>C1
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C2
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C3
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C4
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C5
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C6
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=278
C1 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C2 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C3 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C4 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C5 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C6 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
**************************************************
C1 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C2 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C3 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C4 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C5 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C6 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
**************************************************
C1 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C2 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C3 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C4 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C5 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C6 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
**************************************************
C1 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C2 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C3 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C4 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C5 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C6 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
**************************************************
C1 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C2 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C3 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C4 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C5 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C6 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
**************************************************
C1 HQAFAQVEQFTGMPAPREAMACALAGLH
C2 HQAFAQVEQFTGMPAPREAMACALAGLH
C3 HQAFAQVEQFTGMPAPREAMACALAGLH
C4 HQAFAQVEQFTGMPAPREAMACALAGLH
C5 HQAFAQVEQFTGMPAPREAMACALAGLH
C6 HQAFAQVEQFTGMPAPREAMACALAGLH
****************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 278 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 278 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [8340]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [8340]--->[8340]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.496 Mb, Max= 30.831 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C2 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C3 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C4 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C5 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
C6 VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
**************************************************
C1 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C2 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C3 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C4 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C5 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
C6 AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
**************************************************
C1 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C2 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C3 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C4 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C5 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
C6 TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
**************************************************
C1 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C2 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C3 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C4 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C5 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
C6 TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
**************************************************
C1 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C2 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C3 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C4 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C5 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
C6 VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
**************************************************
C1 HQAFAQVEQFTGMPAPREAMACALAGLH
C2 HQAFAQVEQFTGMPAPREAMACALAGLH
C3 HQAFAQVEQFTGMPAPREAMACALAGLH
C4 HQAFAQVEQFTGMPAPREAMACALAGLH
C5 HQAFAQVEQFTGMPAPREAMACALAGLH
C6 HQAFAQVEQFTGMPAPREAMACALAGLH
****************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C2 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C3 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C4 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C5 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
C6 GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
**************************************************
C1 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C2 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C3 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C4 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C5 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
C6 TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
**************************************************
C1 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C2 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C3 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C4 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C5 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
C6 ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
**************************************************
C1 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C2 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C3 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C4 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C5 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
C6 GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
**************************************************
C1 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C2 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C3 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C4 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C5 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
C6 CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
**************************************************
C1 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C2 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C3 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C4 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C5 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
