (-1117.843) (-1116.848) [-1118.502] (-1115.719) * (-1119.860) [-1115.312] (-1116.228) (-1118.846) -- 0:00:53
      101000 -- (-1116.591) (-1116.601) [-1117.252] (-1115.884) * [-1120.038] (-1115.318) (-1116.336) (-1118.112) -- 0:00:53
      101500 -- (-1117.176) (-1115.177) (-1119.063) [-1118.579] * (-1122.618) (-1116.164) (-1117.172) [-1117.035] -- 0:00:53
      102000 -- (-1116.861) (-1115.329) [-1121.203] (-1115.229) * (-1120.058) (-1118.109) (-1118.762) [-1116.946] -- 0:00:52
      102500 -- (-1115.855) (-1115.328) [-1117.943] (-1117.062) * (-1122.431) [-1118.492] (-1116.175) (-1118.247) -- 0:00:52
      103000 -- (-1117.346) (-1115.866) (-1119.130) [-1116.419] * (-1124.001) [-1117.955] (-1117.549) (-1121.338) -- 0:01:00
      103500 -- [-1118.375] (-1116.227) (-1119.856) (-1117.021) * (-1118.445) (-1116.750) (-1115.299) [-1117.720] -- 0:01:00
      104000 -- (-1117.043) (-1118.432) [-1115.177] (-1117.436) * (-1118.478) (-1122.396) [-1115.580] (-1117.762) -- 0:01:00
      104500 -- (-1119.054) (-1122.282) [-1115.182] (-1118.114) * (-1118.287) (-1121.728) [-1116.114] (-1117.334) -- 0:00:59
      105000 -- [-1117.460] (-1118.200) (-1116.131) (-1124.065) * (-1118.744) (-1121.279) [-1116.065] (-1120.732) -- 0:00:59

      Average standard deviation of split frequencies: 0.017587

      105500 -- (-1116.262) [-1117.458] (-1122.237) (-1119.980) * (-1117.811) (-1117.613) (-1116.606) [-1119.618] -- 0:00:59
      106000 -- [-1115.524] (-1119.042) (-1121.517) (-1116.458) * (-1117.464) (-1117.056) (-1117.017) [-1121.118] -- 0:00:59
      106500 -- (-1117.147) [-1116.336] (-1118.839) (-1116.053) * (-1117.543) (-1116.557) [-1116.815] (-1117.178) -- 0:00:58
      107000 -- [-1117.604] (-1119.642) (-1118.406) (-1116.276) * (-1117.511) (-1116.274) [-1115.531] (-1121.100) -- 0:00:58
      107500 -- [-1115.518] (-1116.470) (-1117.859) (-1116.954) * (-1119.560) [-1115.289] (-1116.296) (-1121.942) -- 0:00:58
      108000 -- (-1116.409) (-1115.715) [-1116.960] (-1118.879) * (-1118.722) [-1116.279] (-1115.377) (-1116.330) -- 0:00:57
      108500 -- (-1116.699) (-1116.395) [-1116.725] (-1118.048) * (-1116.802) (-1116.332) (-1117.971) [-1116.342] -- 0:00:57
      109000 -- (-1121.054) [-1116.975] (-1122.345) (-1116.819) * (-1118.204) (-1117.297) [-1116.661] (-1115.525) -- 0:00:57
      109500 -- (-1121.316) (-1116.629) [-1119.644] (-1117.183) * (-1117.190) [-1118.732] (-1118.833) (-1119.229) -- 0:00:56
      110000 -- [-1116.268] (-1117.627) (-1117.840) (-1117.425) * (-1118.658) [-1117.917] (-1119.776) (-1116.077) -- 0:00:56

      Average standard deviation of split frequencies: 0.019067

      110500 -- (-1116.487) [-1116.346] (-1116.174) (-1120.869) * (-1115.242) [-1117.716] (-1118.365) (-1117.207) -- 0:00:56
      111000 -- (-1119.494) (-1115.949) [-1121.206] (-1116.414) * (-1118.853) (-1117.203) (-1115.513) [-1115.843] -- 0:00:56
      111500 -- (-1120.421) (-1116.997) (-1115.842) [-1115.954] * [-1117.272] (-1116.916) (-1116.039) (-1120.941) -- 0:00:55
      112000 -- (-1117.678) (-1115.362) (-1116.771) [-1116.081] * (-1115.307) (-1117.452) [-1120.328] (-1115.804) -- 0:00:55
      112500 -- (-1116.487) (-1117.657) [-1116.907] (-1117.276) * (-1117.166) (-1118.564) (-1119.014) [-1119.888] -- 0:00:55
      113000 -- (-1116.510) (-1115.665) [-1116.720] (-1118.419) * [-1118.874] (-1118.515) (-1118.050) (-1121.985) -- 0:00:54
      113500 -- [-1116.166] (-1115.446) (-1116.982) (-1117.739) * (-1121.703) [-1117.278] (-1118.617) (-1127.272) -- 0:00:54
      114000 -- (-1116.746) (-1115.370) [-1117.844] (-1118.285) * (-1121.703) (-1116.564) [-1118.034] (-1121.707) -- 0:00:54
      114500 -- (-1116.038) (-1115.189) (-1117.337) [-1117.150] * (-1120.666) (-1118.287) (-1117.688) [-1121.403] -- 0:00:54
      115000 -- (-1115.741) (-1117.304) (-1117.559) [-1116.757] * (-1117.979) (-1118.195) [-1118.235] (-1119.883) -- 0:00:53

      Average standard deviation of split frequencies: 0.016836

      115500 -- [-1117.533] (-1120.325) (-1117.297) (-1116.559) * (-1119.274) (-1118.571) (-1119.958) [-1116.084] -- 0:00:53
      116000 -- (-1118.797) (-1120.964) [-1117.055] (-1115.854) * (-1115.700) (-1118.865) (-1116.870) [-1116.122] -- 0:00:53
      116500 -- (-1115.645) (-1125.156) [-1117.638] (-1119.989) * [-1118.554] (-1117.299) (-1115.911) (-1115.835) -- 0:00:53
      117000 -- [-1116.015] (-1116.853) (-1118.437) (-1122.276) * (-1117.579) (-1119.477) [-1117.724] (-1116.025) -- 0:00:52
      117500 -- (-1116.671) (-1115.321) [-1117.249] (-1119.867) * [-1120.751] (-1116.920) (-1121.648) (-1117.921) -- 0:00:52
      118000 -- (-1116.357) (-1120.847) [-1117.699] (-1116.235) * [-1116.578] (-1122.188) (-1116.685) (-1118.081) -- 0:00:52
      118500 -- (-1116.127) (-1122.460) [-1118.147] (-1115.285) * (-1118.753) (-1118.528) [-1115.665] (-1115.704) -- 0:00:52
      119000 -- (-1117.237) [-1121.068] (-1119.097) (-1117.346) * (-1117.835) [-1116.961] (-1115.512) (-1115.739) -- 0:00:51
      119500 -- (-1117.805) (-1121.956) [-1117.428] (-1120.119) * [-1116.312] (-1116.584) (-1117.482) (-1115.803) -- 0:00:58
      120000 -- (-1118.273) [-1116.956] (-1116.977) (-1115.529) * (-1118.543) (-1116.306) (-1120.734) [-1115.710] -- 0:00:58

      Average standard deviation of split frequencies: 0.016017

      120500 -- (-1117.800) [-1121.412] (-1115.846) (-1115.514) * (-1118.526) (-1120.240) (-1116.696) [-1114.965] -- 0:00:58
      121000 -- [-1118.005] (-1119.065) (-1115.819) (-1115.617) * [-1116.409] (-1118.767) (-1115.479) (-1115.389) -- 0:00:58
      121500 -- (-1119.480) [-1120.041] (-1119.635) (-1123.012) * (-1116.863) (-1117.952) [-1120.107] (-1116.911) -- 0:00:57
      122000 -- (-1117.163) (-1119.721) [-1117.671] (-1116.210) * (-1117.709) (-1116.929) (-1117.184) [-1116.977] -- 0:00:57
      122500 -- (-1115.909) (-1122.014) [-1124.021] (-1116.207) * (-1116.194) (-1117.304) (-1116.252) [-1115.680] -- 0:00:57
      123000 -- (-1119.626) (-1119.203) [-1119.649] (-1116.279) * (-1117.078) (-1116.028) [-1118.107] (-1116.438) -- 0:00:57
      123500 -- (-1120.488) (-1118.207) [-1117.190] (-1116.177) * (-1121.380) (-1118.625) [-1117.651] (-1116.125) -- 0:00:56
      124000 -- (-1121.203) (-1115.825) (-1117.181) [-1117.265] * (-1117.204) [-1119.428] (-1116.116) (-1116.941) -- 0:00:56
      124500 -- (-1118.468) [-1115.315] (-1116.994) (-1116.955) * (-1119.268) (-1119.264) (-1116.346) [-1118.227] -- 0:00:56
      125000 -- (-1122.741) (-1116.309) [-1116.229] (-1116.531) * (-1116.570) (-1119.905) [-1116.263] (-1117.079) -- 0:00:56

      Average standard deviation of split frequencies: 0.018172

      125500 -- (-1117.537) [-1115.739] (-1115.187) (-1116.982) * (-1117.956) (-1118.229) [-1116.300] (-1117.078) -- 0:00:55
      126000 -- (-1116.763) (-1116.219) (-1116.347) [-1118.273] * [-1117.347] (-1116.517) (-1116.833) (-1116.209) -- 0:00:55
      126500 -- (-1116.194) [-1116.557] (-1118.108) (-1116.843) * (-1118.786) (-1115.791) (-1117.546) [-1120.901] -- 0:00:55
      127000 -- (-1119.524) [-1116.681] (-1118.758) (-1116.522) * (-1115.241) [-1116.063] (-1118.182) (-1118.714) -- 0:00:54
      127500 -- (-1116.380) [-1118.243] (-1118.299) (-1117.842) * (-1115.212) (-1115.639) [-1119.077] (-1118.631) -- 0:00:54
      128000 -- (-1119.928) (-1117.563) [-1116.066] (-1116.181) * [-1117.689] (-1117.177) (-1120.770) (-1119.337) -- 0:00:54
      128500 -- [-1114.842] (-1116.947) (-1115.030) (-1117.121) * [-1117.009] (-1116.246) (-1121.852) (-1120.102) -- 0:00:54
      129000 -- (-1120.255) [-1116.522] (-1116.237) (-1121.900) * (-1117.233) (-1117.234) [-1119.880] (-1118.415) -- 0:00:54
      129500 -- (-1120.486) (-1118.316) [-1115.996] (-1117.379) * (-1122.379) [-1115.818] (-1118.692) (-1117.019) -- 0:00:53
      130000 -- (-1118.498) [-1117.444] (-1119.550) (-1118.054) * (-1123.074) (-1116.066) (-1118.756) [-1117.959] -- 0:00:53

      Average standard deviation of split frequencies: 0.017497

      130500 -- (-1115.803) [-1117.606] (-1121.438) (-1116.497) * (-1116.083) (-1116.778) (-1116.660) [-1117.720] -- 0:00:53
      131000 -- (-1116.595) (-1117.580) (-1116.942) [-1115.508] * (-1120.729) (-1117.082) [-1118.550] (-1118.173) -- 0:00:53
      131500 -- [-1115.516] (-1120.931) (-1120.084) (-1115.585) * (-1119.682) [-1119.261] (-1117.613) (-1120.034) -- 0:00:52
      132000 -- (-1115.452) [-1116.958] (-1116.366) (-1116.012) * (-1116.917) [-1115.376] (-1115.500) (-1117.201) -- 0:00:52
      132500 -- (-1119.015) (-1117.987) [-1118.491] (-1115.522) * [-1119.589] (-1116.076) (-1117.184) (-1116.516) -- 0:00:52
      133000 -- (-1119.615) (-1118.163) [-1118.872] (-1116.934) * (-1118.929) (-1116.407) [-1117.996] (-1117.161) -- 0:00:52
      133500 -- (-1116.158) (-1117.324) (-1118.061) [-1116.924] * (-1118.644) [-1117.100] (-1120.091) (-1118.645) -- 0:00:51
      134000 -- (-1117.014) [-1117.700] (-1116.106) (-1116.239) * [-1115.611] (-1117.348) (-1116.207) (-1119.051) -- 0:00:51
      134500 -- [-1117.388] (-1117.098) (-1116.078) (-1115.431) * (-1115.080) (-1118.768) (-1115.769) [-1116.349] -- 0:00:51
      135000 -- (-1119.829) (-1116.472) [-1115.916] (-1115.436) * (-1115.473) (-1120.952) (-1116.517) [-1115.560] -- 0:00:51

      Average standard deviation of split frequencies: 0.016464

      135500 -- (-1117.552) (-1115.661) (-1116.493) [-1117.636] * [-1116.146] (-1118.327) (-1117.243) (-1118.530) -- 0:00:57
      136000 -- (-1118.735) (-1119.827) [-1116.887] (-1115.851) * (-1117.103) [-1119.195] (-1115.848) (-1118.228) -- 0:00:57
      136500 -- [-1118.051] (-1117.809) (-1115.818) (-1118.905) * (-1115.478) (-1116.993) [-1115.754] (-1118.206) -- 0:00:56
      137000 -- [-1117.971] (-1117.376) (-1116.962) (-1116.283) * (-1115.177) [-1118.940] (-1115.413) (-1115.685) -- 0:00:56
      137500 -- [-1115.901] (-1116.196) (-1115.487) (-1117.577) * (-1116.657) [-1118.369] (-1115.393) (-1117.045) -- 0:00:56
      138000 -- [-1120.113] (-1117.300) (-1115.651) (-1116.758) * [-1116.732] (-1119.721) (-1116.154) (-1119.175) -- 0:00:56
      138500 -- (-1116.861) (-1119.193) [-1115.675] (-1118.014) * [-1115.664] (-1115.310) (-1116.619) (-1119.642) -- 0:00:55
      139000 -- (-1124.855) (-1117.645) [-1117.197] (-1116.411) * (-1116.580) (-1120.604) (-1116.158) [-1115.913] -- 0:00:55
      139500 -- (-1119.679) (-1115.739) (-1117.120) [-1116.743] * (-1114.921) (-1118.777) [-1116.363] (-1115.720) -- 0:00:55
      140000 -- [-1116.578] (-1116.910) (-1115.488) (-1116.025) * (-1117.078) (-1116.743) [-1116.668] (-1117.572) -- 0:00:55

      Average standard deviation of split frequencies: 0.018767

      140500 -- [-1116.185] (-1117.445) (-1116.491) (-1118.101) * (-1118.188) (-1121.052) [-1118.100] (-1116.380) -- 0:00:55
      141000 -- [-1116.668] (-1116.821) (-1119.094) (-1115.131) * (-1116.115) (-1118.539) [-1117.800] (-1117.878) -- 0:00:54
      141500 -- [-1117.324] (-1119.539) (-1117.593) (-1118.850) * (-1118.040) (-1119.140) [-1116.777] (-1117.169) -- 0:00:54
      142000 -- (-1116.707) [-1117.382] (-1117.940) (-1120.194) * [-1115.741] (-1118.731) (-1118.893) (-1118.411) -- 0:00:54
      142500 -- (-1117.242) (-1115.970) (-1116.365) [-1121.001] * (-1117.851) [-1117.104] (-1119.510) (-1118.212) -- 0:00:54
      143000 -- (-1118.382) (-1117.144) [-1116.840] (-1118.291) * (-1120.269) (-1117.436) (-1117.517) [-1117.395] -- 0:00:53
      143500 -- (-1118.530) (-1117.872) [-1117.176] (-1120.043) * (-1116.721) [-1117.092] (-1118.852) (-1115.991) -- 0:00:53
      144000 -- (-1117.455) [-1118.127] (-1121.008) (-1122.221) * (-1119.168) (-1118.085) [-1117.611] (-1117.450) -- 0:00:53
      144500 -- (-1118.505) (-1118.830) [-1121.755] (-1123.535) * (-1115.741) (-1117.595) (-1118.192) [-1115.743] -- 0:00:53
      145000 -- [-1116.656] (-1115.235) (-1119.609) (-1120.142) * (-1116.018) (-1115.602) (-1119.472) [-1115.533] -- 0:00:53

      Average standard deviation of split frequencies: 0.018604

      145500 -- [-1116.663] (-1117.668) (-1117.640) (-1118.557) * (-1118.548) (-1115.915) (-1115.907) [-1115.506] -- 0:00:52
      146000 -- [-1119.901] (-1117.358) (-1122.884) (-1116.614) * (-1117.694) (-1116.007) [-1117.669] (-1116.809) -- 0:00:52
      146500 -- [-1117.019] (-1117.109) (-1120.018) (-1121.844) * (-1117.259) (-1118.699) (-1117.202) [-1120.828] -- 0:00:52
      147000 -- (-1115.362) (-1115.388) (-1118.721) [-1121.578] * (-1116.188) [-1119.582] (-1120.007) (-1117.812) -- 0:00:52
      147500 -- (-1115.633) (-1115.777) [-1116.657] (-1120.457) * (-1115.745) (-1117.309) [-1115.532] (-1117.855) -- 0:00:52
      148000 -- (-1118.507) (-1115.840) [-1118.311] (-1118.542) * [-1118.083] (-1118.955) (-1116.774) (-1118.596) -- 0:00:51
      148500 -- (-1118.971) [-1115.375] (-1115.469) (-1117.169) * [-1117.164] (-1119.953) (-1115.699) (-1119.272) -- 0:00:51
      149000 -- (-1117.554) [-1116.647] (-1115.295) (-1116.777) * (-1116.590) [-1119.653] (-1116.974) (-1123.641) -- 0:00:51
      149500 -- (-1115.875) (-1119.441) [-1116.491] (-1117.843) * (-1117.433) (-1117.459) (-1117.289) [-1124.173] -- 0:00:51
      150000 -- [-1115.988] (-1119.027) (-1117.327) (-1121.214) * (-1118.729) (-1117.438) (-1116.676) [-1116.993] -- 0:00:51

      Average standard deviation of split frequencies: 0.019399

      150500 -- [-1115.312] (-1117.514) (-1118.316) (-1118.379) * (-1118.156) (-1117.707) (-1118.753) [-1118.201] -- 0:00:50
      151000 -- (-1115.438) (-1114.913) (-1119.856) [-1116.657] * [-1120.129] (-1119.567) (-1117.462) (-1117.017) -- 0:00:50
      151500 -- [-1117.267] (-1121.159) (-1125.421) (-1117.053) * (-1120.331) (-1119.400) (-1118.142) [-1117.016] -- 0:00:56
      152000 -- (-1116.135) (-1116.100) (-1116.789) [-1116.019] * (-1122.305) [-1115.834] (-1117.351) (-1117.501) -- 0:00:55
      152500 -- (-1115.931) [-1115.661] (-1117.221) (-1118.776) * [-1117.822] (-1116.513) (-1115.393) (-1119.372) -- 0:00:55
      153000 -- (-1119.418) [-1115.147] (-1117.446) (-1118.082) * [-1118.321] (-1117.076) (-1116.227) (-1118.040) -- 0:00:55
      153500 -- (-1124.466) (-1117.842) [-1118.178] (-1116.333) * (-1120.070) (-1115.642) [-1118.822] (-1118.554) -- 0:00:55
      154000 -- (-1117.171) (-1116.688) [-1117.089] (-1118.497) * (-1117.899) [-1115.556] (-1116.835) (-1115.938) -- 0:00:54
      154500 -- (-1120.719) (-1116.372) (-1118.822) [-1120.146] * (-1119.133) [-1116.070] (-1116.400) (-1118.544) -- 0:00:54
      155000 -- (-1119.708) [-1116.862] (-1120.046) (-1117.701) * [-1117.623] (-1117.996) (-1117.246) (-1119.527) -- 0:00:54

      Average standard deviation of split frequencies: 0.017980

      155500 -- (-1116.298) (-1116.996) (-1117.184) [-1118.345] * [-1115.790] (-1115.173) (-1116.871) (-1119.805) -- 0:00:54
      156000 -- (-1119.391) [-1115.132] (-1116.414) (-1122.551) * (-1115.571) (-1115.394) (-1115.664) [-1119.536] -- 0:00:54
      156500 -- (-1116.548) [-1117.158] (-1115.877) (-1121.673) * (-1116.403) [-1117.022] (-1117.090) (-1116.405) -- 0:00:53
      157000 -- (-1119.712) (-1117.688) (-1116.221) [-1120.429] * (-1116.844) (-1116.176) (-1120.135) [-1115.340] -- 0:00:53
      157500 -- (-1116.678) [-1117.294] (-1118.074) (-1117.709) * (-1116.658) (-1115.960) (-1118.987) [-1115.956] -- 0:00:53
      158000 -- [-1115.293] (-1118.940) (-1117.550) (-1118.506) * (-1118.731) (-1118.183) (-1118.490) [-1116.646] -- 0:00:53
      158500 -- (-1115.511) (-1121.355) (-1119.019) [-1116.065] * (-1116.445) (-1116.023) (-1116.804) [-1115.554] -- 0:00:53
      159000 -- (-1116.683) [-1117.667] (-1119.478) (-1117.808) * (-1117.025) [-1117.327] (-1117.006) (-1117.043) -- 0:00:52
      159500 -- [-1116.645] (-1118.729) (-1115.041) (-1116.012) * [-1116.557] (-1117.101) (-1116.157) (-1115.665) -- 0:00:52
      160000 -- (-1115.478) [-1117.949] (-1117.490) (-1115.869) * (-1117.026) [-1118.331] (-1115.712) (-1115.859) -- 0:00:52

      Average standard deviation of split frequencies: 0.018531

      160500 -- [-1116.404] (-1116.561) (-1119.724) (-1116.047) * (-1116.899) (-1116.953) [-1116.850] (-1115.977) -- 0:00:52
      161000 -- (-1116.388) [-1119.042] (-1118.989) (-1119.756) * (-1115.847) (-1116.632) (-1116.750) [-1126.714] -- 0:00:52
      161500 -- (-1117.953) [-1115.155] (-1117.601) (-1118.005) * [-1115.786] (-1117.018) (-1118.659) (-1114.852) -- 0:00:51
      162000 -- (-1127.322) [-1117.211] (-1115.596) (-1116.133) * (-1116.909) (-1115.998) [-1118.866] (-1116.230) -- 0:00:51
      162500 -- (-1118.500) [-1115.745] (-1115.953) (-1118.730) * [-1116.924] (-1117.918) (-1115.839) (-1117.359) -- 0:00:51
      163000 -- (-1118.879) [-1116.047] (-1116.991) (-1115.511) * (-1118.339) (-1115.584) (-1117.416) [-1117.369] -- 0:00:51
      163500 -- [-1116.943] (-1115.732) (-1116.069) (-1115.538) * (-1123.669) [-1116.768] (-1125.808) (-1116.222) -- 0:00:51
      164000 -- (-1118.726) (-1116.564) [-1116.233] (-1115.778) * (-1121.444) (-1115.903) (-1116.398) [-1117.046] -- 0:00:50
      164500 -- (-1115.318) (-1119.611) [-1115.361] (-1115.495) * (-1115.327) (-1115.852) (-1116.008) [-1115.492] -- 0:00:50
      165000 -- (-1115.825) (-1122.964) (-1116.504) [-1115.924] * (-1117.956) [-1115.630] (-1116.812) (-1115.519) -- 0:00:50

      Average standard deviation of split frequencies: 0.018743

      165500 -- [-1115.671] (-1119.018) (-1116.504) (-1117.005) * (-1116.843) (-1115.376) (-1115.394) [-1117.987] -- 0:00:50
      166000 -- [-1119.742] (-1120.400) (-1117.850) (-1116.413) * (-1116.475) [-1115.258] (-1115.382) (-1117.542) -- 0:00:50
      166500 -- (-1117.659) (-1120.211) (-1117.679) [-1116.027] * (-1117.305) [-1117.720] (-1115.046) (-1116.432) -- 0:00:50
      167000 -- (-1118.753) (-1120.102) [-1118.694] (-1121.352) * (-1115.848) (-1118.116) [-1115.016] (-1120.585) -- 0:00:49
      167500 -- (-1118.800) [-1116.006] (-1116.546) (-1118.689) * [-1115.789] (-1116.120) (-1116.946) (-1122.180) -- 0:00:54
      168000 -- (-1117.532) [-1117.872] (-1115.494) (-1116.208) * (-1117.705) (-1115.729) (-1116.099) [-1122.465] -- 0:00:54
      168500 -- (-1119.115) (-1120.259) [-1118.004] (-1115.729) * (-1116.033) [-1115.718] (-1118.175) (-1117.230) -- 0:00:54
      169000 -- [-1119.000] (-1117.907) (-1117.619) (-1116.832) * (-1116.088) (-1118.364) (-1118.412) [-1116.995] -- 0:00:54
      169500 -- (-1119.163) (-1116.841) (-1119.733) [-1115.243] * (-1115.671) (-1117.350) (-1117.782) [-1115.579] -- 0:00:53
      170000 -- [-1118.216] (-1120.235) (-1120.006) (-1119.473) * (-1117.268) (-1115.563) (-1118.508) [-1115.802] -- 0:00:53

      Average standard deviation of split frequencies: 0.018644

      170500 -- (-1118.600) [-1116.444] (-1120.672) (-1116.424) * [-1116.099] (-1115.732) (-1118.513) (-1115.575) -- 0:00:53
      171000 -- (-1119.211) (-1116.554) (-1119.786) [-1119.072] * [-1116.713] (-1118.204) (-1119.007) (-1115.489) -- 0:00:53
      171500 -- (-1117.266) [-1117.033] (-1116.607) (-1117.853) * (-1118.142) (-1116.648) (-1116.048) [-1116.050] -- 0:00:53
      172000 -- (-1118.242) (-1116.318) [-1117.261] (-1118.265) * [-1120.424] (-1116.956) (-1117.310) (-1116.010) -- 0:00:52
      172500 -- (-1117.056) (-1116.379) [-1120.706] (-1117.398) * (-1119.307) (-1114.909) [-1119.211] (-1119.451) -- 0:00:52
      173000 -- (-1118.347) (-1117.151) (-1119.632) [-1116.340] * (-1117.829) (-1116.195) (-1116.323) [-1119.757] -- 0:00:52
      173500 -- (-1120.145) (-1115.034) [-1116.306] (-1116.853) * (-1117.036) [-1115.388] (-1120.429) (-1122.574) -- 0:00:52
      174000 -- [-1117.570] (-1116.213) (-1116.423) (-1115.814) * (-1116.308) [-1116.773] (-1119.530) (-1116.289) -- 0:00:52
      174500 -- (-1117.280) (-1116.079) (-1117.245) [-1115.359] * (-1118.472) (-1115.298) [-1117.013] (-1120.193) -- 0:00:52
      175000 -- (-1115.628) (-1116.351) [-1117.163] (-1115.883) * (-1117.471) (-1115.250) [-1118.454] (-1117.239) -- 0:00:51

      Average standard deviation of split frequencies: 0.017946

      175500 -- (-1117.527) (-1117.340) (-1116.407) [-1116.764] * [-1115.322] (-1118.386) (-1115.506) (-1119.639) -- 0:00:51
      176000 -- [-1117.504] (-1115.359) (-1116.939) (-1115.692) * [-1116.693] (-1117.711) (-1117.117) (-1117.543) -- 0:00:51
      176500 -- (-1118.298) (-1115.888) (-1120.547) [-1115.905] * [-1117.240] (-1117.230) (-1117.935) (-1116.604) -- 0:00:51
      177000 -- (-1115.723) [-1115.422] (-1121.878) (-1117.945) * (-1117.057) [-1116.463] (-1117.634) (-1115.723) -- 0:00:51
      177500 -- (-1116.631) [-1117.130] (-1122.349) (-1115.462) * (-1115.222) (-1117.753) (-1119.877) [-1116.104] -- 0:00:50
      178000 -- (-1115.799) [-1116.585] (-1116.485) (-1115.975) * (-1117.473) (-1118.002) (-1118.953) [-1115.935] -- 0:00:50
      178500 -- (-1117.928) [-1115.674] (-1117.172) (-1120.857) * (-1117.506) (-1118.071) (-1117.722) [-1116.217] -- 0:00:50
      179000 -- (-1115.524) [-1122.033] (-1117.407) (-1124.060) * (-1127.207) [-1116.059] (-1121.363) (-1118.293) -- 0:00:50
      179500 -- (-1120.277) (-1117.650) [-1115.411] (-1118.267) * (-1120.549) [-1115.954] (-1119.542) (-1119.142) -- 0:00:50
      180000 -- (-1119.608) [-1116.254] (-1119.290) (-1116.645) * (-1119.610) (-1115.199) (-1120.975) [-1116.420] -- 0:00:50

      Average standard deviation of split frequencies: 0.017612

      180500 -- [-1119.698] (-1116.513) (-1120.304) (-1116.015) * (-1117.224) [-1120.857] (-1115.262) (-1117.174) -- 0:00:49
      181000 -- [-1117.029] (-1115.727) (-1117.511) (-1115.216) * (-1119.416) (-1116.515) (-1115.066) [-1118.481] -- 0:00:49
      181500 -- (-1124.386) (-1115.248) [-1117.355] (-1115.800) * (-1116.138) (-1118.405) [-1116.023] (-1117.401) -- 0:00:49
      182000 -- (-1120.491) [-1116.851] (-1116.195) (-1116.003) * (-1117.412) [-1115.403] (-1120.697) (-1117.339) -- 0:00:49
      182500 -- (-1115.336) (-1119.188) [-1115.533] (-1115.948) * (-1119.208) (-1117.725) [-1120.527] (-1116.626) -- 0:00:49
      183000 -- (-1115.860) (-1117.669) (-1118.765) [-1116.508] * (-1118.909) [-1118.341] (-1116.339) (-1116.430) -- 0:00:49
      183500 -- (-1117.071) (-1117.649) (-1116.230) [-1116.146] * (-1118.407) [-1116.594] (-1115.848) (-1116.114) -- 0:00:53
      184000 -- (-1120.372) (-1115.562) (-1116.268) [-1115.838] * (-1116.796) (-1118.271) (-1117.915) [-1116.061] -- 0:00:53
      184500 -- (-1122.294) [-1116.656] (-1115.721) (-1114.944) * (-1117.125) (-1119.601) [-1117.138] (-1119.657) -- 0:00:53
      185000 -- (-1121.211) [-1117.897] (-1115.957) (-1115.219) * (-1118.433) (-1121.158) [-1116.620] (-1119.543) -- 0:00:52

      Average standard deviation of split frequencies: 0.016220

      185500 -- [-1117.873] (-1117.977) (-1115.568) (-1117.318) * (-1123.452) [-1121.844] (-1118.706) (-1125.606) -- 0:00:52
      186000 -- [-1117.853] (-1119.854) (-1115.533) (-1117.460) * [-1121.367] (-1125.543) (-1116.838) (-1121.892) -- 0:00:52
      186500 -- [-1116.620] (-1115.837) (-1116.130) (-1118.219) * [-1116.572] (-1118.727) (-1115.075) (-1115.988) -- 0:00:52
      187000 -- [-1115.831] (-1118.351) (-1118.661) (-1116.491) * (-1116.418) [-1116.411] (-1115.388) (-1116.127) -- 0:00:52
      187500 -- (-1118.138) [-1116.208] (-1117.233) (-1116.566) * (-1115.538) [-1117.945] (-1117.711) (-1118.027) -- 0:00:52
      188000 -- (-1118.692) [-1117.487] (-1116.695) (-1118.810) * [-1117.863] (-1119.231) (-1119.898) (-1115.573) -- 0:00:51
      188500 -- (-1117.901) (-1117.518) (-1116.022) [-1117.103] * (-1116.230) (-1117.753) (-1117.009) [-1116.149] -- 0:00:51
      189000 -- (-1118.184) (-1116.033) [-1117.419] (-1118.226) * [-1116.805] (-1117.706) (-1121.714) (-1117.928) -- 0:00:51
      189500 -- [-1115.843] (-1116.028) (-1117.806) (-1118.694) * [-1116.304] (-1115.107) (-1119.657) (-1115.561) -- 0:00:51
      190000 -- [-1117.176] (-1115.735) (-1116.091) (-1118.821) * [-1119.613] (-1118.261) (-1119.341) (-1115.361) -- 0:00:51

      Average standard deviation of split frequencies: 0.018088

      190500 -- (-1117.166) (-1116.560) [-1119.025] (-1115.403) * (-1116.042) (-1118.124) [-1119.028] (-1117.657) -- 0:00:50
      191000 -- (-1117.809) [-1119.614] (-1118.367) (-1116.410) * [-1117.036] (-1118.200) (-1117.305) (-1117.945) -- 0:00:50
      191500 -- (-1115.890) (-1126.286) (-1118.502) [-1116.162] * (-1115.703) (-1116.936) (-1119.995) [-1116.704] -- 0:00:50
      192000 -- [-1114.921] (-1120.224) (-1120.545) (-1115.864) * (-1119.313) (-1115.774) (-1120.416) [-1124.180] -- 0:00:50
      192500 -- (-1115.231) [-1122.370] (-1118.492) (-1118.820) * (-1118.984) [-1116.171] (-1118.179) (-1122.381) -- 0:00:50
      193000 -- (-1116.973) (-1120.581) [-1116.084] (-1116.978) * (-1117.849) (-1116.387) (-1120.237) [-1118.225] -- 0:00:50
      193500 -- (-1117.778) [-1117.176] (-1115.809) (-1117.663) * [-1116.742] (-1116.385) (-1117.812) (-1117.951) -- 0:00:50
      194000 -- (-1118.493) (-1116.259) (-1117.181) [-1118.773] * (-1117.845) (-1116.637) (-1118.864) [-1118.832] -- 0:00:49
      194500 -- (-1117.884) (-1115.230) (-1117.198) [-1117.430] * (-1115.585) (-1116.844) [-1117.202] (-1116.480) -- 0:00:49
      195000 -- (-1117.999) (-1116.396) (-1115.866) [-1115.360] * [-1115.961] (-1116.410) (-1117.231) (-1116.686) -- 0:00:49

      Average standard deviation of split frequencies: 0.016456

      195500 -- (-1116.496) [-1116.734] (-1116.633) (-1116.837) * [-1115.433] (-1115.554) (-1117.691) (-1118.919) -- 0:00:49
      196000 -- (-1117.539) (-1117.949) [-1117.910] (-1115.852) * (-1118.053) [-1117.724] (-1116.773) (-1116.326) -- 0:00:49
      196500 -- (-1118.097) (-1117.611) [-1116.392] (-1118.452) * [-1120.015] (-1118.216) (-1116.773) (-1116.327) -- 0:00:49
      197000 -- [-1119.212] (-1117.048) (-1117.258) (-1119.459) * [-1117.268] (-1116.168) (-1116.665) (-1116.518) -- 0:00:48
      197500 -- (-1118.412) [-1120.296] (-1119.156) (-1120.610) * (-1121.118) (-1115.779) [-1115.707] (-1119.011) -- 0:00:48
      198000 -- (-1116.997) (-1118.714) [-1120.457] (-1118.812) * [-1117.878] (-1117.817) (-1115.833) (-1125.132) -- 0:00:48
      198500 -- (-1122.227) (-1118.604) (-1116.432) [-1115.889] * [-1118.290] (-1117.782) (-1118.193) (-1118.056) -- 0:00:48
      199000 -- (-1117.713) (-1117.788) [-1117.367] (-1115.717) * (-1117.005) (-1119.934) [-1116.087] (-1121.010) -- 0:00:48
      199500 -- (-1121.618) (-1118.152) [-1118.156] (-1115.572) * (-1116.690) (-1117.609) [-1118.070] (-1118.954) -- 0:00:52
      200000 -- (-1116.562) (-1118.629) (-1118.738) [-1115.559] * (-1120.132) [-1116.127] (-1119.201) (-1117.435) -- 0:00:51

      Average standard deviation of split frequencies: 0.015792

      200500 -- (-1118.098) [-1116.622] (-1116.912) (-1115.581) * (-1116.372) [-1117.834] (-1117.088) (-1118.122) -- 0:00:51
      201000 -- (-1117.126) [-1118.003] (-1117.651) (-1117.737) * (-1115.323) [-1115.715] (-1116.670) (-1118.480) -- 0:00:51
      201500 -- (-1117.364) (-1119.774) (-1119.185) [-1115.514] * [-1117.106] (-1115.354) (-1116.768) (-1116.294) -- 0:00:51
      202000 -- [-1116.515] (-1119.450) (-1117.282) (-1116.003) * (-1115.063) (-1119.310) (-1116.684) [-1115.985] -- 0:00:51
      202500 -- (-1119.079) (-1116.015) (-1116.983) [-1116.023] * (-1115.136) (-1116.690) (-1116.875) [-1116.926] -- 0:00:51
      203000 -- (-1119.467) (-1117.187) (-1115.241) [-1115.625] * [-1115.182] (-1116.107) (-1117.976) (-1117.854) -- 0:00:51
      203500 -- (-1117.153) (-1117.775) (-1117.288) [-1115.760] * (-1116.078) [-1118.544] (-1117.363) (-1119.977) -- 0:00:50
      204000 -- (-1117.349) [-1115.431] (-1125.043) (-1117.967) * (-1115.738) [-1117.520] (-1116.891) (-1118.094) -- 0:00:50
      204500 -- (-1118.053) (-1115.847) [-1115.522] (-1115.953) * (-1117.337) (-1116.623) [-1116.917] (-1118.024) -- 0:00:50
      205000 -- (-1116.430) (-1115.567) [-1115.530] (-1120.242) * (-1116.102) [-1116.898] (-1116.397) (-1116.674) -- 0:00:50