C6 AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
**************************************************
C1 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C2 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C3 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C4 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C5 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
C6 ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
**************************************************
C1 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C2 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C3 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C4 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C5 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
C6 GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
**************************************************
C1 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C2 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C3 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C4 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C5 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
C6 CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
**************************************************
C1 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C2 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C3 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C4 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C5 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
C6 ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
**************************************************
C1 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C2 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C3 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C4 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C5 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
C6 CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
**************************************************
C1 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C2 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C3 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C4 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C5 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
C6 GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
**************************************************
C1 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C2 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C3 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C4 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C5 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
C6 GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
**************************************************
C1 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C2 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C3 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C4 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C5 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
C6 GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
**************************************************
C1 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C2 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C3 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C4 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C5 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
C6 CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
**************************************************
C1 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C2 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C3 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C4 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C5 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
C6 CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
**************************************************
C1 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C2 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C3 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C4 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C5 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
C6 AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
**********************************
>C1
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C2
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C3
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C4
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C5
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C6
GTGTCCTTGACAGCGTGCGCTAACAAGGGGCCGCGAAAAGCTGGAATTAT
TGGTTCTCCAATCGCGCATTCCCGTTCCCCGCACTTGCACCTGGCCGCTT
ACCGTGCACTGCGTCTCCACGACTGGACGTATGAGCGGATCGAATGCGAT
GCTGAAGAGCTCCCGACTGTCGTTAGCGGGTTCGGGCCGCAGTGGGTCGG
CGTTTCAGTGACCATGCCGGGCAAATTCGCCGCGCTGCGGTTCGCCGATG
AGCACACTGCACGTGCCAGCCTGGTTGGGTCGGCTAACACGCTGCTGCGG
ACCCAGCGCGGCTGGCGGGCCGACAACACCGACATTGATGGTGTGGCGGG
GGCGCTGGCGGCGATCGGGCCTTTGGCAGGGCGTGCGCTAGTGTGCGGGT
CGGGCGGCACTGCTCCGGCGGCTGTGATGGGGTTGGCTGAACTGGGCGTC
ACCGATATCACCGTTTTGGCACGCAATCCCGACAAGGCGTCCCGGTTGGT
CGATCTCGGGGTTCAGGTCGGTGTGGCGACCCGATTGTGCGGTCTGGACA
GCGGTGGCTTGGCAGATGAGGTGAAGGCTGCCGAAGTGCTGGTTAGTACG
GTACCGGCAGATGTGGCTGCGCGGTATGTCGATGTCTTCGCGACGGTCCC
GGTGCTGCTAGATGCAATCTACGACCCGTGGCCTACGCCACTGGTCGCAG
CGGTGTCCGCGGCGGGCGGCCGAGTGATCAGCGGCTTGCAAATGCTGTTG
CATCAAGCGTTTGCGCAGGTGGAGCAATTCACCGGGATGCCTGCACCGCG
AGAGGCGATGGCTTGTGCTCTGGCGGGTTTGCAT
>C1
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C2
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C3
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C4
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C5
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
>C6
VSLTACANKGPRKAGIIGSPIAHSRSPHLHLAAYRALRLHDWTYERIECD
AEELPTVVSGFGPQWVGVSVTMPGKFAALRFADEHTARASLVGSANTLLR
TQRGWRADNTDIDGVAGALAAIGPLAGRALVCGSGGTAPAAVMGLAELGV
TDITVLARNPDKASRLVDLGVQVGVATRLCGLDSGGLADEVKAAEVLVST
VPADVAARYVDVFATVPVLLDAIYDPWPTPLVAAVSAAGGRVISGLQMLL
HQAFAQVEQFTGMPAPREAMACALAGLH
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 834 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773039
Setting output file names to "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1874064387
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8317723847
Seed = 328786654
Swapseed = 1579773039
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1866.531867 -- -24.965149
Chain 2 -- -1866.531976 -- -24.965149
Chain 3 -- -1866.531867 -- -24.965149
Chain 4 -- -1866.531976 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1866.531867 -- -24.965149
Chain 2 -- -1866.531976 -- -24.965149
Chain 3 -- -1866.531976 -- -24.965149
Chain 4 -- -1866.531976 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1866.532] (-1866.532) (-1866.532) (-1866.532) * [-1866.532] (-1866.532) (-1866.532) (-1866.532)
500 -- (-1142.935) (-1144.387) [-1128.310] (-1139.721) * (-1143.242) [-1122.959] (-1121.584) (-1170.442) -- 0:00:00