      Average standard deviation of split frequencies: 0.013730

      205500 -- (-1119.730) (-1115.599) (-1117.693) [-1116.881] * (-1116.080) (-1116.125) [-1119.556] (-1116.888) -- 0:00:50
      206000 -- (-1121.391) (-1115.765) (-1116.328) [-1115.984] * [-1117.506] (-1119.873) (-1122.467) (-1117.384) -- 0:00:50
      206500 -- (-1115.522) (-1115.518) (-1115.596) [-1116.940] * (-1123.101) [-1117.310] (-1120.602) (-1116.504) -- 0:00:49
      207000 -- [-1115.512] (-1115.949) (-1120.089) (-1117.177) * (-1118.809) [-1118.409] (-1116.535) (-1115.648) -- 0:00:49
      207500 -- (-1117.435) [-1115.084] (-1117.323) (-1118.901) * (-1116.354) [-1117.215] (-1117.011) (-1116.487) -- 0:00:49
      208000 -- [-1115.518] (-1115.084) (-1116.850) (-1117.454) * (-1117.952) [-1116.287] (-1116.992) (-1117.327) -- 0:00:49
      208500 -- [-1115.503] (-1115.559) (-1116.380) (-1116.776) * (-1118.753) (-1120.404) [-1115.329] (-1117.359) -- 0:00:49
      209000 -- (-1115.565) [-1118.478] (-1118.181) (-1122.516) * (-1116.481) (-1116.133) [-1116.808] (-1117.331) -- 0:00:49
      209500 -- (-1115.385) [-1115.364] (-1118.253) (-1123.297) * [-1116.951] (-1116.204) (-1116.150) (-1115.953) -- 0:00:49
      210000 -- (-1116.618) [-1114.862] (-1116.079) (-1117.672) * (-1118.787) [-1119.810] (-1119.424) (-1116.027) -- 0:00:48

      Average standard deviation of split frequencies: 0.013923

      210500 -- (-1116.412) [-1114.862] (-1117.972) (-1115.894) * (-1116.291) [-1117.471] (-1118.899) (-1118.376) -- 0:00:48
      211000 -- (-1117.651) (-1115.806) [-1116.129] (-1115.806) * (-1115.938) [-1117.341] (-1117.230) (-1118.787) -- 0:00:48
      211500 -- (-1118.308) (-1117.963) [-1116.509] (-1119.438) * (-1116.296) (-1116.492) [-1116.033] (-1120.185) -- 0:00:48
      212000 -- (-1117.953) (-1116.573) (-1118.383) [-1116.525] * (-1116.927) (-1118.636) [-1116.522] (-1121.624) -- 0:00:48
      212500 -- [-1117.522] (-1116.325) (-1121.255) (-1118.976) * [-1116.878] (-1117.221) (-1116.062) (-1115.734) -- 0:00:48
      213000 -- (-1116.741) (-1115.182) (-1119.296) [-1116.931] * (-1120.322) [-1117.175] (-1121.843) (-1117.304) -- 0:00:48
      213500 -- [-1116.105] (-1115.088) (-1122.194) (-1116.038) * (-1119.809) (-1120.911) [-1116.896] (-1119.818) -- 0:00:47
      214000 -- [-1115.598] (-1119.476) (-1120.775) (-1116.474) * (-1117.542) (-1120.266) (-1121.752) [-1123.290] -- 0:00:47
      214500 -- [-1115.966] (-1116.339) (-1118.803) (-1118.795) * (-1118.019) (-1119.227) [-1121.504] (-1119.665) -- 0:00:47
      215000 -- [-1116.233] (-1117.798) (-1116.398) (-1118.147) * [-1120.210] (-1120.488) (-1122.911) (-1118.830) -- 0:00:47

      Average standard deviation of split frequencies: 0.014635

      215500 -- [-1118.296] (-1115.416) (-1116.262) (-1116.405) * (-1118.237) [-1117.527] (-1117.138) (-1125.469) -- 0:00:50
      216000 -- (-1115.254) [-1116.780] (-1116.966) (-1117.928) * (-1119.875) (-1117.753) (-1119.362) [-1117.393] -- 0:00:50
      216500 -- (-1118.644) (-1117.119) (-1118.574) [-1116.976] * (-1118.707) (-1118.068) [-1118.527] (-1121.446) -- 0:00:50
      217000 -- (-1116.655) (-1118.429) (-1120.012) [-1117.784] * (-1120.678) (-1118.367) [-1116.842] (-1123.771) -- 0:00:50
      217500 -- [-1115.670] (-1121.715) (-1116.567) (-1119.252) * [-1117.154] (-1118.480) (-1116.886) (-1119.196) -- 0:00:50
      218000 -- (-1115.540) [-1118.133] (-1116.470) (-1115.474) * (-1116.677) (-1116.630) [-1117.052] (-1118.738) -- 0:00:50
      218500 -- (-1118.167) (-1117.013) (-1116.369) [-1114.972] * (-1119.187) (-1117.723) [-1116.061] (-1116.401) -- 0:00:50
      219000 -- (-1115.845) [-1115.034] (-1118.023) (-1115.997) * (-1118.982) (-1118.646) [-1118.765] (-1119.421) -- 0:00:49
      219500 -- [-1115.878] (-1116.743) (-1119.933) (-1117.121) * (-1118.066) [-1115.485] (-1117.869) (-1120.063) -- 0:00:49
      220000 -- [-1116.690] (-1115.226) (-1123.821) (-1117.077) * [-1117.785] (-1120.277) (-1117.870) (-1118.709) -- 0:00:49

      Average standard deviation of split frequencies: 0.014451

      220500 -- (-1116.890) [-1116.788] (-1119.618) (-1118.299) * (-1116.997) (-1120.445) [-1117.126] (-1117.300) -- 0:00:49
      221000 -- (-1118.013) [-1119.178] (-1116.297) (-1122.376) * (-1121.200) [-1117.159] (-1118.078) (-1116.413) -- 0:00:49
      221500 -- [-1119.199] (-1118.993) (-1115.648) (-1120.110) * [-1116.463] (-1116.020) (-1123.648) (-1117.624) -- 0:00:49
      222000 -- (-1118.079) (-1120.582) [-1115.426] (-1121.691) * (-1117.159) (-1121.652) [-1122.819] (-1116.955) -- 0:00:49
      222500 -- (-1117.476) (-1118.259) [-1115.550] (-1116.098) * (-1114.780) [-1122.954] (-1119.596) (-1116.472) -- 0:00:48
      223000 -- (-1116.084) (-1118.967) [-1115.421] (-1116.828) * [-1115.442] (-1117.184) (-1118.240) (-1118.197) -- 0:00:48
      223500 -- (-1116.608) (-1116.312) [-1116.485] (-1116.189) * [-1115.026] (-1117.190) (-1116.114) (-1116.930) -- 0:00:48
      224000 -- (-1117.510) [-1117.076] (-1118.182) (-1119.147) * (-1115.322) [-1115.838] (-1115.677) (-1117.027) -- 0:00:48
      224500 -- (-1119.304) (-1118.047) [-1117.219] (-1121.163) * (-1115.483) [-1120.084] (-1116.859) (-1117.623) -- 0:00:48
      225000 -- [-1116.909] (-1117.774) (-1118.617) (-1116.843) * [-1116.366] (-1118.572) (-1119.989) (-1117.444) -- 0:00:48

      Average standard deviation of split frequencies: 0.014356

      225500 -- (-1117.161) (-1115.172) [-1118.908] (-1118.466) * (-1116.492) [-1115.881] (-1117.560) (-1117.576) -- 0:00:48
      226000 -- (-1116.741) (-1122.481) [-1116.947] (-1116.483) * [-1115.771] (-1120.520) (-1115.565) (-1116.182) -- 0:00:47
      226500 -- (-1120.934) (-1122.262) [-1120.509] (-1116.475) * [-1116.013] (-1115.968) (-1117.778) (-1118.635) -- 0:00:47
      227000 -- (-1116.803) (-1116.818) (-1119.626) [-1116.176] * (-1117.311) [-1116.620] (-1117.997) (-1115.734) -- 0:00:47
      227500 -- (-1119.229) (-1117.748) [-1116.160] (-1117.424) * [-1117.929] (-1116.122) (-1116.520) (-1115.996) -- 0:00:47
      228000 -- (-1117.651) [-1115.983] (-1120.636) (-1117.971) * (-1117.405) (-1118.989) [-1116.697] (-1116.648) -- 0:00:47
      228500 -- (-1131.315) [-1115.229] (-1117.892) (-1119.647) * (-1115.581) (-1116.102) [-1115.076] (-1116.367) -- 0:00:47
      229000 -- (-1117.797) [-1115.222] (-1119.518) (-1118.374) * (-1116.655) [-1117.492] (-1118.277) (-1119.063) -- 0:00:47
      229500 -- (-1118.774) (-1117.022) (-1115.785) [-1115.458] * (-1117.243) (-1115.648) (-1119.913) [-1116.443] -- 0:00:47
      230000 -- [-1117.993] (-1116.033) (-1116.435) (-1119.784) * (-1117.536) [-1115.483] (-1117.505) (-1115.998) -- 0:00:46

      Average standard deviation of split frequencies: 0.013464

      230500 -- [-1115.882] (-1118.424) (-1116.188) (-1120.581) * [-1115.634] (-1116.435) (-1116.880) (-1116.163) -- 0:00:46
      231000 -- (-1119.588) (-1116.880) [-1115.918] (-1117.998) * (-1122.777) (-1117.537) [-1117.712] (-1117.329) -- 0:00:46
      231500 -- (-1118.539) (-1117.218) (-1116.269) [-1118.062] * (-1121.637) [-1116.684] (-1116.769) (-1115.444) -- 0:00:49
      232000 -- (-1118.983) [-1115.561] (-1117.534) (-1117.522) * (-1118.155) [-1116.901] (-1116.398) (-1115.993) -- 0:00:49
      232500 -- (-1118.599) (-1116.224) (-1118.752) [-1119.610] * (-1116.636) (-1119.651) (-1118.416) [-1115.825] -- 0:00:49
      233000 -- [-1119.266] (-1117.310) (-1117.804) (-1116.376) * (-1117.051) (-1120.438) [-1120.855] (-1115.838) -- 0:00:49
      233500 -- (-1121.485) (-1117.866) [-1115.313] (-1116.852) * (-1116.805) (-1115.525) [-1118.150] (-1116.468) -- 0:00:49
      234000 -- (-1120.579) [-1116.253] (-1115.876) (-1117.021) * (-1117.639) [-1115.429] (-1115.525) (-1115.392) -- 0:00:49
      234500 -- [-1117.573] (-1116.495) (-1116.439) (-1118.586) * (-1115.838) (-1118.292) (-1117.697) [-1117.634] -- 0:00:48
      235000 -- (-1115.879) [-1120.077] (-1116.074) (-1118.295) * (-1115.839) (-1116.562) [-1117.483] (-1116.237) -- 0:00:48

      Average standard deviation of split frequencies: 0.013160

      235500 -- (-1116.186) (-1117.605) (-1121.888) [-1117.220] * (-1117.994) [-1118.727] (-1117.428) (-1115.635) -- 0:00:48
      236000 -- (-1116.320) [-1115.770] (-1115.518) (-1116.541) * (-1117.149) (-1116.282) (-1120.365) [-1116.859] -- 0:00:48
      236500 -- [-1117.746] (-1115.476) (-1115.840) (-1122.242) * (-1117.613) [-1116.156] (-1118.842) (-1116.070) -- 0:00:48
      237000 -- [-1115.730] (-1115.658) (-1116.897) (-1116.158) * (-1119.342) [-1117.230] (-1118.900) (-1116.034) -- 0:00:48
      237500 -- [-1115.238] (-1115.587) (-1118.038) (-1119.981) * (-1119.325) [-1118.850] (-1117.707) (-1115.617) -- 0:00:48
      238000 -- (-1115.211) [-1116.787] (-1119.362) (-1116.351) * (-1118.058) [-1117.742] (-1119.981) (-1117.006) -- 0:00:48
      238500 -- (-1116.117) [-1116.803] (-1122.562) (-1117.098) * (-1116.174) [-1119.295] (-1116.379) (-1116.278) -- 0:00:47
      239000 -- [-1118.973] (-1115.107) (-1117.219) (-1119.805) * (-1119.690) (-1116.960) (-1117.252) [-1116.905] -- 0:00:47
      239500 -- [-1122.398] (-1115.404) (-1118.509) (-1118.974) * [-1118.195] (-1119.181) (-1119.354) (-1116.991) -- 0:00:47
      240000 -- (-1115.607) (-1117.244) (-1118.248) [-1122.277] * (-1119.323) (-1117.353) (-1116.466) [-1116.524] -- 0:00:47

      Average standard deviation of split frequencies: 0.010406

      240500 -- [-1119.817] (-1116.635) (-1121.911) (-1123.388) * (-1115.288) (-1118.635) (-1116.756) [-1116.416] -- 0:00:47
      241000 -- (-1120.414) [-1115.617] (-1117.819) (-1123.958) * [-1115.995] (-1115.739) (-1118.166) (-1117.579) -- 0:00:47
      241500 -- (-1115.839) (-1119.531) [-1117.276] (-1124.041) * (-1119.511) (-1117.258) (-1117.483) [-1115.869] -- 0:00:47
      242000 -- (-1118.382) (-1116.357) [-1118.872] (-1120.520) * (-1117.933) (-1115.830) (-1117.188) [-1115.675] -- 0:00:46
      242500 -- (-1116.218) (-1115.262) [-1116.863] (-1118.868) * [-1116.595] (-1118.865) (-1115.329) (-1115.881) -- 0:00:46
      243000 -- (-1116.429) (-1115.573) (-1117.299) [-1117.459] * (-1117.102) (-1115.640) (-1115.317) [-1115.959] -- 0:00:46
      243500 -- [-1116.100] (-1115.798) (-1117.875) (-1115.810) * (-1120.461) (-1117.873) [-1116.694] (-1115.624) -- 0:00:46
      244000 -- (-1116.310) (-1116.646) [-1115.803] (-1116.095) * (-1119.844) (-1117.292) [-1116.035] (-1120.507) -- 0:00:46
      244500 -- (-1117.782) (-1118.940) (-1115.843) [-1115.539] * (-1117.391) (-1118.477) [-1117.394] (-1123.133) -- 0:00:46
      245000 -- (-1120.828) (-1115.578) (-1117.429) [-1115.390] * (-1119.519) [-1116.041] (-1116.726) (-1119.835) -- 0:00:46

      Average standard deviation of split frequencies: 0.009941

      245500 -- [-1118.307] (-1115.232) (-1118.795) (-1118.283) * (-1118.849) [-1116.563] (-1117.750) (-1116.108) -- 0:00:46
      246000 -- (-1117.586) (-1118.833) [-1116.512] (-1120.661) * (-1118.718) (-1117.481) [-1116.828] (-1116.306) -- 0:00:45
      246500 -- (-1118.414) (-1117.433) (-1118.048) [-1121.420] * (-1118.598) [-1116.650] (-1115.441) (-1118.225) -- 0:00:45
      247000 -- (-1119.877) (-1118.718) [-1116.260] (-1116.347) * (-1117.591) (-1115.647) (-1117.951) [-1116.861] -- 0:00:45
      247500 -- (-1119.952) [-1116.430] (-1115.993) (-1115.685) * (-1119.035) (-1117.237) [-1121.008] (-1115.616) -- 0:00:48
      248000 -- (-1118.098) (-1120.498) (-1117.793) [-1116.539] * (-1116.977) (-1117.430) [-1115.770] (-1119.661) -- 0:00:48
      248500 -- (-1117.726) [-1119.376] (-1115.605) (-1119.360) * (-1116.302) (-1117.893) [-1115.908] (-1118.600) -- 0:00:48
      249000 -- (-1115.383) (-1119.401) (-1116.115) [-1118.281] * (-1115.732) (-1122.085) [-1116.458] (-1117.169) -- 0:00:48
      249500 -- (-1115.784) [-1118.888] (-1118.924) (-1116.346) * (-1115.737) (-1119.823) [-1116.001] (-1120.554) -- 0:00:48
      250000 -- [-1115.343] (-1120.303) (-1117.814) (-1117.531) * (-1117.057) (-1117.520) [-1115.995] (-1118.608) -- 0:00:48

      Average standard deviation of split frequencies: 0.010696

      250500 -- (-1116.932) [-1118.157] (-1130.025) (-1117.028) * [-1115.462] (-1118.432) (-1118.095) (-1118.161) -- 0:00:47
      251000 -- [-1116.040] (-1115.496) (-1118.349) (-1118.271) * (-1119.613) (-1116.964) (-1117.501) [-1118.235] -- 0:00:47
      251500 -- (-1118.304) [-1117.781] (-1118.412) (-1117.342) * (-1115.519) (-1117.756) (-1115.580) [-1115.615] -- 0:00:47
      252000 -- (-1115.916) (-1117.107) [-1119.519] (-1117.268) * [-1115.347] (-1120.200) (-1115.267) (-1116.957) -- 0:00:47
      252500 -- (-1117.599) [-1117.489] (-1118.984) (-1119.260) * [-1115.097] (-1118.639) (-1116.864) (-1121.602) -- 0:00:47
      253000 -- (-1119.870) (-1117.891) [-1118.757] (-1116.005) * (-1121.307) [-1120.011] (-1117.580) (-1116.602) -- 0:00:47
      253500 -- [-1116.298] (-1117.843) (-1115.932) (-1116.043) * [-1117.337] (-1115.174) (-1116.426) (-1119.767) -- 0:00:47
      254000 -- (-1116.285) (-1118.257) [-1115.624] (-1115.566) * (-1118.684) (-1116.188) [-1116.602] (-1116.709) -- 0:00:46
      254500 -- (-1116.831) (-1115.917) [-1117.052] (-1116.778) * (-1118.712) (-1118.391) [-1116.963] (-1116.698) -- 0:00:46
      255000 -- (-1116.743) [-1115.917] (-1117.147) (-1118.380) * (-1120.541) (-1116.622) (-1117.586) [-1115.436] -- 0:00:46