1000 -- (-1131.831) [-1123.777] (-1130.196) (-1126.019) * (-1129.714) (-1121.219) [-1128.304] (-1143.733) -- 0:00:00
1500 -- (-1127.445) (-1128.299) [-1125.712] (-1121.182) * (-1131.573) (-1123.053) [-1124.544] (-1130.926) -- 0:00:00
2000 -- (-1122.850) [-1131.786] (-1127.596) (-1129.290) * (-1129.593) (-1123.948) (-1126.174) [-1125.934] -- 0:00:00
2500 -- (-1122.794) (-1124.794) [-1123.848] (-1124.924) * (-1138.275) (-1125.273) (-1127.133) [-1122.914] -- 0:00:00
3000 -- (-1123.854) (-1129.168) [-1123.216] (-1126.968) * (-1128.922) (-1124.148) (-1125.909) [-1127.124] -- 0:00:00
3500 -- [-1130.507] (-1128.203) (-1132.203) (-1128.011) * (-1123.389) (-1123.522) (-1131.993) [-1124.157] -- 0:00:00
4000 -- (-1121.148) (-1130.674) [-1123.829] (-1126.379) * (-1133.271) (-1126.553) (-1125.866) [-1124.151] -- 0:00:00
4500 -- [-1123.851] (-1126.896) (-1127.647) (-1122.140) * (-1131.885) (-1123.334) [-1122.645] (-1128.068) -- 0:00:00
5000 -- (-1117.462) [-1130.021] (-1124.685) (-1123.333) * (-1122.257) (-1126.898) [-1120.490] (-1124.819) -- 0:00:00
Average standard deviation of split frequencies: 0.081983
5500 -- [-1128.931] (-1127.837) (-1128.043) (-1131.566) * [-1134.211] (-1128.522) (-1125.690) (-1119.892) -- 0:00:00
6000 -- (-1123.594) [-1129.296] (-1122.473) (-1117.844) * [-1128.819] (-1131.215) (-1125.988) (-1125.875) -- 0:00:00
6500 -- (-1128.013) (-1125.193) [-1121.319] (-1127.855) * (-1128.026) (-1136.537) [-1125.403] (-1125.564) -- 0:00:00
7000 -- (-1123.454) (-1124.620) (-1126.190) [-1120.487] * [-1125.083] (-1136.482) (-1121.603) (-1132.875) -- 0:02:21
7500 -- (-1125.881) [-1117.060] (-1128.136) (-1130.543) * [-1134.040] (-1133.588) (-1125.940) (-1126.667) -- 0:02:12
8000 -- [-1124.165] (-1124.436) (-1125.216) (-1133.156) * [-1127.327] (-1132.624) (-1122.854) (-1130.848) -- 0:02:04
8500 -- (-1125.923) [-1122.435] (-1128.714) (-1134.334) * (-1123.775) (-1136.479) (-1123.766) [-1126.685] -- 0:01:56
9000 -- (-1126.781) [-1122.409] (-1130.608) (-1129.069) * (-1127.981) [-1129.780] (-1125.458) (-1122.492) -- 0:01:50
9500 -- (-1126.467) [-1125.280] (-1126.772) (-1122.005) * [-1121.883] (-1127.138) (-1123.808) (-1127.146) -- 0:01:44
10000 -- (-1125.485) (-1127.283) [-1122.784] (-1123.017) * (-1120.255) [-1127.048] (-1120.671) (-1123.565) -- 0:01:39
Average standard deviation of split frequencies: 0.061030
10500 -- (-1125.591) [-1124.635] (-1129.189) (-1132.533) * (-1142.408) [-1124.792] (-1123.264) (-1121.218) -- 0:01:34
11000 -- (-1128.862) (-1127.188) (-1123.303) [-1129.217] * (-1125.934) [-1129.704] (-1127.209) (-1127.853) -- 0:01:29
11500 -- (-1121.860) (-1128.739) [-1127.154] (-1125.687) * (-1121.346) (-1131.251) [-1125.353] (-1130.673) -- 0:01:25
12000 -- (-1127.722) (-1123.855) [-1121.255] (-1128.409) * (-1124.387) (-1131.987) [-1126.302] (-1130.618) -- 0:01:22
12500 -- [-1126.162] (-1126.616) (-1125.685) (-1127.414) * (-1118.675) (-1130.122) (-1129.607) [-1124.173] -- 0:01:19
13000 -- (-1129.171) [-1125.111] (-1131.025) (-1121.179) * (-1118.688) [-1128.265] (-1129.867) (-1130.324) -- 0:01:15
13500 -- (-1125.998) (-1133.344) (-1122.850) [-1125.644] * (-1117.797) (-1135.225) (-1127.936) [-1124.008] -- 0:01:13
14000 -- (-1129.295) (-1134.733) [-1125.765] (-1129.219) * (-1117.449) [-1127.832] (-1120.523) (-1129.693) -- 0:01:10
14500 -- [-1127.892] (-1126.736) (-1126.466) (-1125.835) * (-1116.940) [-1124.932] (-1118.984) (-1125.981) -- 0:01:07
15000 -- [-1124.532] (-1121.762) (-1125.059) (-1122.360) * [-1116.133] (-1123.154) (-1118.906) (-1133.410) -- 0:01:05
Average standard deviation of split frequencies: 0.076257
15500 -- (-1121.202) (-1129.344) (-1123.702) [-1127.685] * (-1121.610) [-1123.916] (-1116.707) (-1144.819) -- 0:01:03
16000 -- (-1125.714) (-1135.316) [-1122.036] (-1123.261) * (-1119.509) [-1126.283] (-1119.282) (-1135.370) -- 0:01:01
16500 -- (-1129.179) (-1134.709) (-1121.142) [-1120.146] * (-1118.552) (-1128.135) [-1116.723] (-1120.329) -- 0:00:59
17000 -- [-1122.708] (-1141.242) (-1123.732) (-1121.677) * (-1116.406) [-1127.567] (-1116.723) (-1119.235) -- 0:00:57
17500 -- (-1125.827) (-1127.286) [-1128.801] (-1128.853) * (-1115.785) (-1120.960) (-1120.112) [-1118.066] -- 0:00:56
18000 -- [-1123.506] (-1132.863) (-1133.656) (-1125.164) * (-1117.371) (-1124.139) [-1117.760] (-1122.590) -- 0:00:54
18500 -- (-1124.351) [-1125.250] (-1121.897) (-1129.434) * (-1120.836) [-1128.125] (-1115.775) (-1118.416) -- 0:00:53
19000 -- (-1125.860) [-1127.327] (-1128.427) (-1128.751) * (-1118.366) (-1124.677) [-1119.298] (-1117.931) -- 0:00:51
19500 -- (-1123.703) (-1134.181) [-1125.568] (-1129.928) * (-1118.410) (-1127.115) [-1115.394] (-1117.002) -- 0:00:50
20000 -- (-1124.192) (-1124.174) [-1121.477] (-1126.262) * (-1117.961) (-1130.194) [-1115.295] (-1116.166) -- 0:00:49
Average standard deviation of split frequencies: 0.063361
20500 -- (-1127.623) (-1123.385) [-1123.815] (-1144.277) * (-1120.062) [-1129.972] (-1115.405) (-1116.218) -- 0:00:47
21000 -- (-1122.022) (-1125.184) [-1127.125] (-1129.997) * [-1117.607] (-1125.497) (-1117.091) (-1115.408) -- 0:00:46
21500 -- [-1126.483] (-1124.309) (-1124.089) (-1124.627) * [-1117.994] (-1124.690) (-1118.836) (-1117.902) -- 0:00:45
22000 -- (-1129.898) (-1128.915) [-1123.710] (-1122.835) * (-1118.380) (-1122.796) [-1117.142] (-1116.759) -- 0:00:44
22500 -- (-1136.745) (-1127.366) [-1127.425] (-1130.763) * [-1116.485] (-1118.864) (-1116.862) (-1117.187) -- 0:00:43
23000 -- (-1125.095) (-1132.025) [-1127.314] (-1122.240) * (-1116.332) (-1121.510) (-1117.318) [-1116.703] -- 0:01:24
23500 -- [-1122.107] (-1136.967) (-1137.981) (-1129.928) * (-1117.356) (-1123.781) (-1118.000) [-1115.873] -- 0:01:23
24000 -- [-1127.835] (-1124.914) (-1120.967) (-1132.432) * [-1115.251] (-1126.040) (-1116.194) (-1117.816) -- 0:01:21
24500 -- (-1130.345) [-1127.052] (-1135.290) (-1126.084) * (-1116.584) (-1123.889) (-1116.902) [-1117.279] -- 0:01:19
25000 -- [-1123.740] (-1133.356) (-1123.750) (-1138.917) * (-1117.603) [-1122.801] (-1117.124) (-1117.753) -- 0:01:18
Average standard deviation of split frequencies: 0.061488
25500 -- (-1126.143) (-1124.276) (-1133.435) [-1121.958] * (-1116.142) (-1142.389) (-1116.777) [-1116.891] -- 0:01:16
26000 -- [-1120.721] (-1134.248) (-1128.568) (-1132.403) * (-1116.964) (-1132.405) (-1121.641) [-1116.861] -- 0:01:14
26500 -- (-1129.012) (-1128.781) (-1128.470) [-1125.104] * (-1116.248) (-1132.472) (-1116.902) [-1118.282] -- 0:01:13
27000 -- [-1127.940] (-1128.903) (-1128.426) (-1129.389) * [-1117.752] (-1132.144) (-1118.417) (-1118.173) -- 0:01:12
27500 -- (-1130.481) (-1125.634) (-1123.083) [-1127.148] * (-1117.780) (-1124.734) [-1117.833] (-1117.101) -- 0:01:10
28000 -- [-1124.590] (-1130.709) (-1121.846) (-1136.214) * (-1118.202) (-1120.849) (-1116.794) [-1117.117] -- 0:01:09
28500 -- (-1133.760) (-1129.612) [-1119.816] (-1127.138) * (-1117.425) (-1129.897) [-1116.391] (-1119.647) -- 0:01:08
29000 -- (-1125.765) (-1123.921) (-1132.117) [-1125.812] * [-1117.521] (-1122.388) (-1115.790) (-1117.427) -- 0:01:06
29500 -- (-1128.417) (-1126.315) [-1123.131] (-1123.025) * (-1119.766) (-1129.774) (-1125.280) [-1116.923] -- 0:01:05
30000 -- [-1129.127] (-1126.851) (-1134.051) (-1136.732) * [-1116.666] (-1123.010) (-1117.146) (-1116.913) -- 0:01:04
Average standard deviation of split frequencies: 0.048212
30500 -- (-1126.137) [-1129.652] (-1121.899) (-1130.093) * (-1117.865) (-1135.932) (-1118.137) [-1117.625] -- 0:01:03
31000 -- [-1124.863] (-1128.077) (-1119.261) (-1125.526) * [-1115.443] (-1132.328) (-1118.735) (-1119.580) -- 0:01:02
31500 -- (-1123.419) (-1129.524) [-1123.102] (-1121.269) * (-1115.905) (-1121.668) [-1118.899] (-1116.141) -- 0:01:01
32000 -- (-1135.030) (-1128.342) (-1126.060) [-1129.613] * (-1115.730) (-1128.291) (-1117.023) [-1115.931] -- 0:01:00
32500 -- [-1126.663] (-1127.525) (-1122.022) (-1127.445) * (-1117.627) (-1123.963) [-1116.846] (-1116.002) -- 0:00:59
33000 -- (-1124.204) (-1137.143) [-1123.075] (-1121.637) * (-1117.875) (-1128.942) [-1118.718] (-1117.594) -- 0:00:58
33500 -- [-1130.249] (-1133.321) (-1124.140) (-1129.610) * [-1118.190] (-1121.653) (-1117.231) (-1118.031) -- 0:00:57
34000 -- (-1130.683) (-1131.784) [-1128.339] (-1127.856) * (-1122.288) [-1125.243] (-1115.702) (-1118.914) -- 0:00:56
34500 -- (-1124.818) (-1124.210) (-1127.346) [-1120.017] * (-1123.034) (-1133.046) (-1116.180) [-1121.463] -- 0:00:55
35000 -- (-1130.469) (-1125.432) (-1132.619) [-1124.436] * (-1121.960) (-1135.354) [-1121.954] (-1120.280) -- 0:00:55
Average standard deviation of split frequencies: 0.046176
35500 -- [-1126.414] (-1126.071) (-1124.077) (-1141.225) * [-1117.725] (-1125.951) (-1119.561) (-1116.525) -- 0:00:54
36000 -- (-1121.419) (-1125.041) (-1131.442) [-1121.181] * (-1119.516) (-1125.675) (-1116.966) [-1118.517] -- 0:00:53
36500 -- (-1126.493) [-1121.462] (-1125.783) (-1126.928) * (-1120.126) [-1133.345] (-1117.533) (-1119.697) -- 0:00:52
37000 -- [-1126.306] (-1117.705) (-1129.423) (-1124.544) * (-1117.592) (-1126.026) [-1117.945] (-1117.710) -- 0:00:52
37500 -- (-1126.491) (-1115.646) [-1125.318] (-1128.397) * [-1117.993] (-1134.745) (-1118.857) (-1117.932) -- 0:00:51
38000 -- (-1145.252) (-1116.313) (-1133.497) [-1120.903] * [-1118.025] (-1121.762) (-1118.445) (-1116.553) -- 0:00:50
38500 -- (-1124.918) (-1115.993) [-1120.779] (-1124.906) * (-1116.708) (-1125.064) (-1120.077) [-1118.991] -- 0:00:49
39000 -- (-1118.399) (-1115.820) (-1125.116) [-1125.727] * (-1116.434) [-1128.121] (-1121.129) (-1116.368) -- 0:01:13
39500 -- (-1115.857) (-1115.735) (-1128.898) [-1118.650] * (-1119.536) [-1124.366] (-1118.615) (-1116.111) -- 0:01:12
40000 -- (-1120.242) [-1116.219] (-1124.070) (-1124.441) * (-1118.396) (-1124.487) (-1118.091) [-1116.238] -- 0:01:12
Average standard deviation of split frequencies: 0.044919
40500 -- (-1118.671) (-1118.384) (-1138.135) [-1130.626] * (-1117.946) [-1123.958] (-1118.207) (-1116.062) -- 0:01:11
41000 -- [-1116.236] (-1115.641) (-1158.928) (-1125.851) * [-1116.756] (-1127.025) (-1117.490) (-1119.081) -- 0:01:10
41500 -- (-1118.176) (-1118.692) [-1119.079] (-1125.905) * (-1118.003) (-1128.961) [-1117.344] (-1118.264) -- 0:01:09
42000 -- (-1116.519) (-1121.265) (-1115.371) [-1122.209] * (-1116.468) (-1132.658) [-1116.542] (-1117.917) -- 0:01:08
42500 -- (-1117.757) [-1117.292] (-1117.350) (-1122.739) * (-1118.889) (-1125.178) [-1120.290] (-1115.906) -- 0:01:07
43000 -- [-1119.182] (-1117.195) (-1117.068) (-1126.921) * (-1118.888) (-1126.136) (-1117.575) [-1117.362] -- 0:01:06
43500 -- (-1119.597) (-1115.251) [-1116.584] (-1121.525) * (-1118.259) (-1130.575) [-1116.876] (-1118.797) -- 0:01:05
44000 -- (-1119.384) (-1115.546) [-1117.390] (-1127.394) * (-1115.727) (-1127.697) [-1116.608] (-1116.276) -- 0:01:05
44500 -- (-1115.373) (-1120.582) [-1118.736] (-1126.765) * (-1116.451) (-1129.544) [-1119.743] (-1118.235) -- 0:01:04
45000 -- (-1116.879) (-1119.271) (-1117.409) [-1125.991] * [-1116.451] (-1123.957) (-1116.051) (-1116.626) -- 0:01:03
Average standard deviation of split frequencies: 0.039374
45500 -- (-1117.294) (-1115.520) [-1116.752] (-1122.332) * (-1115.351) (-1129.692) [-1117.639] (-1116.439) -- 0:01:02
46000 -- (-1116.390) (-1115.955) [-1117.230] (-1128.492) * (-1117.658) (-1124.532) [-1116.488] (-1116.436) -- 0:01:02
46500 -- [-1115.343] (-1117.837) (-1117.115) (-1125.021) * (-1117.065) (-1127.534) [-1117.578] (-1116.491) -- 0:01:01
47000 -- (-1117.576) [-1116.708] (-1116.199) (-1128.040) * [-1117.876] (-1123.018) (-1117.304) (-1116.489) -- 0:01:00
47500 -- (-1118.999) (-1119.836) [-1116.333] (-1124.295) * (-1117.015) (-1133.025) [-1115.723] (-1115.215) -- 0:01:00
48000 -- (-1118.180) (-1116.411) (-1116.471) [-1141.831] * (-1121.390) (-1125.941) (-1117.155) [-1115.769] -- 0:00:59
48500 -- (-1123.013) (-1119.552) [-1115.404] (-1122.420) * [-1117.137] (-1132.222) (-1118.392) (-1115.647) -- 0:00:58
49000 -- (-1117.142) (-1118.292) (-1116.506) [-1123.851] * (-1116.306) [-1123.937] (-1119.397) (-1115.777) -- 0:00:58
49500 -- [-1116.788] (-1119.191) (-1117.431) (-1132.920) * (-1116.575) (-1122.251) (-1120.817) [-1118.593] -- 0:00:57
50000 -- (-1115.650) (-1117.755) (-1120.179) [-1121.691] * [-1116.512] (-1126.587) (-1122.825) (-1119.825) -- 0:00:57
Average standard deviation of split frequencies: 0.034115
50500 -- (-1118.248) (-1118.338) (-1118.229) [-1120.652] * (-1117.048) [-1130.026] (-1116.877) (-1117.951) -- 0:00:56
51000 -- [-1117.270] (-1117.678) (-1116.958) (-1126.900) * (-1116.938) [-1127.331] (-1115.855) (-1120.474) -- 0:00:55
51500 -- (-1115.410) (-1117.657) (-1115.795) [-1123.003] * (-1116.358) (-1128.939) [-1115.678] (-1123.286) -- 0:00:55
52000 -- (-1115.489) (-1116.429) (-1115.809) [-1125.844] * [-1116.927] (-1125.287) (-1115.462) (-1120.159) -- 0:00:54
52500 -- (-1116.390) (-1117.863) [-1115.333] (-1127.887) * (-1117.255) [-1128.280] (-1115.464) (-1118.726) -- 0:00:54
53000 -- (-1117.266) (-1118.343) [-1116.153] (-1122.157) * (-1117.224) (-1122.694) (-1120.129) [-1117.309] -- 0:00:53
53500 -- (-1123.063) (-1119.554) [-1120.152] (-1133.035) * (-1120.327) [-1122.176] (-1116.849) (-1121.151) -- 0:00:53
54000 -- [-1116.939] (-1117.495) (-1121.409) (-1127.251) * (-1118.040) (-1129.054) (-1116.767) [-1120.905] -- 0:00:52
54500 -- (-1117.702) (-1117.236) [-1117.813] (-1123.147) * (-1116.600) [-1129.800] (-1118.383) (-1117.150) -- 0:00:52
55000 -- [-1117.219] (-1117.508) (-1117.582) (-1125.600) * (-1121.174) (-1125.200) [-1115.353] (-1115.950) -- 0:01:08
Average standard deviation of split frequencies: 0.038128
55500 -- (-1118.034) (-1119.848) [-1116.172] (-1135.070) * (-1118.967) (-1131.316) [-1117.292] (-1118.585) -- 0:01:08
56000 -- (-1118.260) (-1119.226) [-1115.738] (-1130.953) * [-1118.632] (-1127.826) (-1121.697) (-1118.140) -- 0:01:07
56500 -- (-1115.466) [-1121.361] (-1117.357) (-1134.350) * [-1117.774] (-1129.804) (-1119.162) (-1116.425) -- 0:01:06
57000 -- (-1118.733) (-1119.663) (-1118.421) [-1121.868] * (-1117.594) (-1123.441) (-1124.012) [-1117.465] -- 0:01:06
57500 -- (-1121.215) [-1117.733] (-1119.372) (-1124.065) * [-1117.595] (-1123.061) (-1119.898) (-1119.215) -- 0:01:05
58000 -- [-1119.076] (-1119.354) (-1122.627) (-1130.983) * (-1116.990) [-1125.965] (-1119.644) (-1116.844) -- 0:01:04