      Average standard deviation of split frequencies: 0.009552

      255500 -- (-1117.063) [-1115.441] (-1115.730) (-1115.317) * (-1118.665) (-1119.748) [-1119.316] (-1116.722) -- 0:00:46
      256000 -- [-1116.455] (-1115.398) (-1115.990) (-1114.938) * (-1120.063) [-1118.957] (-1119.368) (-1120.310) -- 0:00:46
      256500 -- (-1116.752) [-1116.233] (-1118.387) (-1120.536) * (-1120.366) (-1116.841) (-1115.761) [-1116.968] -- 0:00:46
      257000 -- [-1116.944] (-1116.301) (-1118.485) (-1117.104) * (-1117.104) (-1116.197) [-1115.800] (-1120.007) -- 0:00:46
      257500 -- (-1117.089) (-1115.159) [-1118.628] (-1116.850) * (-1117.207) [-1115.697] (-1115.095) (-1122.173) -- 0:00:46
      258000 -- [-1120.771] (-1115.778) (-1117.046) (-1117.713) * (-1117.776) [-1115.081] (-1119.071) (-1121.304) -- 0:00:46
      258500 -- (-1119.572) (-1115.452) (-1116.189) [-1116.194] * [-1119.093] (-1116.042) (-1115.357) (-1117.579) -- 0:00:45
      259000 -- (-1119.091) (-1116.384) [-1116.655] (-1117.043) * (-1119.017) (-1115.270) (-1116.467) [-1118.302] -- 0:00:45
      259500 -- (-1118.209) (-1115.839) [-1116.589] (-1116.617) * (-1119.384) [-1117.353] (-1115.952) (-1118.897) -- 0:00:45
      260000 -- (-1116.424) (-1116.693) (-1117.419) [-1117.313] * (-1119.215) (-1118.081) [-1116.049] (-1116.576) -- 0:00:45

      Average standard deviation of split frequencies: 0.009947

      260500 -- (-1116.026) (-1116.518) [-1115.838] (-1115.550) * (-1118.956) (-1118.158) (-1116.317) [-1117.227] -- 0:00:45
      261000 -- (-1116.187) (-1116.788) [-1116.831] (-1115.400) * (-1120.040) [-1117.440] (-1115.460) (-1116.285) -- 0:00:45
      261500 -- (-1117.468) [-1116.718] (-1118.208) (-1115.309) * (-1120.030) (-1116.656) [-1115.096] (-1116.089) -- 0:00:45
      262000 -- (-1120.331) (-1116.365) [-1117.868] (-1119.637) * (-1119.607) (-1117.908) (-1115.058) [-1115.680] -- 0:00:45
      262500 -- (-1115.710) (-1121.193) [-1116.141] (-1116.940) * (-1116.065) (-1117.853) [-1115.982] (-1115.052) -- 0:00:44
      263000 -- (-1115.292) [-1118.567] (-1116.148) (-1115.548) * (-1116.373) (-1119.275) (-1115.843) [-1118.464] -- 0:00:44
      263500 -- [-1116.005] (-1116.641) (-1116.387) (-1116.739) * (-1116.349) (-1116.553) (-1116.091) [-1117.648] -- 0:00:47
      264000 -- (-1116.399) (-1116.588) (-1118.263) [-1118.109] * [-1117.559] (-1116.203) (-1117.801) (-1117.710) -- 0:00:47
      264500 -- (-1120.656) (-1118.406) [-1116.760] (-1117.898) * [-1116.810] (-1121.915) (-1116.516) (-1117.924) -- 0:00:47
      265000 -- (-1121.753) [-1116.430] (-1116.807) (-1120.383) * [-1116.027] (-1116.236) (-1117.029) (-1116.300) -- 0:00:47

      Average standard deviation of split frequencies: 0.009591

      265500 -- [-1118.008] (-1121.948) (-1115.370) (-1117.420) * (-1116.122) [-1117.299] (-1118.523) (-1116.622) -- 0:00:47
      266000 -- (-1115.791) (-1118.531) (-1115.643) [-1117.253] * (-1116.143) (-1116.416) (-1116.107) [-1116.890] -- 0:00:46
      266500 -- [-1115.802] (-1116.064) (-1115.628) (-1119.345) * (-1115.089) (-1116.294) (-1116.531) [-1117.482] -- 0:00:46
      267000 -- (-1114.794) (-1116.919) [-1115.351] (-1119.156) * [-1117.258] (-1119.886) (-1119.724) (-1115.890) -- 0:00:46
      267500 -- (-1115.117) (-1118.998) [-1115.414] (-1121.009) * [-1117.784] (-1115.288) (-1118.777) (-1115.541) -- 0:00:46
      268000 -- [-1116.288] (-1120.041) (-1117.507) (-1117.613) * [-1120.401] (-1118.257) (-1116.923) (-1115.848) -- 0:00:46
      268500 -- (-1118.357) (-1118.913) [-1118.223] (-1118.187) * (-1119.596) (-1116.768) [-1115.683] (-1117.870) -- 0:00:46
      269000 -- (-1117.842) (-1118.706) (-1118.851) [-1118.686] * (-1117.361) [-1115.985] (-1117.477) (-1118.572) -- 0:00:46
      269500 -- (-1123.976) (-1117.764) [-1116.544] (-1117.474) * (-1117.361) [-1115.374] (-1116.823) (-1117.453) -- 0:00:46
      270000 -- (-1118.312) [-1115.998] (-1118.532) (-1116.717) * (-1116.821) (-1115.480) (-1117.156) [-1115.906] -- 0:00:45

      Average standard deviation of split frequencies: 0.009482

      270500 -- [-1117.835] (-1115.885) (-1117.823) (-1115.328) * [-1117.647] (-1115.480) (-1117.277) (-1118.930) -- 0:00:45
      271000 -- (-1118.275) (-1115.453) [-1116.120] (-1118.672) * (-1117.296) (-1115.262) (-1115.972) [-1116.157] -- 0:00:45
      271500 -- (-1120.071) (-1115.680) (-1116.984) [-1115.345] * (-1117.968) (-1116.217) (-1118.832) [-1117.595] -- 0:00:45
      272000 -- (-1119.300) [-1115.467] (-1117.478) (-1117.832) * (-1117.355) [-1116.233] (-1115.461) (-1117.642) -- 0:00:45
      272500 -- (-1116.870) (-1115.746) (-1117.012) [-1119.983] * (-1119.676) (-1115.845) [-1116.665] (-1117.517) -- 0:00:45
      273000 -- (-1118.437) (-1115.516) [-1115.959] (-1117.690) * [-1117.355] (-1118.016) (-1118.189) (-1121.526) -- 0:00:45
      273500 -- (-1118.494) (-1115.439) [-1115.972] (-1119.281) * (-1119.241) (-1117.954) [-1116.084] (-1117.742) -- 0:00:45
      274000 -- (-1119.856) (-1115.961) (-1118.094) [-1120.281] * (-1118.368) (-1122.010) (-1116.905) [-1117.340] -- 0:00:45
      274500 -- (-1120.870) [-1117.159] (-1117.177) (-1117.111) * [-1116.275] (-1122.010) (-1118.375) (-1116.550) -- 0:00:44
      275000 -- (-1117.965) (-1115.633) (-1118.238) [-1115.122] * (-1117.086) (-1117.628) [-1118.359] (-1115.182) -- 0:00:44

      Average standard deviation of split frequencies: 0.010248

      275500 -- [-1118.221] (-1115.499) (-1115.950) (-1115.321) * (-1118.663) [-1117.129] (-1117.904) (-1117.007) -- 0:00:44
      276000 -- (-1120.188) [-1116.543] (-1120.240) (-1115.892) * (-1118.134) (-1118.511) (-1118.446) [-1116.634] -- 0:00:44
      276500 -- (-1120.046) [-1121.465] (-1117.885) (-1116.862) * (-1115.676) (-1115.522) (-1120.472) [-1117.500] -- 0:00:44
      277000 -- (-1117.388) (-1122.300) (-1116.915) [-1116.295] * (-1116.309) (-1117.791) [-1118.061] (-1116.887) -- 0:00:44
      277500 -- (-1116.505) (-1120.693) (-1115.633) [-1116.533] * (-1115.684) (-1118.749) (-1118.011) [-1116.198] -- 0:00:44
      278000 -- (-1117.410) (-1119.020) [-1116.501] (-1117.409) * (-1117.094) [-1115.217] (-1117.444) (-1115.283) -- 0:00:44
      278500 -- (-1116.507) (-1119.406) (-1117.498) [-1116.535] * (-1117.898) [-1117.718] (-1116.266) (-1117.273) -- 0:00:44
      279000 -- (-1124.465) (-1118.097) [-1116.960] (-1115.197) * (-1117.201) (-1117.233) (-1116.938) [-1117.980] -- 0:00:43
      279500 -- (-1116.570) (-1119.458) (-1115.233) [-1115.603] * (-1117.337) [-1115.869] (-1118.780) (-1121.843) -- 0:00:43
      280000 -- [-1119.261] (-1116.202) (-1115.687) (-1119.050) * (-1116.527) [-1116.727] (-1119.435) (-1120.293) -- 0:00:46

      Average standard deviation of split frequencies: 0.009287

      280500 -- [-1119.333] (-1115.710) (-1116.687) (-1119.128) * (-1116.138) (-1116.860) [-1115.502] (-1118.899) -- 0:00:46
      281000 -- [-1117.057] (-1116.806) (-1116.249) (-1117.611) * [-1117.451] (-1117.716) (-1117.059) (-1117.133) -- 0:00:46
      281500 -- (-1116.662) (-1117.260) [-1118.333] (-1117.016) * (-1116.438) (-1116.006) [-1116.567] (-1122.279) -- 0:00:45
      282000 -- [-1116.913] (-1116.926) (-1118.256) (-1118.016) * (-1116.535) (-1115.737) (-1120.931) [-1117.645] -- 0:00:45
      282500 -- (-1119.225) (-1116.778) [-1117.229] (-1115.881) * [-1120.225] (-1121.392) (-1119.960) (-1117.721) -- 0:00:45
      283000 -- (-1117.252) (-1116.681) (-1115.577) [-1116.586] * [-1116.121] (-1118.088) (-1116.597) (-1116.689) -- 0:00:45
      283500 -- [-1116.829] (-1115.676) (-1117.045) (-1117.082) * [-1115.440] (-1117.069) (-1117.337) (-1116.323) -- 0:00:45
      284000 -- (-1116.926) (-1117.704) [-1120.606] (-1116.041) * (-1116.992) (-1115.002) (-1118.478) [-1116.592] -- 0:00:45
      284500 -- (-1117.642) (-1119.847) (-1118.247) [-1115.344] * (-1115.272) [-1115.570] (-1118.918) (-1117.144) -- 0:00:45
      285000 -- [-1117.884] (-1120.285) (-1119.305) (-1115.845) * [-1119.260] (-1116.338) (-1118.942) (-1116.096) -- 0:00:45

      Average standard deviation of split frequencies: 0.009523

      285500 -- (-1118.002) (-1120.282) [-1117.117] (-1115.119) * (-1115.709) (-1117.157) [-1116.780] (-1118.144) -- 0:00:45
      286000 -- [-1120.079] (-1117.118) (-1117.254) (-1116.219) * (-1115.288) (-1117.097) (-1117.486) [-1116.483] -- 0:00:44
      286500 -- (-1119.606) (-1117.193) (-1119.446) [-1116.182] * (-1116.445) [-1117.152] (-1119.420) (-1115.695) -- 0:00:44
      287000 -- [-1115.083] (-1116.329) (-1117.914) (-1118.606) * [-1115.999] (-1120.575) (-1116.423) (-1115.751) -- 0:00:44
      287500 -- [-1115.426] (-1115.748) (-1116.699) (-1117.946) * (-1118.658) (-1123.157) (-1118.409) [-1116.902] -- 0:00:44
      288000 -- (-1116.276) (-1118.054) (-1121.018) [-1116.762] * (-1117.541) [-1117.761] (-1116.578) (-1117.031) -- 0:00:44
      288500 -- (-1115.725) (-1117.255) (-1116.913) [-1118.185] * (-1118.476) (-1117.757) [-1117.751] (-1115.863) -- 0:00:44
      289000 -- (-1117.819) (-1117.483) (-1121.694) [-1118.257] * [-1119.561] (-1116.290) (-1118.248) (-1117.106) -- 0:00:44
      289500 -- [-1116.858] (-1115.404) (-1119.424) (-1118.924) * (-1118.424) [-1115.530] (-1116.297) (-1121.789) -- 0:00:44
      290000 -- (-1117.527) [-1116.585] (-1121.689) (-1116.597) * (-1117.956) (-1118.848) [-1115.814] (-1122.855) -- 0:00:44

      Average standard deviation of split frequencies: 0.010091

      290500 -- (-1120.178) (-1117.039) (-1119.171) [-1119.191] * (-1120.331) [-1120.941] (-1117.318) (-1121.884) -- 0:00:43
      291000 -- (-1117.897) (-1116.273) [-1121.308] (-1119.318) * [-1117.543] (-1116.166) (-1117.641) (-1116.100) -- 0:00:43
      291500 -- (-1117.076) (-1115.296) [-1119.313] (-1117.473) * (-1118.877) (-1116.636) (-1117.819) [-1116.393] -- 0:00:43
      292000 -- (-1116.562) (-1118.816) [-1118.560] (-1118.940) * (-1117.004) [-1118.024] (-1117.093) (-1115.608) -- 0:00:43
      292500 -- [-1115.484] (-1115.057) (-1118.430) (-1118.482) * (-1117.230) [-1116.033] (-1115.707) (-1117.260) -- 0:00:43
      293000 -- (-1116.714) [-1115.569] (-1117.631) (-1116.616) * (-1117.016) (-1116.166) (-1117.039) [-1118.378] -- 0:00:43
      293500 -- (-1115.437) (-1119.016) (-1121.227) [-1116.865] * (-1115.884) (-1119.056) (-1118.019) [-1115.614] -- 0:00:43
      294000 -- (-1119.485) (-1115.673) [-1117.851] (-1117.647) * (-1116.192) (-1115.411) (-1117.937) [-1116.029] -- 0:00:43
      294500 -- (-1117.597) (-1115.900) (-1118.381) [-1117.638] * [-1115.102] (-1115.412) (-1117.959) (-1115.834) -- 0:00:43
      295000 -- (-1116.984) [-1117.633] (-1114.938) (-1118.081) * (-1115.653) [-1116.412] (-1116.251) (-1115.493) -- 0:00:43

      Average standard deviation of split frequencies: 0.009732

      295500 -- (-1115.724) [-1115.021] (-1116.455) (-1120.482) * (-1117.227) (-1117.200) (-1116.660) [-1115.502] -- 0:00:42
      296000 -- (-1115.509) (-1115.442) [-1115.310] (-1121.747) * (-1118.213) [-1116.160] (-1119.662) (-1117.473) -- 0:00:45
      296500 -- (-1116.071) (-1118.704) [-1118.089] (-1117.894) * [-1115.018] (-1115.555) (-1119.293) (-1117.712) -- 0:00:45
      297000 -- (-1117.157) [-1118.069] (-1117.095) (-1117.876) * [-1116.362] (-1115.160) (-1118.986) (-1116.896) -- 0:00:44
      297500 -- (-1118.407) (-1116.920) [-1119.400] (-1120.541) * (-1116.213) (-1116.479) (-1122.212) [-1121.626] -- 0:00:44
      298000 -- [-1117.576] (-1119.781) (-1118.798) (-1119.095) * (-1117.509) (-1117.899) (-1118.420) [-1122.465] -- 0:00:44
      298500 -- (-1116.761) (-1120.198) (-1115.946) [-1118.557] * (-1120.684) (-1115.534) [-1119.275] (-1121.738) -- 0:00:44
      299000 -- (-1117.377) (-1120.269) [-1117.199] (-1117.388) * (-1118.410) (-1115.799) [-1115.780] (-1118.647) -- 0:00:44
      299500 -- (-1117.512) (-1119.797) (-1115.774) [-1118.252] * [-1117.902] (-1116.280) (-1116.042) (-1118.806) -- 0:00:44
      300000 -- (-1117.854) (-1118.260) (-1115.750) [-1115.964] * (-1123.890) (-1116.510) [-1116.798] (-1116.952) -- 0:00:44

      Average standard deviation of split frequencies: 0.009668

      300500 -- [-1117.218] (-1117.210) (-1116.127) (-1115.698) * (-1121.116) (-1116.460) (-1118.269) [-1116.477] -- 0:00:44
      301000 -- (-1119.176) (-1117.516) [-1116.694] (-1116.535) * [-1119.962] (-1116.336) (-1117.537) (-1116.893) -- 0:00:44
      301500 -- (-1117.021) (-1117.690) (-1116.902) [-1116.647] * [-1117.790] (-1115.323) (-1120.291) (-1117.214) -- 0:00:44
      302000 -- (-1116.761) (-1118.802) [-1115.609] (-1119.185) * (-1120.818) [-1115.257] (-1121.539) (-1117.358) -- 0:00:43
      302500 -- (-1116.136) (-1115.896) (-1115.605) [-1117.071] * (-1118.591) [-1116.050] (-1116.875) (-1119.161) -- 0:00:43
      303000 -- (-1116.931) (-1117.154) [-1115.330] (-1116.458) * (-1121.132) (-1115.255) [-1116.520] (-1116.286) -- 0:00:43
      303500 -- (-1117.628) (-1116.540) [-1115.830] (-1117.664) * (-1115.528) (-1116.278) [-1116.843] (-1118.150) -- 0:00:43
      304000 -- (-1116.774) [-1117.034] (-1117.187) (-1117.153) * (-1115.779) [-1117.825] (-1116.624) (-1118.981) -- 0:00:43
      304500 -- (-1116.532) (-1117.934) (-1118.000) [-1115.684] * (-1116.438) (-1116.198) [-1118.626] (-1120.936) -- 0:00:43
      305000 -- (-1116.862) [-1118.360] (-1120.247) (-1116.372) * (-1115.977) [-1116.782] (-1118.198) (-1119.186) -- 0:00:43

      Average standard deviation of split frequencies: 0.008131

      305500 -- (-1117.194) [-1116.738] (-1117.984) (-1119.276) * (-1116.745) [-1120.950] (-1118.372) (-1118.264) -- 0:00:43
      306000 -- (-1116.533) [-1117.845] (-1121.341) (-1118.408) * (-1117.441) (-1115.726) [-1118.041] (-1117.593) -- 0:00:43
      306500 -- (-1116.157) (-1116.003) [-1117.304] (-1120.087) * (-1116.669) (-1115.439) (-1117.825) [-1115.189] -- 0:00:42
      307000 -- (-1116.382) [-1115.281] (-1116.814) (-1117.331) * (-1115.564) (-1117.413) (-1118.515) [-1115.512] -- 0:00:42
      307500 -- (-1116.793) [-1115.279] (-1119.250) (-1117.331) * (-1116.581) (-1121.082) (-1119.869) [-1116.978] -- 0:00:42
      308000 -- (-1116.331) (-1116.238) (-1116.946) [-1119.988] * (-1116.160) (-1117.702) (-1119.367) [-1116.170] -- 0:00:42
      308500 -- [-1116.479] (-1120.772) (-1115.564) (-1121.140) * (-1116.248) (-1117.485) [-1116.273] (-1117.347) -- 0:00:42
      309000 -- (-1117.746) (-1115.965) [-1115.102] (-1118.586) * (-1118.134) [-1116.293] (-1116.521) (-1117.808) -- 0:00:42
      309500 -- (-1116.929) (-1117.216) (-1118.434) [-1118.678] * (-1116.432) (-1117.764) [-1116.248] (-1117.065) -- 0:00:42
      310000 -- (-1116.964) (-1119.266) [-1115.350] (-1116.664) * [-1116.497] (-1119.170) (-1117.666) (-1118.479) -- 0:00:42