58500 -- (-1117.675) [-1117.110] (-1120.440) (-1140.017) * (-1117.629) (-1123.477) [-1121.354] (-1119.469) -- 0:01:04
59000 -- (-1116.529) (-1115.867) (-1116.882) [-1137.033] * (-1117.076) (-1127.163) [-1117.793] (-1118.407) -- 0:01:03
59500 -- (-1128.853) (-1115.983) (-1117.273) [-1121.886] * [-1116.505] (-1129.874) (-1117.555) (-1116.647) -- 0:01:03
60000 -- (-1119.450) (-1118.542) (-1115.433) [-1126.191] * (-1117.333) [-1130.957] (-1117.653) (-1116.621) -- 0:01:02
Average standard deviation of split frequencies: 0.033240
60500 -- (-1116.962) (-1116.449) [-1116.047] (-1149.301) * [-1118.230] (-1130.901) (-1118.953) (-1117.152) -- 0:01:02
61000 -- [-1122.347] (-1115.995) (-1118.555) (-1121.626) * (-1116.467) [-1123.999] (-1119.729) (-1118.260) -- 0:01:01
61500 -- [-1116.117] (-1116.110) (-1116.161) (-1118.967) * (-1116.222) (-1128.760) (-1118.755) [-1120.540] -- 0:01:01
62000 -- (-1117.430) [-1114.996] (-1115.064) (-1115.370) * [-1116.872] (-1135.188) (-1117.386) (-1121.965) -- 0:01:00
62500 -- (-1115.194) [-1115.314] (-1117.574) (-1115.463) * [-1119.370] (-1126.195) (-1120.585) (-1117.201) -- 0:01:00
63000 -- (-1115.502) (-1115.332) [-1116.780] (-1115.965) * (-1119.094) (-1146.155) [-1118.756] (-1122.561) -- 0:00:59
63500 -- [-1115.758] (-1116.150) (-1116.787) (-1119.421) * (-1119.074) [-1122.897] (-1116.954) (-1121.655) -- 0:00:58
64000 -- [-1119.079] (-1116.955) (-1115.971) (-1119.654) * [-1118.760] (-1131.526) (-1117.819) (-1117.958) -- 0:00:58
64500 -- (-1116.452) (-1120.319) [-1118.521] (-1117.726) * (-1119.996) (-1121.151) (-1118.249) [-1118.986] -- 0:00:58
65000 -- (-1116.586) (-1117.238) (-1117.038) [-1116.870] * (-1119.237) (-1119.910) (-1116.723) [-1115.686] -- 0:00:57
Average standard deviation of split frequencies: 0.025713
65500 -- (-1121.015) (-1116.359) (-1116.416) [-1116.329] * (-1117.832) (-1116.788) (-1117.001) [-1117.164] -- 0:00:57
66000 -- (-1116.276) (-1116.125) [-1116.727] (-1115.878) * (-1117.390) [-1116.706] (-1116.657) (-1118.823) -- 0:00:56
66500 -- (-1117.263) (-1117.030) (-1117.489) [-1116.335] * (-1115.796) (-1115.470) (-1117.407) [-1116.076] -- 0:00:56
67000 -- [-1116.407] (-1116.879) (-1116.025) (-1118.839) * (-1117.627) [-1117.239] (-1117.743) (-1117.480) -- 0:00:55
67500 -- (-1115.513) [-1116.236] (-1116.978) (-1118.540) * [-1121.236] (-1117.282) (-1115.598) (-1118.678) -- 0:00:55
68000 -- [-1116.997] (-1117.659) (-1116.811) (-1120.790) * (-1125.346) [-1115.970] (-1117.551) (-1118.759) -- 0:00:54
68500 -- [-1117.555] (-1118.371) (-1117.182) (-1117.574) * (-1119.828) (-1116.582) [-1119.160] (-1118.513) -- 0:00:54
69000 -- (-1117.072) (-1118.892) [-1119.864] (-1119.333) * [-1118.593] (-1116.574) (-1121.593) (-1119.358) -- 0:00:53
69500 -- (-1120.820) (-1117.489) (-1119.006) [-1119.139] * (-1117.370) [-1116.598] (-1115.285) (-1116.421) -- 0:00:53
70000 -- [-1117.918] (-1115.789) (-1122.130) (-1118.195) * (-1117.158) (-1115.793) (-1117.372) [-1116.635] -- 0:00:53
Average standard deviation of split frequencies: 0.026016
70500 -- (-1118.616) (-1117.350) (-1115.382) [-1115.684] * (-1117.049) (-1115.284) (-1116.029) [-1116.121] -- 0:00:52
71000 -- [-1118.098] (-1121.764) (-1118.060) (-1116.975) * [-1116.545] (-1115.445) (-1117.623) (-1115.162) -- 0:01:05
71500 -- (-1119.614) (-1116.991) [-1116.058] (-1115.792) * (-1115.332) (-1116.696) (-1115.676) [-1118.440] -- 0:01:04
72000 -- (-1117.996) (-1117.495) (-1115.527) [-1115.288] * [-1117.109] (-1116.591) (-1116.523) (-1116.758) -- 0:01:04
72500 -- (-1117.939) [-1116.587] (-1119.252) (-1115.298) * (-1117.831) [-1117.132] (-1116.685) (-1115.331) -- 0:01:03
73000 -- (-1118.294) (-1118.041) (-1123.002) [-1116.498] * (-1118.465) [-1115.850] (-1117.815) (-1115.636) -- 0:01:03
73500 -- (-1116.126) (-1118.768) (-1119.922) [-1117.825] * (-1117.276) (-1116.147) (-1119.115) [-1115.977] -- 0:01:03
74000 -- [-1122.320] (-1116.234) (-1123.561) (-1118.134) * (-1117.724) [-1119.127] (-1119.416) (-1117.078) -- 0:01:02
74500 -- (-1115.525) (-1117.070) (-1119.128) [-1116.996] * (-1117.184) [-1118.995] (-1117.532) (-1118.068) -- 0:01:02
75000 -- (-1117.293) (-1120.371) (-1117.229) [-1119.386] * (-1117.972) [-1117.398] (-1117.564) (-1116.814) -- 0:01:01
Average standard deviation of split frequencies: 0.027292
75500 -- (-1117.401) (-1117.276) [-1118.299] (-1117.431) * (-1118.391) [-1117.828] (-1117.326) (-1116.264) -- 0:01:01
76000 -- (-1117.591) [-1117.200] (-1116.123) (-1116.412) * [-1114.962] (-1118.360) (-1115.755) (-1117.034) -- 0:01:00
76500 -- (-1118.605) [-1115.589] (-1115.873) (-1116.036) * [-1116.711] (-1116.133) (-1116.952) (-1117.541) -- 0:01:00
77000 -- [-1117.572] (-1115.619) (-1117.840) (-1118.986) * (-1114.821) (-1117.451) [-1116.350] (-1117.930) -- 0:00:59
77500 -- (-1117.053) (-1115.676) (-1117.768) [-1115.498] * (-1114.819) [-1115.865] (-1117.210) (-1117.710) -- 0:00:59
78000 -- (-1117.739) (-1116.622) (-1116.014) [-1118.438] * (-1117.695) (-1115.048) [-1115.484] (-1119.542) -- 0:00:59
78500 -- (-1117.500) [-1116.651] (-1116.020) (-1116.462) * [-1117.872] (-1115.687) (-1115.484) (-1121.331) -- 0:00:58
79000 -- (-1119.523) (-1116.122) (-1121.230) [-1116.486] * (-1118.566) (-1117.239) (-1118.282) [-1116.781] -- 0:00:58
79500 -- (-1118.138) (-1119.251) [-1115.464] (-1118.745) * (-1117.577) (-1118.244) [-1116.755] (-1115.666) -- 0:00:57
80000 -- (-1117.220) (-1117.868) [-1120.690] (-1115.387) * (-1119.400) (-1117.193) (-1116.584) [-1117.538] -- 0:00:57
Average standard deviation of split frequencies: 0.026451
80500 -- [-1117.307] (-1115.263) (-1119.912) (-1124.032) * [-1116.593] (-1115.750) (-1117.621) (-1116.564) -- 0:00:57
81000 -- (-1117.125) [-1119.481] (-1118.465) (-1121.217) * (-1117.538) (-1115.398) [-1117.622] (-1115.624) -- 0:00:56
81500 -- (-1117.177) (-1116.449) [-1119.254] (-1118.062) * (-1118.073) [-1115.663] (-1119.370) (-1116.773) -- 0:00:56
82000 -- (-1117.180) (-1115.414) [-1115.640] (-1120.612) * [-1116.386] (-1115.581) (-1118.406) (-1122.092) -- 0:00:55
82500 -- (-1118.057) [-1116.498] (-1115.922) (-1117.144) * (-1116.281) [-1118.848] (-1117.603) (-1119.116) -- 0:00:55
83000 -- (-1119.637) (-1116.990) (-1117.463) [-1118.010] * [-1116.641] (-1131.825) (-1115.215) (-1118.278) -- 0:00:55
83500 -- (-1118.149) [-1116.592] (-1118.912) (-1118.459) * (-1117.690) (-1118.882) [-1115.482] (-1121.264) -- 0:00:54
84000 -- (-1115.967) (-1115.967) (-1117.025) [-1128.086] * (-1117.942) (-1116.873) (-1116.453) [-1120.691] -- 0:00:54
84500 -- [-1117.250] (-1117.671) (-1120.377) (-1125.493) * (-1115.680) [-1117.656] (-1117.858) (-1115.538) -- 0:00:54
85000 -- (-1118.453) (-1117.029) (-1115.806) [-1117.953] * (-1118.200) (-1116.723) [-1116.914] (-1115.651) -- 0:00:53
Average standard deviation of split frequencies: 0.024522
85500 -- [-1119.400] (-1115.602) (-1120.556) (-1115.366) * [-1115.378] (-1120.099) (-1119.958) (-1118.112) -- 0:00:53
86000 -- [-1116.261] (-1118.719) (-1118.659) (-1116.427) * (-1116.210) (-1116.585) [-1116.353] (-1118.171) -- 0:00:53
86500 -- (-1116.020) (-1116.517) [-1115.651] (-1115.756) * (-1115.357) [-1116.720] (-1116.166) (-1119.049) -- 0:00:52