      Average standard deviation of split frequencies: 0.007924

      310500 -- (-1117.133) (-1116.859) (-1115.356) [-1116.828] * (-1116.464) (-1117.454) (-1116.401) [-1118.408] -- 0:00:42
      311000 -- (-1120.062) (-1116.621) [-1115.200] (-1116.299) * (-1115.539) (-1116.358) (-1116.857) [-1115.569] -- 0:00:42
      311500 -- (-1119.046) (-1115.893) [-1115.026] (-1117.378) * (-1116.238) (-1116.363) [-1115.674] (-1116.123) -- 0:00:41
      312000 -- (-1121.466) [-1115.043] (-1115.170) (-1117.016) * (-1115.844) [-1118.903] (-1117.044) (-1115.297) -- 0:00:44
      312500 -- [-1120.480] (-1115.101) (-1115.842) (-1121.069) * [-1115.814] (-1123.465) (-1116.626) (-1116.083) -- 0:00:44
      313000 -- [-1117.072] (-1115.101) (-1115.767) (-1121.497) * [-1116.523] (-1121.678) (-1118.008) (-1117.656) -- 0:00:43
      313500 -- (-1116.570) [-1120.508] (-1118.007) (-1122.585) * [-1115.801] (-1118.359) (-1117.816) (-1120.186) -- 0:00:43
      314000 -- [-1116.158] (-1118.136) (-1117.984) (-1116.863) * [-1116.744] (-1115.144) (-1115.298) (-1116.496) -- 0:00:43
      314500 -- (-1116.849) (-1117.071) [-1118.794] (-1116.183) * (-1115.987) (-1115.100) [-1116.177] (-1118.360) -- 0:00:43
      315000 -- (-1116.987) (-1117.525) [-1117.680] (-1116.960) * (-1115.224) (-1117.702) [-1115.784] (-1116.278) -- 0:00:43

      Average standard deviation of split frequencies: 0.007210

      315500 -- (-1118.462) [-1116.195] (-1116.402) (-1116.836) * (-1117.329) [-1116.298] (-1117.995) (-1116.596) -- 0:00:43
      316000 -- [-1118.437] (-1115.880) (-1116.587) (-1117.134) * (-1117.003) (-1116.754) (-1117.661) [-1116.652] -- 0:00:43
      316500 -- (-1115.255) [-1115.153] (-1116.489) (-1119.447) * (-1115.641) (-1115.818) (-1117.542) [-1118.233] -- 0:00:43
      317000 -- (-1116.067) (-1116.504) [-1122.925] (-1116.837) * (-1118.708) [-1117.468] (-1116.832) (-1119.446) -- 0:00:43
      317500 -- (-1117.789) (-1115.903) [-1123.680] (-1117.417) * [-1117.130] (-1116.673) (-1116.157) (-1121.636) -- 0:00:42
      318000 -- (-1118.467) [-1120.036] (-1119.185) (-1117.179) * [-1116.177] (-1116.872) (-1117.845) (-1120.756) -- 0:00:42
      318500 -- [-1117.404] (-1116.248) (-1118.644) (-1118.177) * (-1119.074) (-1117.254) [-1119.408] (-1117.096) -- 0:00:42
      319000 -- (-1123.539) (-1115.866) (-1117.356) [-1118.442] * (-1119.175) (-1122.502) (-1120.049) [-1115.843] -- 0:00:42
      319500 -- [-1116.868] (-1115.613) (-1116.946) (-1117.830) * [-1116.415] (-1119.405) (-1123.883) (-1115.235) -- 0:00:42
      320000 -- (-1117.677) [-1115.335] (-1116.565) (-1116.962) * (-1116.046) (-1118.712) (-1122.657) [-1115.235] -- 0:00:42

      Average standard deviation of split frequencies: 0.007105

      320500 -- (-1117.406) (-1115.529) [-1117.590] (-1119.815) * [-1115.287] (-1120.888) (-1116.432) (-1116.215) -- 0:00:42
      321000 -- (-1117.720) (-1119.505) [-1115.638] (-1121.043) * (-1114.962) (-1117.595) (-1119.876) [-1115.807] -- 0:00:42
      321500 -- [-1116.908] (-1116.907) (-1115.523) (-1116.959) * (-1117.293) (-1121.103) (-1119.213) [-1116.898] -- 0:00:42
      322000 -- [-1118.959] (-1118.018) (-1126.278) (-1115.836) * (-1117.796) [-1120.893] (-1117.303) (-1118.102) -- 0:00:42
      322500 -- (-1117.108) (-1117.992) [-1116.717] (-1117.498) * [-1117.931] (-1119.307) (-1118.467) (-1121.219) -- 0:00:42
      323000 -- (-1117.259) (-1117.590) [-1115.964] (-1117.498) * (-1120.595) [-1119.853] (-1117.118) (-1118.395) -- 0:00:41
      323500 -- (-1122.851) [-1118.174] (-1117.089) (-1117.498) * (-1122.353) [-1118.767] (-1115.958) (-1118.561) -- 0:00:41
      324000 -- (-1126.970) (-1117.558) (-1118.273) [-1115.478] * (-1117.037) (-1119.053) (-1119.604) [-1117.014] -- 0:00:41
      324500 -- (-1117.964) (-1117.150) [-1121.086] (-1116.546) * (-1117.412) [-1119.768] (-1120.470) (-1120.280) -- 0:00:41
      325000 -- [-1116.296] (-1117.738) (-1119.719) (-1120.726) * [-1116.989] (-1116.681) (-1120.944) (-1120.217) -- 0:00:41

      Average standard deviation of split frequencies: 0.007953

      325500 -- (-1118.094) (-1118.003) [-1117.173] (-1121.564) * (-1118.277) (-1115.095) [-1117.257] (-1118.421) -- 0:00:41
      326000 -- (-1115.644) [-1117.435] (-1115.801) (-1118.646) * (-1118.599) (-1116.136) [-1117.160] (-1122.738) -- 0:00:41
      326500 -- (-1117.232) (-1117.350) [-1116.191] (-1115.578) * (-1124.853) [-1115.940] (-1117.157) (-1116.265) -- 0:00:41
      327000 -- (-1117.211) [-1115.139] (-1117.868) (-1116.010) * (-1119.240) (-1116.860) [-1115.772] (-1116.662) -- 0:00:41
      327500 -- [-1118.724] (-1115.906) (-1119.365) (-1115.784) * [-1115.746] (-1114.866) (-1120.669) (-1115.921) -- 0:00:41
      328000 -- [-1117.320] (-1118.140) (-1117.401) (-1115.186) * (-1115.642) [-1115.384] (-1115.967) (-1115.814) -- 0:00:40
      328500 -- [-1119.749] (-1115.741) (-1119.207) (-1117.834) * (-1116.466) [-1115.943] (-1116.614) (-1116.287) -- 0:00:42
      329000 -- (-1117.518) (-1116.480) (-1118.729) [-1117.981] * (-1116.465) [-1116.895] (-1115.827) (-1115.094) -- 0:00:42
      329500 -- (-1117.336) [-1115.587] (-1117.448) (-1119.736) * (-1116.685) [-1116.643] (-1115.412) (-1115.675) -- 0:00:42
      330000 -- (-1120.653) [-1116.007] (-1119.438) (-1116.534) * [-1118.380] (-1114.948) (-1115.710) (-1116.119) -- 0:00:42

      Average standard deviation of split frequencies: 0.007128

      330500 -- (-1118.488) [-1115.531] (-1119.533) (-1118.327) * (-1118.741) (-1116.117) [-1116.157] (-1116.545) -- 0:00:42
      331000 -- (-1116.564) (-1116.082) [-1119.100] (-1116.914) * (-1115.509) (-1117.927) (-1116.753) [-1117.290] -- 0:00:42
      331500 -- (-1116.868) [-1116.539] (-1118.865) (-1116.965) * [-1115.646] (-1117.096) (-1118.402) (-1116.596) -- 0:00:42
      332000 -- (-1115.777) (-1117.461) [-1115.852] (-1118.939) * [-1116.572] (-1116.611) (-1115.519) (-1117.356) -- 0:00:42
      332500 -- (-1115.205) [-1116.118] (-1122.990) (-1116.869) * (-1115.485) [-1115.885] (-1118.098) (-1120.663) -- 0:00:42
      333000 -- (-1115.899) (-1115.532) [-1124.585] (-1117.101) * (-1114.919) [-1117.626] (-1117.100) (-1117.620) -- 0:00:42
      333500 -- (-1117.378) (-1116.606) (-1118.316) [-1115.552] * [-1114.986] (-1116.685) (-1117.682) (-1115.144) -- 0:00:41
      334000 -- (-1116.159) (-1115.829) [-1115.440] (-1117.582) * (-1114.999) (-1117.336) (-1118.197) [-1118.457] -- 0:00:41
      334500 -- (-1115.376) [-1120.975] (-1117.253) (-1119.435) * (-1115.879) [-1117.539] (-1115.913) (-1118.551) -- 0:00:41
      335000 -- (-1116.667) (-1118.377) [-1116.557] (-1116.683) * (-1130.089) (-1117.236) [-1115.313] (-1117.343) -- 0:00:41

      Average standard deviation of split frequencies: 0.007561

      335500 -- (-1117.778) (-1116.811) [-1117.326] (-1116.463) * [-1117.287] (-1117.610) (-1115.715) (-1117.249) -- 0:00:41
      336000 -- (-1116.943) [-1115.840] (-1120.051) (-1118.035) * (-1115.686) (-1120.096) (-1117.496) [-1119.098] -- 0:00:41
      336500 -- (-1118.956) (-1115.970) [-1118.163] (-1116.040) * (-1115.011) (-1120.463) [-1119.286] (-1117.647) -- 0:00:41
      337000 -- (-1124.473) (-1116.148) [-1116.186] (-1115.900) * [-1115.011] (-1117.668) (-1118.155) (-1117.379) -- 0:00:41
      337500 -- [-1118.125] (-1116.939) (-1121.468) (-1118.440) * (-1115.354) (-1116.591) [-1115.276] (-1119.552) -- 0:00:41
      338000 -- (-1115.299) (-1115.914) (-1119.684) [-1117.218] * (-1116.942) [-1118.427] (-1116.936) (-1115.430) -- 0:00:41
      338500 -- (-1116.293) (-1115.452) (-1121.714) [-1121.385] * (-1115.290) (-1117.667) [-1118.447] (-1119.180) -- 0:00:41
      339000 -- (-1115.067) (-1116.415) [-1118.988] (-1121.028) * (-1117.301) (-1116.247) [-1117.869] (-1119.050) -- 0:00:40
      339500 -- (-1119.440) (-1117.700) [-1115.620] (-1118.301) * [-1115.640] (-1116.446) (-1118.838) (-1119.048) -- 0:00:40
      340000 -- (-1116.654) [-1120.631] (-1115.973) (-1117.551) * (-1115.280) [-1120.180] (-1116.590) (-1116.023) -- 0:00:40

      Average standard deviation of split frequencies: 0.007489

      340500 -- (-1117.195) [-1120.653] (-1114.970) (-1117.650) * [-1116.877] (-1119.561) (-1116.233) (-1119.368) -- 0:00:40
      341000 -- (-1116.745) (-1117.462) [-1117.253] (-1119.064) * (-1116.930) (-1117.766) [-1117.572] (-1117.254) -- 0:00:40
      341500 -- (-1117.363) (-1117.464) [-1120.629] (-1116.904) * (-1124.520) [-1118.929] (-1116.905) (-1116.554) -- 0:00:40
      342000 -- [-1117.323] (-1117.060) (-1116.190) (-1116.164) * (-1118.836) (-1120.098) [-1115.725] (-1116.870) -- 0:00:40
      342500 -- (-1116.465) (-1116.207) (-1115.975) [-1118.710] * (-1118.621) (-1118.445) (-1115.334) [-1115.001] -- 0:00:40
      343000 -- [-1117.489] (-1116.355) (-1119.956) (-1120.566) * (-1115.677) (-1119.088) [-1115.546] (-1115.037) -- 0:00:40
      343500 -- [-1120.445] (-1117.163) (-1117.508) (-1118.183) * (-1116.504) (-1120.376) (-1117.167) [-1117.318] -- 0:00:40
      344000 -- (-1122.342) [-1118.715] (-1115.310) (-1115.732) * (-1116.385) (-1122.781) [-1115.355] (-1119.852) -- 0:00:40
      344500 -- (-1116.573) (-1118.541) (-1120.265) [-1116.480] * [-1116.345] (-1118.999) (-1117.515) (-1121.809) -- 0:00:39
      345000 -- [-1116.432] (-1121.095) (-1117.401) (-1118.126) * (-1115.959) (-1115.239) [-1117.369] (-1116.025) -- 0:00:41

      Average standard deviation of split frequencies: 0.008629

      345500 -- (-1115.365) [-1120.817] (-1117.549) (-1118.421) * (-1116.211) [-1119.141] (-1119.799) (-1115.172) -- 0:00:41
      346000 -- [-1115.677] (-1117.815) (-1115.874) (-1117.797) * [-1116.017] (-1115.636) (-1121.165) (-1114.965) -- 0:00:41
      346500 -- (-1117.239) (-1120.085) [-1116.060] (-1116.461) * (-1118.374) (-1115.318) [-1118.082] (-1115.404) -- 0:00:41
      347000 -- [-1115.895] (-1126.497) (-1116.923) (-1116.585) * (-1121.305) [-1115.415] (-1116.411) (-1116.604) -- 0:00:41
      347500 -- [-1117.330] (-1120.814) (-1117.826) (-1116.912) * (-1121.158) (-1116.626) [-1116.234] (-1116.310) -- 0:00:41
      348000 -- [-1116.773] (-1120.075) (-1117.613) (-1119.074) * (-1118.461) (-1116.635) (-1117.177) [-1115.550] -- 0:00:41
      348500 -- (-1118.770) (-1117.226) (-1115.101) [-1116.514] * (-1116.976) (-1119.061) (-1117.536) [-1115.190] -- 0:00:41
      349000 -- (-1117.102) [-1119.302] (-1116.110) (-1117.463) * (-1116.735) (-1116.985) (-1117.059) [-1115.632] -- 0:00:41
      349500 -- (-1116.002) (-1117.735) (-1117.243) [-1115.691] * (-1119.632) (-1116.064) [-1115.958] (-1116.415) -- 0:00:40
      350000 -- (-1117.456) [-1119.122] (-1117.106) (-1115.743) * (-1119.091) (-1117.118) (-1116.166) [-1117.018] -- 0:00:40

      Average standard deviation of split frequencies: 0.008514

      350500 -- (-1119.284) (-1118.182) (-1117.425) [-1116.596] * [-1119.261] (-1121.248) (-1117.726) (-1115.818) -- 0:00:40
      351000 -- (-1118.032) [-1117.298] (-1116.059) (-1115.283) * (-1117.622) (-1117.749) [-1116.200] (-1116.967) -- 0:00:40
      351500 -- [-1118.029] (-1118.694) (-1115.601) (-1119.896) * (-1118.129) (-1118.007) [-1115.809] (-1115.649) -- 0:00:40
      352000 -- (-1117.012) [-1116.399] (-1115.822) (-1118.113) * (-1120.021) (-1115.194) (-1117.060) [-1115.868] -- 0:00:40
      352500 -- (-1117.451) (-1117.845) (-1115.822) [-1116.672] * [-1120.785] (-1116.265) (-1116.877) (-1118.963) -- 0:00:40
      353000 -- [-1116.232] (-1117.190) (-1115.527) (-1116.364) * [-1117.566] (-1116.706) (-1116.447) (-1124.845) -- 0:00:40
      353500 -- (-1116.027) (-1118.959) (-1120.672) [-1117.240] * (-1116.722) (-1115.743) (-1115.960) [-1115.438] -- 0:00:40
      354000 -- (-1116.671) (-1114.882) (-1118.391) [-1116.235] * (-1116.930) [-1117.425] (-1119.443) (-1118.469) -- 0:00:40
      354500 -- (-1115.834) (-1116.475) (-1117.502) [-1115.801] * [-1115.738] (-1114.921) (-1116.209) (-1117.378) -- 0:00:40
      355000 -- [-1115.230] (-1118.513) (-1115.225) (-1115.914) * (-1115.805) (-1119.707) [-1116.170] (-1115.936) -- 0:00:39

      Average standard deviation of split frequencies: 0.008534

      355500 -- [-1115.932] (-1118.409) (-1115.820) (-1119.262) * [-1118.866] (-1116.515) (-1115.524) (-1120.500) -- 0:00:39
      356000 -- (-1115.655) (-1119.985) [-1117.511] (-1117.949) * [-1116.077] (-1119.482) (-1117.123) (-1117.334) -- 0:00:39
      356500 -- [-1116.442] (-1118.668) (-1124.206) (-1117.755) * [-1116.335] (-1120.152) (-1118.468) (-1116.685) -- 0:00:39
      357000 -- [-1117.595] (-1117.068) (-1119.329) (-1118.568) * (-1115.410) (-1116.325) [-1117.954] (-1116.761) -- 0:00:39
      357500 -- (-1118.143) (-1115.698) (-1117.367) [-1119.674] * (-1116.373) (-1118.739) [-1119.230] (-1116.567) -- 0:00:39
      358000 -- (-1116.776) (-1122.294) [-1115.867] (-1115.928) * [-1119.680] (-1117.728) (-1117.074) (-1116.637) -- 0:00:39
      358500 -- (-1116.630) (-1117.770) [-1115.763] (-1120.779) * (-1121.465) [-1115.318] (-1116.457) (-1116.890) -- 0:00:39
      359000 -- (-1118.291) [-1118.451] (-1116.124) (-1118.774) * [-1116.871] (-1116.008) (-1116.050) (-1117.265) -- 0:00:39
      359500 -- (-1116.946) [-1117.485] (-1117.341) (-1118.165) * (-1116.750) [-1116.525] (-1115.828) (-1117.349) -- 0:00:39
      360000 -- [-1115.623] (-1119.327) (-1115.550) (-1119.272) * (-1116.837) (-1119.071) [-1115.762] (-1118.947) -- 0:00:39

      Average standard deviation of split frequencies: 0.008641

      360500 -- [-1115.616] (-1120.065) (-1116.646) (-1120.448) * [-1116.525] (-1119.871) (-1115.942) (-1117.839) -- 0:00:39
      361000 -- [-1116.809] (-1119.044) (-1117.168) (-1124.239) * (-1116.790) (-1121.408) [-1114.907] (-1116.423) -- 0:00:40
      361500 -- (-1118.176) [-1115.078] (-1116.897) (-1116.989) * (-1116.590) (-1117.920) [-1115.040] (-1120.181) -- 0:00:40
      362000 -- (-1116.301) [-1115.719] (-1116.989) (-1118.117) * (-1116.736) (-1118.613) (-1116.602) [-1116.246] -- 0:00:40
      362500 -- (-1118.699) (-1119.384) (-1117.242) [-1118.119] * [-1118.500] (-1117.354) (-1118.932) (-1117.083) -- 0:00:40
      363000 -- (-1116.312) (-1118.689) (-1116.785) [-1120.791] * (-1117.780) [-1116.517] (-1117.480) (-1117.073) -- 0:00:40
      363500 -- (-1116.564) (-1118.068) (-1115.503) [-1115.661] * [-1120.809] (-1116.009) (-1119.780) (-1117.708) -- 0:00:40
      364000 -- (-1118.648) [-1121.867] (-1115.115) (-1116.130) * (-1117.804) (-1115.354) (-1121.346) [-1120.822] -- 0:00:40
      364500 -- (-1116.141) (-1117.915) [-1115.534] (-1120.726) * [-1120.322] (-1121.080) (-1119.113) (-1116.552) -- 0:00:40
      365000 -- (-1116.293) (-1122.184) (-1115.705) [-1116.704] * (-1118.341) (-1119.077) (-1118.422) [-1115.891] -- 0:00:40

      Average standard deviation of split frequencies: 0.007943

      365500 -- (-1117.524) [-1120.136] (-1117.581) (-1115.068) * (-1116.255) [-1116.438] (-1117.550) (-1115.430) -- 0:00:39
      366000 -- (-1121.087) (-1120.018) [-1115.489] (-1117.297) * [-1116.519] (-1117.642) (-1115.676) (-1117.016) -- 0:00:39
      366500 -- (-1116.681) (-1118.172) (-1114.972) [-1116.836] * (-1118.257) [-1116.114] (-1115.751) (-1117.627) -- 0:00:39
      367000 -- (-1116.537) (-1119.502) [-1117.596] (-1117.913) * (-1115.572) (-1117.879) [-1116.057] (-1117.728) -- 0:00:39
      367500 -- (-1116.149) (-1117.450) [-1118.413] (-1117.912) * (-1116.501) (-1119.827) (-1117.918) [-1118.408] -- 0:00:39
      368000 -- [-1117.511] (-1116.164) (-1116.382) (-1116.340) * (-1116.413) (-1122.803) (-1117.636) [-1116.810] -- 0:00:39
      368500 -- (-1118.201) (-1118.505) (-1120.414) [-1115.195] * (-1116.350) [-1119.278] (-1117.625) (-1117.564) -- 0:00:39
      369000 -- (-1116.661) [-1117.685] (-1120.542) (-1115.607) * (-1119.533) [-1117.467] (-1116.442) (-1119.258) -- 0:00:39
      369500 -- (-1117.755) (-1121.129) (-1120.393) [-1117.261] * (-1116.858) [-1117.631] (-1118.098) (-1116.108) -- 0:00:39
      370000 -- (-1120.242) [-1119.062] (-1125.533) (-1118.548) * (-1118.807) (-1118.960) (-1117.255) [-1116.443] -- 0:00:39

      Average standard deviation of split frequencies: 0.008753

      370500 -- (-1119.371) (-1115.944) (-1120.341) [-1117.832] * [-1116.886] (-1114.835) (-1117.762) (-1118.195) -- 0:00:39
      371000 -- (-1118.631) (-1116.127) (-1116.551) [-1118.086] * (-1118.795) [-1115.306] (-1116.448) (-1119.031) -- 0:00:38
      371500 -- [-1119.208] (-1115.522) (-1116.434) (-1115.545) * [-1115.812] (-1116.745) (-1116.922) (-1118.312) -- 0:00:38
      372000 -- (-1117.199) (-1116.791) [-1117.142] (-1117.990) * (-1116.079) [-1115.775] (-1115.416) (-1120.050) -- 0:00:38
      372500 -- (-1115.970) (-1116.396) (-1117.047) [-1119.595] * (-1116.711) [-1116.601] (-1123.565) (-1117.532) -- 0:00:38
      373000 -- [-1117.310] (-1119.068) (-1116.699) (-1119.233) * [-1115.361] (-1116.386) (-1119.215) (-1115.372) -- 0:00:38
      373500 -- (-1117.474) (-1117.154) (-1116.359) [-1117.637] * (-1118.521) (-1116.245) (-1120.588) [-1115.492] -- 0:00:38
      374000 -- (-1117.943) (-1117.670) (-1117.278) [-1117.832] * (-1120.450) (-1116.793) (-1119.517) [-1117.118] -- 0:00:38
      374500 -- (-1115.830) [-1118.053] (-1118.447) (-1120.186) * [-1119.255] (-1121.807) (-1117.612) (-1117.475) -- 0:00:38
      375000 -- [-1116.590] (-1118.743) (-1117.705) (-1121.028) * [-1116.224] (-1120.475) (-1119.714) (-1115.767) -- 0:00:38

      Average standard deviation of split frequencies: 0.008997

      375500 -- (-1118.818) (-1116.816) [-1115.455] (-1115.375) * (-1116.660) (-1120.387) [-1115.827] (-1115.746) -- 0:00:38
      376000 -- (-1116.558) [-1116.274] (-1117.855) (-1118.144) * (-1115.254) (-1117.932) [-1116.458] (-1119.819) -- 0:00:38
      376500 -- (-1119.598) (-1118.561) [-1116.939] (-1118.013) * [-1116.769] (-1116.559) (-1116.324) (-1117.283) -- 0:00:38
      377000 -- [-1117.655] (-1117.954) (-1117.699) (-1117.430) * (-1117.433) [-1116.459] (-1116.518) (-1119.593) -- 0:00:38
      377500 -- [-1119.062] (-1117.271) (-1120.613) (-1117.508) * [-1116.194] (-1115.795) (-1117.876) (-1117.508) -- 0:00:39
      378000 -- (-1119.219) (-1116.992) [-1117.287] (-1121.070) * (-1114.940) (-1117.177) [-1115.690] (-1115.174) -- 0:00:39
      378500 -- (-1117.456) (-1118.819) (-1117.754) [-1118.719] * (-1116.003) [-1116.860] (-1121.503) (-1115.431) -- 0:00:39
      379000 -- (-1117.935) (-1117.070) [-1116.125] (-1119.551) * (-1117.507) (-1116.411) (-1124.734) [-1118.449] -- 0:00:39
      379500 -- (-1116.146) [-1116.297] (-1115.121) (-1119.285) * (-1117.019) [-1116.154] (-1123.256) (-1115.180) -- 0:00:39
      380000 -- (-1116.585) [-1116.485] (-1115.764) (-1117.496) * (-1118.923) (-1116.066) (-1119.759) [-1115.834] -- 0:00:39

      Average standard deviation of split frequencies: 0.008669

      380500 -- (-1116.698) (-1117.503) [-1121.032] (-1117.419) * (-1116.319) (-1118.842) [-1118.498] (-1116.001) -- 0:00:39
      381000 -- (-1116.431) (-1119.280) (-1116.058) [-1115.666] * [-1115.598] (-1117.591) (-1115.803) (-1116.809) -- 0:00:38
      381500 -- (-1119.574) (-1117.398) [-1116.728] (-1115.485) * [-1115.784] (-1116.757) (-1119.275) (-1121.227) -- 0:00:38
      382000 -- (-1117.121) [-1116.613] (-1116.575) (-1117.084) * (-1116.679) [-1116.664] (-1118.256) (-1117.563) -- 0:00:38
      382500 -- (-1116.341) [-1116.434] (-1116.141) (-1115.491) * (-1116.914) (-1118.423) [-1120.581] (-1117.404) -- 0:00:38
      383000 -- (-1115.092) (-1118.710) (-1119.084) [-1116.758] * (-1116.996) (-1117.017) (-1118.171) [-1119.700] -- 0:00:38
      383500 -- (-1115.871) [-1119.349] (-1116.030) (-1116.704) * (-1117.014) [-1121.248] (-1118.015) (-1116.897) -- 0:00:38
      384000 -- [-1116.672] (-1116.717) (-1116.525) (-1117.427) * (-1120.928) (-1122.567) (-1117.444) [-1117.170] -- 0:00:38
      384500 -- [-1118.190] (-1115.041) (-1115.156) (-1116.992) * (-1118.212) (-1122.300) (-1116.502) [-1118.443] -- 0:00:38
      385000 -- [-1115.823] (-1116.351) (-1115.084) (-1116.425) * (-1120.860) (-1126.314) (-1116.987) [-1119.154] -- 0:00:38

      Average standard deviation of split frequencies: 0.008345

      385500 -- [-1115.190] (-1116.587) (-1115.997) (-1117.326) * (-1119.744) (-1122.406) (-1116.757) [-1118.115] -- 0:00:38
      386000 -- (-1115.490) [-1115.232] (-1123.740) (-1118.428) * (-1120.041) (-1119.127) [-1118.327] (-1116.331) -- 0:00:38
      386500 -- (-1117.292) (-1117.480) (-1118.593) [-1117.766] * (-1118.727) (-1120.496) [-1116.707] (-1115.823) -- 0:00:38
      387000 -- (-1117.905) (-1119.223) [-1117.514] (-1118.777) * (-1118.607) [-1119.334] (-1116.608) (-1120.797) -- 0:00:38
      387500 -- (-1117.100) (-1116.554) (-1117.622) [-1116.314] * [-1118.670] (-1117.745) (-1116.221) (-1117.581) -- 0:00:37
      388000 -- (-1117.839) (-1118.477) (-1117.671) [-1116.505] * (-1119.209) (-1116.855) [-1116.195] (-1115.675) -- 0:00:37
      388500 -- [-1115.246] (-1115.807) (-1116.663) (-1117.746) * (-1117.305) (-1119.565) [-1115.185] (-1116.278) -- 0:00:37
      389000 -- (-1117.284) (-1115.583) (-1117.059) [-1117.448] * (-1116.925) (-1120.699) [-1116.789] (-1117.263) -- 0:00:37
      389500 -- (-1117.285) [-1115.310] (-1118.198) (-1117.735) * (-1117.115) (-1117.823) (-1117.697) [-1117.613] -- 0:00:37
      390000 -- (-1117.663) (-1116.283) (-1116.843) [-1115.299] * (-1115.779) (-1118.857) [-1117.941] (-1117.509) -- 0:00:37

      Average standard deviation of split frequencies: 0.008589

      390500 -- (-1119.026) (-1117.631) [-1117.118] (-1115.792) * (-1115.525) [-1117.383] (-1117.217) (-1116.864) -- 0:00:37
      391000 -- [-1119.956] (-1116.320) (-1116.728) (-1115.793) * (-1115.871) (-1122.410) [-1115.939] (-1118.748) -- 0:00:37
      391500 -- (-1116.741) [-1115.828] (-1115.591) (-1117.374) * [-1115.217] (-1116.530) (-1117.175) (-1118.204) -- 0:00:37
      392000 -- (-1115.115) [-1115.547] (-1117.421) (-1120.477) * (-1117.842) [-1118.624] (-1117.694) (-1117.159) -- 0:00:37
      392500 -- (-1116.294) (-1115.701) [-1116.231] (-1116.959) * (-1119.281) [-1116.762] (-1117.274) (-1122.116) -- 0:00:37
      393000 -- [-1116.722] (-1116.400) (-1117.724) (-1115.472) * (-1121.463) (-1115.206) [-1118.878] (-1120.112) -- 0:00:37
      393500 -- (-1117.586) [-1117.026] (-1117.390) (-1115.292) * (-1117.778) (-1118.006) (-1116.580) [-1121.438] -- 0:00:38
      394000 -- (-1118.957) [-1120.248] (-1116.739) (-1117.309) * (-1117.590) [-1117.655] (-1120.312) (-1120.237) -- 0:00:38
      394500 -- (-1123.698) (-1117.317) [-1117.163] (-1117.607) * (-1116.923) [-1114.949] (-1117.246) (-1116.911) -- 0:00:38
      395000 -- (-1121.663) [-1116.546] (-1115.718) (-1118.771) * (-1118.251) [-1117.209] (-1116.940) (-1117.013) -- 0:00:38

      Average standard deviation of split frequencies: 0.008184

      395500 -- (-1120.199) (-1122.543) [-1115.424] (-1120.520) * [-1117.618] (-1120.257) (-1116.298) (-1117.244) -- 0:00:38
      396000 -- (-1118.493) (-1123.653) (-1117.700) [-1121.472] * (-1118.521) (-1116.191) (-1117.474) [-1120.618] -- 0:00:38
      396500 -- (-1117.920) (-1120.047) (-1119.800) [-1115.563] * (-1120.672) (-1117.715) [-1117.183] (-1117.946) -- 0:00:38
      397000 -- (-1117.917) (-1118.024) [-1115.624] (-1119.125) * (-1117.879) (-1115.657) (-1116.599) [-1118.505] -- 0:00:37
      397500 -- (-1117.181) [-1117.770] (-1117.656) (-1117.726) * (-1115.018) [-1116.914] (-1116.775) (-1117.302) -- 0:00:37
      398000 -- (-1118.176) (-1116.948) [-1115.444] (-1119.219) * (-1115.850) [-1118.449] (-1117.409) (-1122.866) -- 0:00:37
      398500 -- (-1116.532) (-1116.341) (-1115.527) [-1115.707] * (-1117.747) (-1116.813) [-1117.397] (-1118.143) -- 0:00:37
      399000 -- (-1119.172) (-1117.173) (-1116.327) [-1115.011] * (-1117.408) (-1115.175) [-1116.715] (-1115.903) -- 0:00:37
      399500 -- (-1116.717) (-1117.507) [-1116.278] (-1116.271) * (-1117.628) [-1115.858] (-1116.075) (-1116.039) -- 0:00:37
      400000 -- [-1120.153] (-1116.964) (-1115.611) (-1116.200) * (-1118.727) (-1118.302) (-1116.380) [-1116.257] -- 0:00:37

      Average standard deviation of split frequencies: 0.008015

      400500 -- (-1117.981) (-1115.459) (-1116.065) [-1117.759] * [-1115.892] (-1119.647) (-1118.032) (-1115.767) -- 0:00:37
      401000 -- [-1116.654] (-1116.873) (-1116.749) (-1118.530) * (-1115.857) [-1119.065] (-1116.198) (-1118.182) -- 0:00:37
      401500 -- (-1117.287) [-1119.592] (-1117.463) (-1116.313) * [-1115.866] (-1120.554) (-1120.633) (-1117.561) -- 0:00:37
      402000 -- (-1116.889) (-1116.867) [-1118.454] (-1117.012) * (-1116.804) [-1116.832] (-1116.754) (-1117.894) -- 0:00:37
      402500 -- (-1117.347) (-1115.397) (-1118.769) [-1117.392] * (-1116.890) [-1116.956] (-1122.267) (-1115.725) -- 0:00:37
      403000 -- (-1116.922) (-1116.421) (-1123.591) [-1116.255] * (-1116.265) (-1115.718) [-1117.196] (-1116.643) -- 0:00:37
      403500 -- (-1117.808) [-1118.328] (-1126.911) (-1116.250) * (-1118.067) (-1115.751) [-1120.721] (-1118.914) -- 0:00:36
      404000 -- (-1117.403) (-1117.859) [-1116.523] (-1115.740) * (-1117.993) [-1116.985] (-1116.180) (-1121.365) -- 0:00:36
      404500 -- (-1117.550) [-1117.127] (-1117.344) (-1120.748) * (-1119.030) (-1119.583) [-1116.770] (-1115.506) -- 0:00:36
      405000 -- (-1116.010) [-1116.712] (-1121.387) (-1116.291) * (-1121.077) (-1116.045) [-1115.640] (-1115.316) -- 0:00:36

      Average standard deviation of split frequencies: 0.008563

      405500 -- (-1116.390) (-1116.081) (-1119.855) [-1117.060] * (-1119.154) (-1116.311) [-1115.754] (-1117.557) -- 0:00:36
      406000 -- [-1115.719] (-1116.660) (-1119.681) (-1116.447) * (-1118.344) [-1115.862] (-1117.491) (-1119.051) -- 0:00:36
      406500 -- [-1116.834] (-1119.542) (-1115.831) (-1115.950) * (-1118.762) (-1118.008) [-1115.384] (-1118.380) -- 0:00:36
      407000 -- [-1116.577] (-1122.510) (-1117.628) (-1115.943) * (-1123.595) (-1118.928) (-1116.592) [-1118.302] -- 0:00:36
      407500 -- (-1115.494) (-1120.066) (-1116.594) [-1115.500] * (-1116.404) (-1118.668) [-1115.551] (-1117.692) -- 0:00:36
      408000 -- (-1115.882) (-1123.725) [-1117.591] (-1115.930) * (-1115.544) [-1116.883] (-1115.036) (-1116.008) -- 0:00:36
      408500 -- [-1117.083] (-1120.086) (-1115.994) (-1117.284) * (-1117.822) (-1115.740) (-1116.768) [-1115.882] -- 0:00:36
      409000 -- (-1116.999) (-1118.569) (-1116.035) [-1116.830] * (-1118.156) [-1115.194] (-1118.004) (-1116.247) -- 0:00:36
      409500 -- (-1116.631) (-1117.523) (-1116.875) [-1116.857] * [-1116.373] (-1116.040) (-1115.631) (-1117.391) -- 0:00:37
      410000 -- (-1115.607) [-1117.245] (-1119.459) (-1120.873) * (-1116.680) [-1119.177] (-1115.431) (-1115.995) -- 0:00:37