87000 -- (-1118.505) (-1117.726) [-1115.083] (-1118.484) * [-1117.302] (-1116.644) (-1116.763) (-1116.105) -- 0:00:52
87500 -- (-1116.624) (-1117.005) [-1115.527] (-1116.106) * (-1119.228) [-1116.367] (-1116.005) (-1117.217) -- 0:01:02
88000 -- (-1117.033) [-1116.053] (-1115.740) (-1117.350) * (-1116.339) (-1116.361) (-1117.016) [-1115.639] -- 0:01:02
88500 -- [-1115.451] (-1118.604) (-1119.725) (-1119.003) * [-1117.603] (-1116.747) (-1117.402) (-1115.036) -- 0:01:01
89000 -- [-1120.903] (-1116.675) (-1117.890) (-1118.795) * (-1117.340) [-1115.307] (-1116.191) (-1116.774) -- 0:01:01
89500 -- (-1121.452) [-1120.336] (-1116.323) (-1116.537) * (-1116.824) (-1116.212) (-1116.083) [-1116.288] -- 0:01:01
90000 -- (-1119.868) (-1122.721) [-1117.947] (-1118.177) * (-1120.105) (-1118.203) (-1121.159) [-1119.837] -- 0:01:00
Average standard deviation of split frequencies: 0.025723
90500 -- (-1115.893) [-1123.506] (-1116.984) (-1115.927) * (-1120.016) [-1116.368] (-1117.828) (-1116.409) -- 0:01:00
91000 -- [-1116.708] (-1119.829) (-1117.581) (-1115.368) * (-1121.662) (-1116.774) [-1118.220] (-1119.520) -- 0:00:59
91500 -- [-1116.867] (-1118.957) (-1119.654) (-1115.606) * (-1116.106) (-1116.229) (-1116.444) [-1119.001] -- 0:00:59
92000 -- [-1118.521] (-1116.866) (-1115.831) (-1115.904) * (-1116.892) [-1117.397] (-1117.035) (-1118.835) -- 0:00:59
92500 -- (-1118.338) (-1117.239) (-1115.831) [-1116.346] * (-1115.589) (-1118.923) [-1115.984] (-1117.883) -- 0:00:58
93000 -- (-1119.482) (-1115.725) (-1117.530) [-1115.871] * (-1116.253) (-1116.346) [-1116.264] (-1116.695) -- 0:00:58
93500 -- (-1120.022) [-1118.672] (-1118.795) (-1116.988) * (-1116.733) (-1115.248) [-1116.192] (-1118.481) -- 0:00:58
94000 -- [-1117.223] (-1118.555) (-1120.083) (-1115.238) * [-1115.476] (-1116.164) (-1118.014) (-1117.505) -- 0:00:57
94500 -- (-1116.644) (-1116.303) [-1117.067] (-1120.711) * (-1115.053) (-1115.356) [-1115.628] (-1119.607) -- 0:00:57
95000 -- (-1116.329) (-1115.969) [-1117.430] (-1118.375) * [-1116.320] (-1115.866) (-1118.622) (-1116.376) -- 0:00:57
Average standard deviation of split frequencies: 0.024061
95500 -- (-1117.793) (-1116.793) [-1117.474] (-1118.378) * [-1116.287] (-1115.347) (-1115.864) (-1118.508) -- 0:00:56
96000 -- (-1115.975) (-1116.079) [-1119.206] (-1117.052) * (-1120.739) (-1115.384) [-1116.146] (-1116.521) -- 0:00:56
96500 -- [-1115.225] (-1116.765) (-1116.304) (-1118.615) * (-1117.573) (-1115.776) (-1118.035) [-1115.634] -- 0:00:56
97000 -- [-1115.426] (-1117.275) (-1116.363) (-1118.618) * (-1117.339) (-1116.494) (-1123.454) [-1116.260] -- 0:00:55
97500 -- (-1115.320) (-1117.645) (-1118.718) [-1119.183] * [-1118.493] (-1119.081) (-1119.613) (-1124.871) -- 0:00:55
98000 -- [-1116.124] (-1115.292) (-1120.024) (-1127.291) * (-1117.811) (-1117.794) [-1116.941] (-1120.310) -- 0:00:55
98500 -- (-1118.190) [-1115.233] (-1118.983) (-1120.112) * (-1119.662) [-1117.687] (-1118.176) (-1117.707) -- 0:00:54
99000 -- (-1117.057) (-1116.200) (-1116.328) [-1117.554] * (-1117.683) (-1116.929) (-1119.812) [-1117.089] -- 0:00:54
99500 -- (-1117.253) (-1116.963) [-1115.050] (-1116.149) * (-1117.675) (-1119.583) [-1119.646] (-1120.435) -- 0:00:54
100000 -- [-1115.198] (-1117.769) (-1120.738) (-1115.896) * (-1118.313) [-1117.543] (-1118.584) (-1117.800) -- 0:00:54
Average standard deviation of split frequencies: 0.021196
100500 -- (-1117.843) (-1116.848) [-1118.502] (-1115.719) * (-1119.860) [-1115.312] (-1116.228) (-1118.846) -- 0:00:53
101000 -- (-1116.591) (-1116.601) [-1117.252] (-1115.884) * [-1120.038] (-1115.318) (-1116.336) (-1118.112) -- 0:00:53
101500 -- (-1117.176) (-1115.177) (-1119.063) [-1118.579] * (-1122.618) (-1116.164) (-1117.172) [-1117.035] -- 0:00:53
102000 -- (-1116.861) (-1115.329) [-1121.203] (-1115.229) * (-1120.058) (-1118.109) (-1118.762) [-1116.946] -- 0:00:52
102500 -- (-1115.855) (-1115.328) [-1117.943] (-1117.062) * (-1122.431) [-1118.492] (-1116.175) (-1118.247) -- 0:00:52
103000 -- (-1117.346) (-1115.866) (-1119.130) [-1116.419] * (-1124.001) [-1117.955] (-1117.549) (-1121.338) -- 0:01:00
103500 -- [-1118.375] (-1116.227) (-1119.856) (-1117.021) * (-1118.445) (-1116.750) (-1115.299) [-1117.720] -- 0:01:00
104000 -- (-1117.043) (-1118.432) [-1115.177] (-1117.436) * (-1118.478) (-1122.396) [-1115.580] (-1117.762) -- 0:01:00
104500 -- (-1119.054) (-1122.282) [-1115.182] (-1118.114) * (-1118.287) (-1121.728) [-1116.114] (-1117.334) -- 0:00:59
105000 -- [-1117.460] (-1118.200) (-1116.131) (-1124.065) * (-1118.744) (-1121.279) [-1116.065] (-1120.732) -- 0:00:59
Average standard deviation of split frequencies: 0.017587
105500 -- (-1116.262) [-1117.458] (-1122.237) (-1119.980) * (-1117.811) (-1117.613) (-1116.606) [-1119.618] -- 0:00:59
106000 -- [-1115.524] (-1119.042) (-1121.517) (-1116.458) * (-1117.464) (-1117.056) (-1117.017) [-1121.118] -- 0:00:59
106500 -- (-1117.147) [-1116.336] (-1118.839) (-1116.053) * (-1117.543) (-1116.557) [-1116.815] (-1117.178) -- 0:00:58
107000 -- [-1117.604] (-1119.642) (-1118.406) (-1116.276) * (-1117.511) (-1116.274) [-1115.531] (-1121.100) -- 0:00:58
107500 -- [-1115.518] (-1116.470) (-1117.859) (-1116.954) * (-1119.560) [-1115.289] (-1116.296) (-1121.942) -- 0:00:58
108000 -- (-1116.409) (-1115.715) [-1116.960] (-1118.879) * (-1118.722) [-1116.279] (-1115.377) (-1116.330) -- 0:00:57
108500 -- (-1116.699) (-1116.395) [-1116.725] (-1118.048) * (-1116.802) (-1116.332) (-1117.971) [-1116.342] -- 0:00:57
109000 -- (-1121.054) [-1116.975] (-1122.345) (-1116.819) * (-1118.204) (-1117.297) [-1116.661] (-1115.525) -- 0:00:57
109500 -- (-1121.316) (-1116.629) [-1119.644] (-1117.183) * (-1117.190) [-1118.732] (-1118.833) (-1119.229) -- 0:00:56
110000 -- [-1116.268] (-1117.627) (-1117.840) (-1117.425) * (-1118.658) [-1117.917] (-1119.776) (-1116.077) -- 0:00:56
Average standard deviation of split frequencies: 0.019067
110500 -- (-1116.487) [-1116.346] (-1116.174) (-1120.869) * (-1115.242) [-1117.716] (-1118.365) (-1117.207) -- 0:00:56
111000 -- (-1119.494) (-1115.949) [-1121.206] (-1116.414) * (-1118.853) (-1117.203) (-1115.513) [-1115.843] -- 0:00:56
111500 -- (-1120.421) (-1116.997) (-1115.842) [-1115.954] * [-1117.272] (-1116.916) (-1116.039) (-1120.941) -- 0:00:55
112000 -- (-1117.678) (-1115.362) (-1116.771) [-1116.081] * (-1115.307) (-1117.452) [-1120.328] (-1115.804) -- 0:00:55
112500 -- (-1116.487) (-1117.657) [-1116.907] (-1117.276) * (-1117.166) (-1118.564) (-1119.014) [-1119.888] -- 0:00:55
113000 -- (-1116.510) (-1115.665) [-1116.720] (-1118.419) * [-1118.874] (-1118.515) (-1118.050) (-1121.985) -- 0:00:54
113500 -- [-1116.166] (-1115.446) (-1116.982) (-1117.739) * (-1121.703) [-1117.278] (-1118.617) (-1127.272) -- 0:00:54
114000 -- (-1116.746) (-1115.370) [-1117.844] (-1118.285) * (-1121.703) (-1116.564) [-1118.034] (-1121.707) -- 0:00:54
114500 -- (-1116.038) (-1115.189) (-1117.337) [-1117.150] * (-1120.666) (-1118.287) (-1117.688) [-1121.403] -- 0:00:54
115000 -- (-1115.741) (-1117.304) (-1117.559) [-1116.757] * (-1117.979) (-1118.195) [-1118.235] (-1119.883) -- 0:00:53
Average standard deviation of split frequencies: 0.016836