      Average standard deviation of split frequencies: 0.008609

      410500 -- (-1118.918) (-1115.341) [-1117.860] (-1115.421) * [-1117.746] (-1116.883) (-1115.996) (-1117.246) -- 0:00:37
      411000 -- (-1120.235) [-1116.982] (-1116.867) (-1118.354) * (-1117.931) [-1116.779] (-1117.175) (-1118.499) -- 0:00:37
      411500 -- (-1120.514) (-1115.061) [-1116.723] (-1118.099) * [-1116.970] (-1115.799) (-1116.104) (-1117.065) -- 0:00:37
      412000 -- (-1118.964) (-1116.742) [-1116.356] (-1116.715) * [-1116.323] (-1115.847) (-1115.590) (-1117.050) -- 0:00:37
      412500 -- (-1119.785) (-1118.935) [-1116.844] (-1116.922) * [-1115.804] (-1117.947) (-1122.224) (-1120.661) -- 0:00:37
      413000 -- (-1116.742) [-1116.743] (-1118.055) (-1117.595) * (-1117.731) (-1122.734) [-1115.867] (-1119.491) -- 0:00:36
      413500 -- (-1117.217) (-1116.046) [-1116.500] (-1116.051) * (-1115.249) [-1117.795] (-1117.269) (-1119.462) -- 0:00:36
      414000 -- (-1114.963) (-1115.776) (-1116.197) [-1118.882] * (-1120.026) (-1119.119) (-1117.039) [-1115.912] -- 0:00:36
      414500 -- (-1115.361) (-1119.695) [-1117.525] (-1116.735) * [-1121.151] (-1119.032) (-1119.589) (-1115.292) -- 0:00:36
      415000 -- [-1115.726] (-1115.025) (-1116.906) (-1118.380) * [-1118.861] (-1118.216) (-1116.943) (-1116.049) -- 0:00:36

      Average standard deviation of split frequencies: 0.009065

      415500 -- (-1117.869) (-1117.100) [-1117.729] (-1115.680) * (-1118.612) (-1116.968) (-1120.365) [-1115.496] -- 0:00:36
      416000 -- (-1115.203) [-1116.720] (-1117.191) (-1124.735) * (-1120.794) [-1118.065] (-1122.838) (-1114.918) -- 0:00:36
      416500 -- [-1115.992] (-1117.609) (-1117.448) (-1116.313) * (-1116.814) (-1117.660) [-1117.855] (-1114.918) -- 0:00:36
      417000 -- (-1115.667) (-1115.712) [-1117.818] (-1117.232) * (-1115.781) (-1116.982) [-1119.264] (-1115.606) -- 0:00:36
      417500 -- (-1116.161) (-1119.044) (-1119.002) [-1116.291] * (-1117.266) (-1116.825) [-1116.613] (-1120.768) -- 0:00:36
      418000 -- (-1116.280) [-1117.985] (-1118.473) (-1116.957) * (-1117.008) (-1116.571) (-1115.409) [-1117.063] -- 0:00:36
      418500 -- [-1115.498] (-1120.356) (-1118.583) (-1118.990) * (-1116.083) [-1114.892] (-1115.264) (-1117.937) -- 0:00:36
      419000 -- [-1115.109] (-1117.168) (-1116.235) (-1118.503) * (-1118.893) (-1116.754) (-1117.911) [-1115.754] -- 0:00:36
      419500 -- (-1117.514) (-1116.741) (-1115.573) [-1120.033] * [-1117.466] (-1115.472) (-1119.116) (-1119.357) -- 0:00:35
      420000 -- [-1115.490] (-1114.944) (-1115.741) (-1115.863) * (-1118.278) (-1117.054) [-1116.423] (-1119.012) -- 0:00:35

      Average standard deviation of split frequencies: 0.009665

      420500 -- (-1117.005) (-1117.916) [-1117.094] (-1116.100) * (-1118.778) [-1117.340] (-1116.341) (-1119.807) -- 0:00:35
      421000 -- [-1117.554] (-1117.202) (-1117.709) (-1118.289) * [-1116.124] (-1118.972) (-1116.781) (-1117.525) -- 0:00:35
      421500 -- (-1116.421) [-1116.702] (-1116.051) (-1119.421) * (-1116.401) [-1118.838] (-1116.430) (-1121.460) -- 0:00:35
      422000 -- (-1117.133) (-1116.436) [-1114.981] (-1116.606) * (-1116.371) (-1117.958) (-1115.416) [-1120.713] -- 0:00:35
      422500 -- [-1118.579] (-1117.781) (-1117.591) (-1119.961) * (-1115.675) (-1119.108) (-1117.304) [-1117.008] -- 0:00:35
      423000 -- (-1119.153) [-1116.945] (-1120.004) (-1117.132) * (-1115.890) (-1118.760) (-1118.096) [-1119.167] -- 0:00:35
      423500 -- [-1117.529] (-1117.930) (-1116.298) (-1116.321) * (-1118.341) (-1118.717) [-1117.450] (-1119.489) -- 0:00:35
      424000 -- [-1116.554] (-1115.771) (-1118.874) (-1115.701) * (-1119.182) (-1117.566) [-1116.109] (-1115.404) -- 0:00:35
      424500 -- [-1118.718] (-1116.086) (-1117.582) (-1121.839) * [-1117.708] (-1118.185) (-1116.079) (-1115.457) -- 0:00:35
      425000 -- (-1116.123) [-1114.969] (-1118.544) (-1124.000) * (-1116.320) (-1117.664) [-1115.473] (-1115.566) -- 0:00:35

      Average standard deviation of split frequencies: 0.009829

      425500 -- [-1118.020] (-1117.308) (-1118.244) (-1121.034) * (-1116.299) (-1118.773) (-1116.181) [-1115.944] -- 0:00:35
      426000 -- [-1117.622] (-1120.322) (-1116.826) (-1127.740) * (-1115.741) (-1118.863) (-1120.332) [-1116.086] -- 0:00:36
      426500 -- (-1119.560) (-1118.293) [-1116.516] (-1123.525) * (-1118.232) [-1118.408] (-1116.861) (-1116.384) -- 0:00:36
      427000 -- [-1117.086] (-1119.982) (-1117.743) (-1115.910) * (-1115.623) (-1117.523) (-1117.560) [-1117.282] -- 0:00:36
      427500 -- (-1124.447) [-1116.613] (-1117.849) (-1115.798) * (-1117.225) (-1116.750) [-1117.539] (-1116.543) -- 0:00:36
      428000 -- (-1118.974) [-1116.544] (-1116.511) (-1116.376) * (-1118.684) (-1120.910) [-1117.024] (-1117.305) -- 0:00:36
      428500 -- [-1115.866] (-1116.887) (-1115.734) (-1115.832) * [-1115.948] (-1116.925) (-1118.930) (-1116.397) -- 0:00:36
      429000 -- [-1116.995] (-1117.545) (-1116.851) (-1120.276) * (-1119.074) [-1115.956] (-1118.044) (-1117.734) -- 0:00:35
      429500 -- [-1118.009] (-1118.788) (-1117.340) (-1122.067) * [-1117.218] (-1116.084) (-1116.818) (-1116.531) -- 0:00:35
      430000 -- (-1117.954) (-1121.229) (-1117.016) [-1117.151] * [-1115.405] (-1117.392) (-1116.126) (-1115.819) -- 0:00:35

      Average standard deviation of split frequencies: 0.010672

      430500 -- (-1117.874) (-1117.899) [-1114.847] (-1119.252) * (-1115.508) [-1117.073] (-1117.267) (-1118.133) -- 0:00:35
      431000 -- (-1118.760) [-1116.421] (-1116.487) (-1116.822) * (-1115.287) (-1116.711) [-1116.801] (-1114.991) -- 0:00:35
      431500 -- (-1115.980) (-1116.529) (-1116.397) [-1116.308] * (-1115.739) [-1115.605] (-1117.720) (-1119.817) -- 0:00:35
      432000 -- [-1117.170] (-1116.860) (-1123.055) (-1117.104) * (-1115.252) [-1116.127] (-1119.477) (-1122.673) -- 0:00:35
      432500 -- (-1120.496) [-1116.103] (-1118.611) (-1117.163) * (-1118.942) (-1117.336) [-1120.131] (-1128.536) -- 0:00:35
      433000 -- (-1118.617) (-1117.679) (-1122.730) [-1117.914] * (-1119.309) (-1118.130) [-1116.383] (-1119.400) -- 0:00:35
      433500 -- [-1117.662] (-1124.280) (-1120.414) (-1118.695) * (-1115.880) (-1118.868) [-1116.771] (-1119.152) -- 0:00:35
      434000 -- (-1117.332) [-1122.602] (-1123.176) (-1115.779) * (-1119.317) (-1117.339) [-1116.932] (-1117.176) -- 0:00:35
      434500 -- (-1117.803) (-1121.933) (-1119.195) [-1116.654] * (-1117.404) [-1115.636] (-1116.817) (-1116.017) -- 0:00:35
      435000 -- (-1116.596) (-1116.514) (-1120.538) [-1115.770] * (-1117.780) (-1115.605) [-1116.701] (-1115.902) -- 0:00:35

      Average standard deviation of split frequencies: 0.011150

      435500 -- (-1116.972) [-1116.177] (-1121.072) (-1117.469) * (-1118.318) [-1117.975] (-1116.607) (-1116.201) -- 0:00:34
      436000 -- (-1120.826) [-1116.251] (-1126.942) (-1119.330) * [-1116.693] (-1117.143) (-1115.945) (-1118.122) -- 0:00:34
      436500 -- (-1116.021) (-1122.355) [-1117.763] (-1118.092) * (-1116.337) [-1116.772] (-1117.857) (-1115.375) -- 0:00:34
      437000 -- [-1116.494] (-1117.946) (-1116.456) (-1117.949) * (-1120.599) [-1118.296] (-1119.623) (-1121.822) -- 0:00:34
      437500 -- [-1117.682] (-1117.020) (-1120.911) (-1119.148) * (-1115.935) (-1115.564) [-1119.919] (-1122.723) -- 0:00:34
      438000 -- [-1116.962] (-1118.753) (-1123.189) (-1118.719) * (-1115.314) [-1116.796] (-1117.855) (-1121.778) -- 0:00:34
      438500 -- (-1119.306) (-1115.747) (-1118.861) [-1115.746] * (-1115.474) (-1115.978) [-1117.425] (-1118.130) -- 0:00:34
      439000 -- [-1117.620] (-1116.035) (-1116.768) (-1116.522) * (-1120.116) [-1116.256] (-1121.679) (-1118.775) -- 0:00:34
      439500 -- (-1116.668) [-1117.503] (-1119.916) (-1120.896) * [-1115.705] (-1117.434) (-1116.266) (-1119.819) -- 0:00:34
      440000 -- (-1120.969) [-1117.638] (-1119.300) (-1117.442) * [-1115.712] (-1116.154) (-1116.460) (-1116.492) -- 0:00:34

      Average standard deviation of split frequencies: 0.011099

      440500 -- (-1119.049) (-1117.223) (-1123.910) [-1119.383] * (-1116.109) (-1120.037) (-1116.874) [-1116.859] -- 0:00:34
      441000 -- (-1117.298) (-1118.055) (-1118.582) [-1115.985] * [-1116.346] (-1119.066) (-1116.817) (-1116.524) -- 0:00:34
      441500 -- (-1117.250) [-1117.262] (-1115.975) (-1115.745) * [-1117.072] (-1117.721) (-1118.770) (-1117.508) -- 0:00:34
      442000 -- (-1116.878) (-1118.572) [-1118.537] (-1118.029) * (-1116.136) (-1118.071) (-1118.889) [-1116.345] -- 0:00:35
      442500 -- (-1117.822) (-1116.695) [-1116.498] (-1117.898) * [-1117.614] (-1115.562) (-1123.833) (-1116.279) -- 0:00:35
      443000 -- (-1117.934) (-1119.060) (-1115.436) [-1117.351] * (-1118.971) [-1115.509] (-1122.213) (-1118.559) -- 0:00:35
      443500 -- (-1119.103) (-1118.765) [-1115.513] (-1115.503) * [-1119.267] (-1116.578) (-1115.873) (-1116.561) -- 0:00:35
      444000 -- (-1119.791) (-1116.832) [-1116.824] (-1116.770) * (-1116.126) (-1116.322) [-1116.316] (-1116.627) -- 0:00:35
      444500 -- (-1119.285) [-1115.545] (-1115.100) (-1119.198) * (-1116.966) (-1115.188) [-1116.739] (-1117.452) -- 0:00:34
      445000 -- [-1118.788] (-1117.901) (-1116.957) (-1116.059) * (-1116.044) (-1118.294) [-1116.103] (-1116.830) -- 0:00:34

      Average standard deviation of split frequencies: 0.010636

      445500 -- (-1118.248) [-1115.591] (-1116.600) (-1116.613) * [-1117.001] (-1118.355) (-1116.550) (-1118.517) -- 0:00:34
      446000 -- (-1118.244) [-1115.173] (-1116.398) (-1116.167) * (-1119.443) (-1117.101) [-1116.550] (-1118.050) -- 0:00:34
      446500 -- [-1119.060] (-1116.775) (-1116.520) (-1116.849) * (-1116.229) (-1118.220) (-1115.394) [-1121.119] -- 0:00:34
      447000 -- (-1116.093) [-1116.495] (-1118.839) (-1117.320) * (-1115.632) (-1121.675) (-1116.186) [-1116.250] -- 0:00:34
      447500 -- [-1118.107] (-1118.255) (-1117.598) (-1119.200) * (-1120.106) [-1119.724] (-1116.988) (-1117.941) -- 0:00:34
      448000 -- (-1118.732) (-1122.757) (-1116.124) [-1117.868] * (-1117.124) (-1115.249) [-1117.134] (-1118.545) -- 0:00:34
      448500 -- [-1118.132] (-1116.164) (-1115.999) (-1116.439) * (-1120.449) (-1116.281) (-1117.555) [-1116.362] -- 0:00:34
      449000 -- (-1120.640) (-1126.948) [-1119.344] (-1118.506) * (-1121.927) [-1117.513] (-1116.597) (-1115.315) -- 0:00:34
      449500 -- (-1116.189) (-1118.724) [-1116.408] (-1118.012) * (-1121.863) (-1117.659) (-1116.396) [-1120.120] -- 0:00:34
      450000 -- [-1120.075] (-1118.785) (-1116.140) (-1115.575) * [-1116.657] (-1121.292) (-1116.660) (-1117.870) -- 0:00:34

      Average standard deviation of split frequencies: 0.009937

      450500 -- [-1121.031] (-1119.726) (-1118.326) (-1116.133) * [-1116.149] (-1115.887) (-1117.172) (-1117.511) -- 0:00:34
      451000 -- (-1119.140) (-1118.023) (-1120.906) [-1118.850] * (-1116.472) (-1116.275) [-1115.893] (-1117.088) -- 0:00:34
      451500 -- [-1115.594] (-1116.470) (-1121.406) (-1117.287) * (-1121.105) [-1117.007] (-1115.625) (-1122.460) -- 0:00:34
      452000 -- (-1118.539) (-1116.872) [-1117.901] (-1118.801) * (-1121.509) (-1119.716) (-1120.615) [-1118.860] -- 0:00:33
      452500 -- [-1115.908] (-1115.274) (-1119.977) (-1120.293) * [-1119.050] (-1117.285) (-1115.791) (-1118.851) -- 0:00:33
      453000 -- [-1116.518] (-1118.674) (-1118.219) (-1118.091) * [-1117.059] (-1115.377) (-1116.472) (-1119.182) -- 0:00:33
      453500 -- (-1116.377) [-1118.876] (-1116.038) (-1118.960) * (-1122.461) [-1117.936] (-1117.963) (-1121.200) -- 0:00:33
      454000 -- (-1117.775) (-1119.927) [-1117.899] (-1116.756) * (-1116.109) [-1120.332] (-1115.545) (-1118.700) -- 0:00:33
      454500 -- (-1122.742) (-1118.366) (-1116.212) [-1116.090] * [-1116.123] (-1118.264) (-1116.567) (-1117.551) -- 0:00:33
      455000 -- [-1117.255] (-1119.603) (-1119.181) (-1116.056) * (-1116.142) (-1117.305) (-1115.175) [-1118.037] -- 0:00:33

      Average standard deviation of split frequencies: 0.010467

      455500 -- (-1119.529) (-1116.133) [-1117.885] (-1116.064) * (-1116.407) (-1117.257) (-1115.388) [-1118.424] -- 0:00:33
      456000 -- [-1117.911] (-1119.313) (-1115.763) (-1116.950) * (-1116.037) (-1115.674) [-1116.348] (-1117.913) -- 0:00:33
      456500 -- [-1119.197] (-1121.025) (-1117.597) (-1118.236) * [-1121.448] (-1115.847) (-1122.721) (-1115.741) -- 0:00:33
      457000 -- (-1120.910) (-1116.747) [-1116.202] (-1117.093) * [-1120.518] (-1115.582) (-1116.780) (-1115.435) -- 0:00:33
      457500 -- (-1116.589) (-1117.834) (-1117.437) [-1115.721] * (-1116.469) [-1115.795] (-1117.947) (-1117.045) -- 0:00:33
      458000 -- (-1116.889) (-1117.459) (-1117.069) [-1115.848] * [-1116.113] (-1117.622) (-1117.323) (-1117.753) -- 0:00:33
      458500 -- (-1122.180) (-1118.079) (-1116.564) [-1115.079] * (-1116.612) [-1115.215] (-1117.304) (-1117.929) -- 0:00:34
      459000 -- [-1116.763] (-1117.468) (-1117.954) (-1116.142) * (-1115.349) [-1115.983] (-1120.364) (-1118.814) -- 0:00:34
      459500 -- (-1115.724) (-1115.793) [-1115.604] (-1116.157) * (-1115.932) [-1116.081] (-1117.840) (-1117.255) -- 0:00:34
      460000 -- [-1118.729] (-1115.442) (-1115.498) (-1118.188) * (-1115.928) (-1118.448) (-1116.843) [-1117.328] -- 0:00:34

      Average standard deviation of split frequencies: 0.010169

      460500 -- (-1117.711) [-1118.316] (-1116.018) (-1115.812) * [-1115.700] (-1118.086) (-1117.999) (-1117.231) -- 0:00:33
      461000 -- (-1116.482) (-1121.473) [-1115.342] (-1119.204) * (-1115.885) [-1117.329] (-1119.339) (-1119.487) -- 0:00:33
      461500 -- [-1115.573] (-1116.934) (-1115.496) (-1119.153) * [-1115.920] (-1117.188) (-1117.030) (-1117.947) -- 0:00:33
      462000 -- (-1116.755) (-1115.401) (-1114.974) [-1116.065] * (-1116.923) (-1116.961) [-1116.586] (-1117.768) -- 0:00:33
      462500 -- (-1117.396) (-1115.880) (-1117.506) [-1115.326] * (-1117.055) [-1119.594] (-1117.826) (-1126.448) -- 0:00:33
      463000 -- [-1118.680] (-1116.780) (-1119.645) (-1117.161) * [-1115.288] (-1121.122) (-1118.340) (-1120.753) -- 0:00:33
      463500 -- [-1116.522] (-1119.493) (-1116.795) (-1118.844) * (-1115.715) (-1117.802) [-1118.501] (-1120.486) -- 0:00:33
      464000 -- (-1115.737) [-1118.413] (-1115.537) (-1117.264) * (-1117.437) [-1117.223] (-1120.080) (-1123.632) -- 0:00:33
      464500 -- (-1117.660) [-1116.429] (-1117.646) (-1115.028) * [-1116.215] (-1117.019) (-1116.528) (-1116.549) -- 0:00:33
      465000 -- (-1118.066) (-1116.892) [-1116.910] (-1115.650) * (-1116.756) (-1117.287) [-1116.136] (-1118.014) -- 0:00:33