115500 -- [-1117.533] (-1120.325) (-1117.297) (-1116.559) * (-1119.274) (-1118.571) (-1119.958) [-1116.084] -- 0:00:53
116000 -- (-1118.797) (-1120.964) [-1117.055] (-1115.854) * (-1115.700) (-1118.865) (-1116.870) [-1116.122] -- 0:00:53
116500 -- (-1115.645) (-1125.156) [-1117.638] (-1119.989) * [-1118.554] (-1117.299) (-1115.911) (-1115.835) -- 0:00:53
117000 -- [-1116.015] (-1116.853) (-1118.437) (-1122.276) * (-1117.579) (-1119.477) [-1117.724] (-1116.025) -- 0:00:52
117500 -- (-1116.671) (-1115.321) [-1117.249] (-1119.867) * [-1120.751] (-1116.920) (-1121.648) (-1117.921) -- 0:00:52
118000 -- (-1116.357) (-1120.847) [-1117.699] (-1116.235) * [-1116.578] (-1122.188) (-1116.685) (-1118.081) -- 0:00:52
118500 -- (-1116.127) (-1122.460) [-1118.147] (-1115.285) * (-1118.753) (-1118.528) [-1115.665] (-1115.704) -- 0:00:52
119000 -- (-1117.237) [-1121.068] (-1119.097) (-1117.346) * (-1117.835) [-1116.961] (-1115.512) (-1115.739) -- 0:00:51
119500 -- (-1117.805) (-1121.956) [-1117.428] (-1120.119) * [-1116.312] (-1116.584) (-1117.482) (-1115.803) -- 0:00:58
120000 -- (-1118.273) [-1116.956] (-1116.977) (-1115.529) * (-1118.543) (-1116.306) (-1120.734) [-1115.710] -- 0:00:58
Average standard deviation of split frequencies: 0.016017
120500 -- (-1117.800) [-1121.412] (-1115.846) (-1115.514) * (-1118.526) (-1120.240) (-1116.696) [-1114.965] -- 0:00:58
121000 -- [-1118.005] (-1119.065) (-1115.819) (-1115.617) * [-1116.409] (-1118.767) (-1115.479) (-1115.389) -- 0:00:58
121500 -- (-1119.480) [-1120.041] (-1119.635) (-1123.012) * (-1116.863) (-1117.952) [-1120.107] (-1116.911) -- 0:00:57
122000 -- (-1117.163) (-1119.721) [-1117.671] (-1116.210) * (-1117.709) (-1116.929) (-1117.184) [-1116.977] -- 0:00:57
122500 -- (-1115.909) (-1122.014) [-1124.021] (-1116.207) * (-1116.194) (-1117.304) (-1116.252) [-1115.680] -- 0:00:57
123000 -- (-1119.626) (-1119.203) [-1119.649] (-1116.279) * (-1117.078) (-1116.028) [-1118.107] (-1116.438) -- 0:00:57
123500 -- (-1120.488) (-1118.207) [-1117.190] (-1116.177) * (-1121.380) (-1118.625) [-1117.651] (-1116.125) -- 0:00:56
124000 -- (-1121.203) (-1115.825) (-1117.181) [-1117.265] * (-1117.204) [-1119.428] (-1116.116) (-1116.941) -- 0:00:56
124500 -- (-1118.468) [-1115.315] (-1116.994) (-1116.955) * (-1119.268) (-1119.264) (-1116.346) [-1118.227] -- 0:00:56
125000 -- (-1122.741) (-1116.309) [-1116.229] (-1116.531) * (-1116.570) (-1119.905) [-1116.263] (-1117.079) -- 0:00:56
Average standard deviation of split frequencies: 0.018172
125500 -- (-1117.537) [-1115.739] (-1115.187) (-1116.982) * (-1117.956) (-1118.229) [-1116.300] (-1117.078) -- 0:00:55
126000 -- (-1116.763) (-1116.219) (-1116.347) [-1118.273] * [-1117.347] (-1116.517) (-1116.833) (-1116.209) -- 0:00:55
126500 -- (-1116.194) [-1116.557] (-1118.108) (-1116.843) * (-1118.786) (-1115.791) (-1117.546) [-1120.901] -- 0:00:55
127000 -- (-1119.524) [-1116.681] (-1118.758) (-1116.522) * (-1115.241) [-1116.063] (-1118.182) (-1118.714) -- 0:00:54
127500 -- (-1116.380) [-1118.243] (-1118.299) (-1117.842) * (-1115.212) (-1115.639) [-1119.077] (-1118.631) -- 0:00:54
128000 -- (-1119.928) (-1117.563) [-1116.066] (-1116.181) * [-1117.689] (-1117.177) (-1120.770) (-1119.337) -- 0:00:54
128500 -- [-1114.842] (-1116.947) (-1115.030) (-1117.121) * [-1117.009] (-1116.246) (-1121.852) (-1120.102) -- 0:00:54
129000 -- (-1120.255) [-1116.522] (-1116.237) (-1121.900) * (-1117.233) (-1117.234) [-1119.880] (-1118.415) -- 0:00:54
129500 -- (-1120.486) (-1118.316) [-1115.996] (-1117.379) * (-1122.379) [-1115.818] (-1118.692) (-1117.019) -- 0:00:53
130000 -- (-1118.498) [-1117.444] (-1119.550) (-1118.054) * (-1123.074) (-1116.066) (-1118.756) [-1117.959] -- 0:00:53
Average standard deviation of split frequencies: 0.017497
130500 -- (-1115.803) [-1117.606] (-1121.438) (-1116.497) * (-1116.083) (-1116.778) (-1116.660) [-1117.720] -- 0:00:53
131000 -- (-1116.595) (-1117.580) (-1116.942) [-1115.508] * (-1120.729) (-1117.082) [-1118.550] (-1118.173) -- 0:00:53
131500 -- [-1115.516] (-1120.931) (-1120.084) (-1115.585) * (-1119.682) [-1119.261] (-1117.613) (-1120.034) -- 0:00:52
132000 -- (-1115.452) [-1116.958] (-1116.366) (-1116.012) * (-1116.917) [-1115.376] (-1115.500) (-1117.201) -- 0:00:52
132500 -- (-1119.015) (-1117.987) [-1118.491] (-1115.522) * [-1119.589] (-1116.076) (-1117.184) (-1116.516) -- 0:00:52
133000 -- (-1119.615) (-1118.163) [-1118.872] (-1116.934) * (-1118.929) (-1116.407) [-1117.996] (-1117.161) -- 0:00:52
133500 -- (-1116.158) (-1117.324) (-1118.061) [-1116.924] * (-1118.644) [-1117.100] (-1120.091) (-1118.645) -- 0:00:51
134000 -- (-1117.014) [-1117.700] (-1116.106) (-1116.239) * [-1115.611] (-1117.348) (-1116.207) (-1119.051) -- 0:00:51
134500 -- [-1117.388] (-1117.098) (-1116.078) (-1115.431) * (-1115.080) (-1118.768) (-1115.769) [-1116.349] -- 0:00:51
135000 -- (-1119.829) (-1116.472) [-1115.916] (-1115.436) * (-1115.473) (-1120.952) (-1116.517) [-1115.560] -- 0:00:51
Average standard deviation of split frequencies: 0.016464
135500 -- (-1117.552) (-1115.661) (-1116.493) [-1117.636] * [-1116.146] (-1118.327) (-1117.243) (-1118.530) -- 0:00:57
136000 -- (-1118.735) (-1119.827) [-1116.887] (-1115.851) * (-1117.103) [-1119.195] (-1115.848) (-1118.228) -- 0:00:57
136500 -- [-1118.051] (-1117.809) (-1115.818) (-1118.905) * (-1115.478) (-1116.993) [-1115.754] (-1118.206) -- 0:00:56
137000 -- [-1117.971] (-1117.376) (-1116.962) (-1116.283) * (-1115.177) [-1118.940] (-1115.413) (-1115.685) -- 0:00:56
137500 -- [-1115.901] (-1116.196) (-1115.487) (-1117.577) * (-1116.657) [-1118.369] (-1115.393) (-1117.045) -- 0:00:56
138000 -- [-1120.113] (-1117.300) (-1115.651) (-1116.758) * [-1116.732] (-1119.721) (-1116.154) (-1119.175) -- 0:00:56
138500 -- (-1116.861) (-1119.193) [-1115.675] (-1118.014) * [-1115.664] (-1115.310) (-1116.619) (-1119.642) -- 0:00:55
139000 -- (-1124.855) (-1117.645) [-1117.197] (-1116.411) * (-1116.580) (-1120.604) (-1116.158) [-1115.913] -- 0:00:55
139500 -- (-1119.679) (-1115.739) (-1117.120) [-1116.743] * (-1114.921) (-1118.777) [-1116.363] (-1115.720) -- 0:00:55
140000 -- [-1116.578] (-1116.910) (-1115.488) (-1116.025) * (-1117.078) (-1116.743) [-1116.668] (-1117.572) -- 0:00:55
Average standard deviation of split frequencies: 0.018767
140500 -- [-1116.185] (-1117.445) (-1116.491) (-1118.101) * (-1118.188) (-1121.052) [-1118.100] (-1116.380) -- 0:00:55
141000 -- [-1116.668] (-1116.821) (-1119.094) (-1115.131) * (-1116.115) (-1118.539) [-1117.800] (-1117.878) -- 0:00:54
141500 -- [-1117.324] (-1119.539) (-1117.593) (-1118.850) * (-1118.040) (-1119.140) [-1116.777] (-1117.169) -- 0:00:54
142000 -- (-1116.707) [-1117.382] (-1117.940) (-1120.194) * [-1115.741] (-1118.731) (-1118.893) (-1118.411) -- 0:00:54
142500 -- (-1117.242) (-1115.970) (-1116.365) [-1121.001] * (-1117.851) [-1117.104] (-1119.510) (-1118.212) -- 0:00:54
143000 -- (-1118.382) (-1117.144) [-1116.840] (-1118.291) * (-1120.269) (-1117.436) (-1117.517) [-1117.395] -- 0:00:53
143500 -- (-1118.530) (-1117.872) [-1117.176] (-1120.043) * (-1116.721) [-1117.092] (-1118.852) (-1115.991) -- 0:00:53
144000 -- (-1117.455) [-1118.127] (-1121.008) (-1122.221) * (-1119.168) (-1118.085) [-1117.611] (-1117.450) -- 0:00:53