      Average standard deviation of split frequencies: 0.010242

      465500 -- (-1118.618) [-1120.579] (-1114.820) (-1117.623) * [-1119.722] (-1116.359) (-1118.713) (-1117.328) -- 0:00:33
      466000 -- (-1117.757) (-1114.945) [-1115.588] (-1116.904) * (-1118.256) [-1117.109] (-1117.366) (-1118.415) -- 0:00:33
      466500 -- (-1118.105) [-1115.491] (-1117.088) (-1115.445) * (-1117.657) (-1115.948) (-1116.302) [-1118.413] -- 0:00:33
      467000 -- (-1118.785) [-1118.816] (-1118.351) (-1117.993) * (-1116.578) (-1117.618) (-1115.458) [-1116.873] -- 0:00:33
      467500 -- (-1117.481) (-1116.734) (-1117.608) [-1117.939] * (-1115.985) [-1118.807] (-1118.789) (-1121.530) -- 0:00:33
      468000 -- (-1118.598) (-1119.391) (-1117.259) [-1116.159] * (-1116.134) (-1115.558) (-1116.592) [-1117.864] -- 0:00:32
      468500 -- [-1116.859] (-1117.103) (-1116.039) (-1117.648) * (-1117.206) (-1116.972) (-1116.634) [-1116.862] -- 0:00:32
      469000 -- (-1115.605) (-1118.729) (-1117.666) [-1115.508] * (-1120.486) (-1116.321) [-1116.253] (-1116.824) -- 0:00:32
      469500 -- [-1116.413] (-1116.501) (-1116.876) (-1118.140) * [-1117.227] (-1116.237) (-1117.864) (-1117.534) -- 0:00:32
      470000 -- (-1117.018) (-1116.707) (-1117.346) [-1116.417] * [-1117.947] (-1116.292) (-1115.927) (-1115.775) -- 0:00:32

      Average standard deviation of split frequencies: 0.010203

      470500 -- [-1118.616] (-1116.576) (-1118.582) (-1116.840) * (-1115.697) (-1116.237) [-1122.464] (-1119.776) -- 0:00:32
      471000 -- (-1118.067) (-1117.315) [-1116.604] (-1117.386) * (-1118.492) [-1116.354] (-1115.996) (-1116.623) -- 0:00:32
      471500 -- (-1116.864) (-1117.861) [-1117.043] (-1116.399) * [-1116.603] (-1115.656) (-1116.466) (-1116.086) -- 0:00:32
      472000 -- [-1115.698] (-1116.874) (-1120.580) (-1120.416) * [-1116.278] (-1115.889) (-1115.803) (-1120.272) -- 0:00:32
      472500 -- (-1115.599) (-1118.188) (-1116.004) [-1116.830] * (-1116.280) (-1117.266) (-1115.520) [-1117.346] -- 0:00:32
      473000 -- (-1115.728) (-1120.541) (-1117.361) [-1115.544] * [-1117.090] (-1116.370) (-1117.536) (-1115.518) -- 0:00:32
      473500 -- (-1115.822) (-1116.151) (-1116.055) [-1115.731] * [-1115.377] (-1115.697) (-1117.706) (-1119.070) -- 0:00:32
      474000 -- (-1115.592) [-1117.780] (-1116.777) (-1120.764) * (-1116.410) (-1116.648) [-1117.049] (-1118.117) -- 0:00:32
      474500 -- (-1114.869) (-1117.479) [-1117.995] (-1116.485) * (-1119.942) (-1118.959) [-1115.847] (-1122.825) -- 0:00:33
      475000 -- (-1114.872) [-1115.608] (-1123.217) (-1124.393) * (-1123.345) (-1116.793) (-1116.856) [-1116.707] -- 0:00:33

      Average standard deviation of split frequencies: 0.010275

      475500 -- [-1115.235] (-1116.688) (-1118.391) (-1121.247) * (-1116.732) [-1116.908] (-1115.942) (-1117.881) -- 0:00:33
      476000 -- (-1115.186) (-1118.323) [-1117.639] (-1117.630) * (-1117.095) [-1117.903] (-1117.422) (-1119.185) -- 0:00:33
      476500 -- (-1115.881) (-1122.804) [-1118.695] (-1119.875) * (-1115.675) [-1118.274] (-1119.898) (-1119.106) -- 0:00:32
      477000 -- (-1116.162) (-1118.653) [-1118.327] (-1118.662) * (-1116.368) (-1118.004) (-1116.965) [-1119.014] -- 0:00:32
      477500 -- (-1116.286) (-1120.356) (-1118.600) [-1118.354] * (-1123.293) (-1115.076) (-1115.932) [-1115.358] -- 0:00:32
      478000 -- (-1117.832) [-1121.315] (-1120.083) (-1115.919) * (-1124.401) (-1115.841) [-1115.924] (-1115.288) -- 0:00:32
      478500 -- [-1115.506] (-1122.365) (-1120.080) (-1119.016) * [-1115.798] (-1118.149) (-1116.929) (-1115.619) -- 0:00:32
      479000 -- [-1115.813] (-1122.777) (-1117.194) (-1117.743) * (-1119.256) [-1117.303] (-1121.043) (-1119.542) -- 0:00:32
      479500 -- (-1116.550) (-1117.853) (-1118.293) [-1116.514] * (-1117.185) (-1116.652) [-1121.297] (-1117.332) -- 0:00:32
      480000 -- (-1117.934) (-1116.461) (-1115.421) [-1115.667] * (-1116.475) (-1118.055) (-1117.806) [-1118.765] -- 0:00:32

      Average standard deviation of split frequencies: 0.009072

      480500 -- (-1118.507) [-1115.749] (-1116.274) (-1119.951) * (-1117.350) (-1120.986) [-1117.325] (-1118.842) -- 0:00:32
      481000 -- [-1119.497] (-1118.063) (-1122.868) (-1117.191) * (-1115.244) [-1120.778] (-1118.045) (-1117.351) -- 0:00:32
      481500 -- (-1120.750) [-1120.158] (-1119.387) (-1116.013) * [-1116.099] (-1119.922) (-1123.533) (-1116.877) -- 0:00:32
      482000 -- [-1119.466] (-1118.195) (-1116.313) (-1121.133) * (-1115.556) (-1118.460) (-1118.437) [-1115.902] -- 0:00:32
      482500 -- (-1120.485) [-1116.217] (-1116.105) (-1115.528) * [-1116.830] (-1122.665) (-1121.639) (-1116.929) -- 0:00:32
      483000 -- [-1118.122] (-1115.180) (-1117.272) (-1116.077) * [-1120.018] (-1117.319) (-1118.219) (-1118.934) -- 0:00:32
      483500 -- (-1116.795) (-1115.314) [-1115.518] (-1117.518) * (-1119.406) (-1116.060) (-1117.871) [-1116.438] -- 0:00:32
      484000 -- (-1116.619) [-1116.914] (-1117.472) (-1116.196) * (-1120.856) [-1116.653] (-1116.382) (-1121.420) -- 0:00:31
      484500 -- [-1116.452] (-1115.852) (-1115.342) (-1117.479) * (-1115.548) (-1115.288) (-1115.961) [-1118.220] -- 0:00:31
      485000 -- (-1115.602) [-1115.177] (-1115.389) (-1118.193) * [-1115.576] (-1118.245) (-1115.552) (-1117.339) -- 0:00:31

      Average standard deviation of split frequencies: 0.009275

      485500 -- (-1115.766) [-1115.452] (-1116.229) (-1116.484) * [-1115.342] (-1117.798) (-1118.252) (-1117.340) -- 0:00:31
      486000 -- [-1116.107] (-1118.222) (-1115.643) (-1118.131) * [-1118.177] (-1119.408) (-1116.137) (-1119.261) -- 0:00:31
      486500 -- (-1115.838) [-1115.757] (-1117.984) (-1117.582) * (-1119.267) [-1115.352] (-1124.783) (-1119.499) -- 0:00:31
      487000 -- (-1120.246) (-1117.443) (-1118.813) [-1116.615] * (-1119.802) (-1116.793) [-1118.941] (-1116.891) -- 0:00:31
      487500 -- [-1118.710] (-1114.807) (-1120.236) (-1117.417) * (-1116.669) (-1116.873) (-1118.117) [-1117.703] -- 0:00:31
      488000 -- (-1117.235) (-1118.326) [-1117.921] (-1117.289) * (-1116.172) (-1119.449) [-1117.159] (-1115.664) -- 0:00:31
      488500 -- (-1117.576) (-1119.518) [-1117.247] (-1117.643) * (-1116.138) (-1118.278) [-1115.235] (-1116.018) -- 0:00:31
      489000 -- (-1115.666) [-1116.740] (-1117.143) (-1118.049) * (-1116.138) (-1115.494) (-1116.977) [-1118.166] -- 0:00:31
      489500 -- (-1118.337) (-1115.240) (-1118.617) [-1116.364] * (-1117.165) (-1116.365) [-1117.981] (-1117.333) -- 0:00:31
      490000 -- (-1118.942) [-1115.811] (-1118.826) (-1117.271) * (-1117.725) [-1120.835] (-1118.074) (-1118.273) -- 0:00:31

      Average standard deviation of split frequencies: 0.009007

      490500 -- (-1122.613) (-1116.649) (-1120.726) [-1117.700] * (-1117.122) [-1119.157] (-1123.185) (-1116.612) -- 0:00:32
      491000 -- (-1118.774) (-1115.050) (-1115.944) [-1118.695] * [-1116.757] (-1119.526) (-1122.913) (-1116.692) -- 0:00:32
      491500 -- [-1116.729] (-1118.618) (-1115.950) (-1116.415) * [-1117.650] (-1119.163) (-1118.139) (-1116.586) -- 0:00:32
      492000 -- (-1117.810) (-1116.746) [-1117.538] (-1116.444) * (-1119.499) (-1117.008) (-1118.167) [-1117.163] -- 0:00:32
      492500 -- (-1115.764) (-1118.213) [-1118.631] (-1115.566) * [-1118.088] (-1118.151) (-1117.484) (-1117.631) -- 0:00:31
      493000 -- (-1115.854) (-1118.929) [-1122.569] (-1116.599) * [-1121.083] (-1115.820) (-1117.376) (-1115.821) -- 0:00:31
      493500 -- (-1116.793) (-1119.736) [-1117.688] (-1117.591) * [-1119.282] (-1116.909) (-1116.514) (-1117.141) -- 0:00:31
      494000 -- [-1115.769] (-1118.272) (-1118.913) (-1123.174) * (-1117.325) (-1123.992) [-1116.448] (-1117.508) -- 0:00:31
      494500 -- (-1115.270) (-1120.131) (-1115.711) [-1120.851] * (-1117.695) (-1125.485) (-1115.212) [-1118.693] -- 0:00:31
      495000 -- (-1115.456) (-1123.385) [-1117.672] (-1117.235) * (-1121.836) [-1116.249] (-1115.040) (-1118.213) -- 0:00:31

      Average standard deviation of split frequencies: 0.008673

      495500 -- [-1115.125] (-1116.181) (-1119.626) (-1115.920) * (-1119.441) (-1117.374) [-1116.699] (-1119.140) -- 0:00:31
      496000 -- (-1115.154) (-1116.272) (-1119.967) [-1115.578] * (-1117.167) [-1115.317] (-1118.034) (-1118.300) -- 0:00:31
      496500 -- (-1115.166) [-1116.537] (-1124.705) (-1122.220) * (-1117.766) [-1116.413] (-1118.198) (-1117.943) -- 0:00:31
      497000 -- (-1116.981) (-1116.486) [-1117.102] (-1119.125) * [-1117.621] (-1116.949) (-1124.657) (-1119.164) -- 0:00:31
      497500 -- (-1116.739) (-1119.409) (-1121.051) [-1117.277] * (-1115.830) (-1116.957) (-1117.378) [-1115.224] -- 0:00:31
      498000 -- (-1117.105) (-1115.742) [-1116.274] (-1121.764) * [-1116.003] (-1118.106) (-1119.567) (-1115.133) -- 0:00:31
      498500 -- (-1116.956) (-1115.715) [-1115.702] (-1118.075) * (-1115.877) (-1120.681) [-1116.776] (-1116.548) -- 0:00:31
      499000 -- (-1115.299) [-1119.742] (-1116.842) (-1117.917) * (-1121.849) (-1116.464) (-1117.256) [-1116.363] -- 0:00:31
      499500 -- (-1115.577) [-1119.219] (-1116.629) (-1115.778) * (-1125.229) (-1116.935) [-1117.326] (-1116.708) -- 0:00:31
      500000 -- (-1118.934) [-1118.940] (-1115.794) (-1118.123) * (-1118.985) (-1121.561) [-1116.144] (-1115.587) -- 0:00:31

      Average standard deviation of split frequencies: 0.008239

      500500 -- [-1116.836] (-1119.250) (-1120.616) (-1117.641) * (-1116.681) (-1119.620) [-1117.539] (-1116.744) -- 0:00:30
      501000 -- (-1115.789) (-1117.535) (-1116.923) [-1116.712] * (-1120.782) (-1116.796) (-1116.719) [-1116.483] -- 0:00:30
      501500 -- [-1116.834] (-1119.751) (-1120.355) (-1116.673) * (-1123.084) (-1116.149) (-1116.034) [-1116.266] -- 0:00:30
      502000 -- (-1117.545) (-1122.506) (-1117.737) [-1116.545] * (-1120.218) (-1115.105) (-1118.298) [-1117.605] -- 0:00:30
      502500 -- (-1116.903) (-1115.469) [-1116.744] (-1117.205) * (-1119.151) (-1119.690) [-1117.096] (-1117.577) -- 0:00:30
      503000 -- [-1116.618] (-1120.399) (-1116.749) (-1117.435) * (-1120.978) [-1117.298] (-1118.411) (-1116.445) -- 0:00:30
      503500 -- [-1120.229] (-1115.498) (-1117.550) (-1116.537) * (-1122.256) [-1117.145] (-1119.433) (-1116.943) -- 0:00:30
      504000 -- (-1117.161) (-1116.039) [-1118.556] (-1115.865) * (-1117.018) (-1118.777) [-1122.006] (-1118.369) -- 0:00:30
      504500 -- (-1116.791) [-1118.571] (-1120.955) (-1115.165) * (-1116.863) (-1116.951) [-1118.322] (-1117.197) -- 0:00:30
      505000 -- (-1119.714) (-1119.083) (-1116.278) [-1115.183] * (-1116.042) (-1118.500) (-1116.974) [-1116.364] -- 0:00:30

      Average standard deviation of split frequencies: 0.008559

      505500 -- [-1118.246] (-1117.963) (-1115.823) (-1115.178) * (-1115.923) [-1116.966] (-1118.086) (-1118.158) -- 0:00:30
      506000 -- (-1117.784) (-1116.599) (-1117.053) [-1114.897] * (-1118.229) (-1116.012) [-1117.925] (-1115.869) -- 0:00:30
      506500 -- (-1118.761) (-1117.863) (-1118.895) [-1114.886] * [-1117.013] (-1118.395) (-1119.924) (-1117.999) -- 0:00:30
      507000 -- [-1117.911] (-1117.187) (-1118.509) (-1117.733) * (-1116.815) [-1116.666] (-1116.695) (-1120.791) -- 0:00:31
      507500 -- (-1118.006) [-1115.716] (-1115.087) (-1118.324) * (-1116.086) (-1115.624) [-1120.658] (-1116.337) -- 0:00:31
      508000 -- (-1121.590) (-1116.680) [-1116.917] (-1118.085) * [-1114.992] (-1116.657) (-1118.207) (-1117.977) -- 0:00:30
      508500 -- [-1117.432] (-1117.274) (-1118.872) (-1116.869) * (-1114.993) [-1116.781] (-1118.563) (-1117.392) -- 0:00:30
      509000 -- (-1116.259) (-1118.873) [-1116.802] (-1116.611) * [-1114.898] (-1115.943) (-1120.200) (-1119.127) -- 0:00:30
      509500 -- (-1123.267) (-1117.416) (-1115.415) [-1116.087] * [-1116.636] (-1116.068) (-1122.802) (-1118.083) -- 0:00:30
      510000 -- (-1118.227) (-1118.253) (-1116.096) [-1116.074] * (-1119.204) [-1116.951] (-1116.038) (-1117.423) -- 0:00:30

      Average standard deviation of split frequencies: 0.008308

      510500 -- [-1115.919] (-1120.457) (-1116.885) (-1116.813) * (-1115.676) (-1117.521) [-1116.038] (-1116.218) -- 0:00:30
      511000 -- (-1115.795) (-1116.731) (-1119.272) [-1116.461] * (-1116.975) (-1123.906) (-1116.010) [-1117.761] -- 0:00:30
      511500 -- (-1117.378) (-1119.802) (-1116.435) [-1116.164] * (-1118.046) (-1119.084) [-1116.183] (-1122.171) -- 0:00:30
      512000 -- [-1115.628] (-1116.089) (-1117.942) (-1116.027) * (-1116.650) (-1116.875) [-1116.167] (-1118.568) -- 0:00:30
      512500 -- (-1115.881) (-1116.357) [-1115.486] (-1116.815) * (-1115.658) (-1116.459) [-1115.575] (-1116.862) -- 0:00:30
      513000 -- (-1115.348) [-1119.010] (-1119.026) (-1115.840) * (-1120.250) [-1118.354] (-1115.635) (-1117.977) -- 0:00:30
      513500 -- (-1115.650) (-1119.499) [-1115.625] (-1116.240) * (-1119.733) (-1120.389) (-1116.213) [-1119.837] -- 0:00:30
      514000 -- [-1119.281] (-1118.918) (-1119.055) (-1118.431) * (-1117.621) (-1116.586) (-1116.423) [-1116.607] -- 0:00:30
      514500 -- (-1122.389) [-1119.471] (-1118.310) (-1117.383) * (-1116.331) (-1116.800) [-1118.608] (-1115.787) -- 0:00:30
      515000 -- [-1116.593] (-1119.349) (-1118.322) (-1121.619) * [-1115.581] (-1118.119) (-1119.732) (-1117.529) -- 0:00:30

      Average standard deviation of split frequencies: 0.007994

      515500 -- (-1115.300) (-1117.229) [-1120.648] (-1116.536) * [-1119.379] (-1117.887) (-1116.549) (-1119.053) -- 0:00:30
      516000 -- [-1117.956] (-1120.021) (-1120.880) (-1118.