144500 -- (-1118.505) (-1118.830) [-1121.755] (-1123.535) * (-1115.741) (-1117.595) (-1118.192) [-1115.743] -- 0:00:53
145000 -- [-1116.656] (-1115.235) (-1119.609) (-1120.142) * (-1116.018) (-1115.602) (-1119.472) [-1115.533] -- 0:00:53
Average standard deviation of split frequencies: 0.018604
145500 -- [-1116.663] (-1117.668) (-1117.640) (-1118.557) * (-1118.548) (-1115.915) (-1115.907) [-1115.506] -- 0:00:52
146000 -- [-1119.901] (-1117.358) (-1122.884) (-1116.614) * (-1117.694) (-1116.007) [-1117.669] (-1116.809) -- 0:00:52
146500 -- [-1117.019] (-1117.109) (-1120.018) (-1121.844) * (-1117.259) (-1118.699) (-1117.202) [-1120.828] -- 0:00:52
147000 -- (-1115.362) (-1115.388) (-1118.721) [-1121.578] * (-1116.188) [-1119.582] (-1120.007) (-1117.812) -- 0:00:52
147500 -- (-1115.633) (-1115.777) [-1116.657] (-1120.457) * (-1115.745) (-1117.309) [-1115.532] (-1117.855) -- 0:00:52
148000 -- (-1118.507) (-1115.840) [-1118.311] (-1118.542) * [-1118.083] (-1118.955) (-1116.774) (-1118.596) -- 0:00:51
148500 -- (-1118.971) [-1115.375] (-1115.469) (-1117.169) * [-1117.164] (-1119.953) (-1115.699) (-1119.272) -- 0:00:51
149000 -- (-1117.554) [-1116.647] (-1115.295) (-1116.777) * (-1116.590) [-1119.653] (-1116.974) (-1123.641) -- 0:00:51
149500 -- (-1115.875) (-1119.441) [-1116.491] (-1117.843) * (-1117.433) (-1117.459) (-1117.289) [-1124.173] -- 0:00:51
150000 -- [-1115.988] (-1119.027) (-1117.327) (-1121.214) * (-1118.729) (-1117.438) (-1116.676) [-1116.993] -- 0:00:51
Average standard deviation of split frequencies: 0.019399
150500 -- [-1115.312] (-1117.514) (-1118.316) (-1118.379) * (-1118.156) (-1117.707) (-1118.753) [-1118.201] -- 0:00:50
151000 -- (-1115.438) (-1114.913) (-1119.856) [-1116.657] * [-1120.129] (-1119.567) (-1117.462) (-1117.017) -- 0:00:50
151500 -- [-1117.267] (-1121.159) (-1125.421) (-1117.053) * (-1120.331) (-1119.400) (-1118.142) [-1117.016] -- 0:00:56
152000 -- (-1116.135) (-1116.100) (-1116.789) [-1116.019] * (-1122.305) [-1115.834] (-1117.351) (-1117.501) -- 0:00:55
152500 -- (-1115.931) [-1115.661] (-1117.221) (-1118.776) * [-1117.822] (-1116.513) (-1115.393) (-1119.372) -- 0:00:55
153000 -- (-1119.418) [-1115.147] (-1117.446) (-1118.082) * [-1118.321] (-1117.076) (-1116.227) (-1118.040) -- 0:00:55
153500 -- (-1124.466) (-1117.842) [-1118.178] (-1116.333) * (-1120.070) (-1115.642) [-1118.822] (-1118.554) -- 0:00:55
154000 -- (-1117.171) (-1116.688) [-1117.089] (-1118.497) * (-1117.899) [-1115.556] (-1116.835) (-1115.938) -- 0:00:54
154500 -- (-1120.719) (-1116.372) (-1118.822) [-1120.146] * (-1119.133) [-1116.070] (-1116.400) (-1118.544) -- 0:00:54
155000 -- (-1119.708) [-1116.862] (-1120.046) (-1117.701) * [-1117.623] (-1117.996) (-1117.246) (-1119.527) -- 0:00:54
Average standard deviation of split frequencies: 0.017980
155500 -- (-1116.298) (-1116.996) (-1117.184) [-1118.345] * [-1115.790] (-1115.173) (-1116.871) (-1119.805) -- 0:00:54
156000 -- (-1119.391) [-1115.132] (-1116.414) (-1122.551) * (-1115.571) (-1115.394) (-1115.664) [-1119.536] -- 0:00:54
156500 -- (-1116.548) [-1117.158] (-1115.877) (-1121.673) * (-1116.403) [-1117.022] (-1117.090) (-1116.405) -- 0:00:53
157000 -- (-1119.712) (-1117.688) (-1116.221) [-1120.429] * (-1116.844) (-1116.176) (-1120.135) [-1115.340] -- 0:00:53
157500 -- (-1116.678) [-1117.294] (-1118.074) (-1117.709) * (-1116.658) (-1115.960) (-1118.987) [-1115.956] -- 0:00:53
158000 -- [-1115.293] (-1118.940) (-1117.550) (-1118.506) * (-1118.731) (-1118.183) (-1118.490) [-1116.646] -- 0:00:53
158500 -- (-1115.511) (-1121.355) (-1119.019) [-1116.065] * (-1116.445) (-1116.023) (-1116.804) [-1115.554] -- 0:00:53
159000 -- (-1116.683) [-1117.667] (-1119.478) (-1117.808) * (-1117.025) [-1117.327] (-1117.006) (-1117.043) -- 0:00:52
159500 -- [-1116.645] (-1118.729) (-1115.041) (-1116.012) * [-1116.557] (-1117.101) (-1116.157) (-1115.665) -- 0:00:52
160000 -- (-1115.478) [-1117.949] (-1117.490) (-1115.869) * (-1117.026) [-1118.331] (-1115.712) (-1115.859) -- 0:00:52
Average standard deviation of split frequencies: 0.018531
160500 -- [-1116.404] (-1116.561) (-1119.724) (-1116.047) * (-1116.899) (-1116.953) [-1116.850] (-1115.977) -- 0:00:52
161000 -- (-1116.388) [-1119.042] (-1118.989) (-1119.756) * (-1115.847) (-1116.632) (-1116.750) [-1126.714] -- 0:00:52
161500 -- (-1117.953) [-1115.155] (-1117.601) (-1118.005) * [-1115.786] (-1117.018) (-1118.659) (-1114.852) -- 0:00:51
162000 -- (-1127.322) [-1117.211] (-1115.596) (-1116.133) * (-1116.909) (-1115.998) [-1118.866] (-1116.230) -- 0:00:51
162500 -- (-1118.500) [-1115.745] (-1115.953) (-1118.730) * [-1116.924] (-1117.918) (-1115.839) (-1117.359) -- 0:00:51
163000 -- (-1118.879) [-1116.047] (-1116.991) (-1115.511) * (-1118.339) (-1115.584) (-1117.416) [-1117.369] -- 0:00:51
163500 -- [-1116.943] (-1115.732) (-1116.069) (-1115.538) * (-1123.669) [-1116.768] (-1125.808) (-1116.222) -- 0:00:51
164000 -- (-1118.726) (-1116.564) [-1116.233] (-1115.778) * (-1121.444) (-1115.903) (-1116.398) [-1117.046] -- 0:00:50
164500 -- (-1115.318) (-1119.611) [-1115.361] (-1115.495) * (-1115.327) (-1115.852) (-1116.008) [-1115.492] -- 0:00:50
165000 -- (-1115.825) (-1122.964) (-1116.504) [-1115.924] * (-1117.956) [-1115.630] (-1116.812) (-1115.519) -- 0:00:50
Average standard deviation of split frequencies: 0.018743
165500 -- [-1115.671] (-1119.018) (-1116.504) (-1117.005) * (-1116.843) (-1115.376) (-1115.394) [-1117.987] -- 0:00:50
166000 -- [-1119.742] (-1120.400) (-1117.850) (-1116.413) * (-1116.475) [-1115.258] (-1115.382) (-1117.542) -- 0:00:50
166500 -- (-1117.659) (-1120.211) (-1117.679) [-1116.027] * (-1117.305) [-1117.720] (-1115.046) (-1116.432) -- 0:00:50
167000 -- (-1118.753) (-1120.102) [-1118.694] (-1121.352) * (-1115.848) (-1118.116) [-1115.016] (-1120.585) -- 0:00:49
167500 -- (-1118.800) [-1116.006] (-1116.546) (-1118.689) * [-1115.789] (-1116.120) (-1116.946) (-1122.180) -- 0:00:54
168000 -- (-1117.532) [-1117.872] (-1115.494) (-1116.208) * (-1117.705) (-1115.729) (-1116.099) [-1122.465] -- 0:00:54
168500 -- (-1119.115) (-1120.259) [-1118.004] (-1115.729) * (-1116.033) [-1115.718] (-1118.175) (-1117.230) -- 0:00:54
169000 -- [-1119.000] (-1117.907) (-1117.619) (-1116.832) * (-1116.088) (-1118.364) (-1118.412) [-1116.995] -- 0:00:54
169500 -- (-1119.163) (-1116.841) (-1119.733) [-1115.243] * (-1115.671) (-1117.350) (-1117.782) [-1115.579] -- 0:00:53
170000 -- [-1118.216] (-1120.235) (-1120.006) (-1119.473) * (-1117.268) (-1115.563) (-1118.508) [-1115.802] -- 0:00:53
Average standard deviation of split frequencies: 0.018644
170500 -- (-1118.600) [-1116.444] (-1120.672) (-1116.424) * [-1116.099] (-1115.732) (-1118.513) (-1115.575) -- 0:00:53
171000 -- (-1119.211) (-1116.554) (-1119.786) [-1119.072] * [-1116.713] (-1118.204) (-1119.007) (-1115.489) -- 0:00:53
171500 -- (-1117.266) [-1117.033] (-1116.607) (-1117.853) * (-1118.142) (-1116.648) (-1116.048) [-1116.050] -- 0:00:53
172000 -- (-1118.242) (-1116.318) [-1117.261] (-1118.265) * [-1120.424] (-1116.956) (-1117.310) (-1116.010) -- 0:00:52
172500 -- (-1117.056) (-1116.379) [-1120.706] (-1117.398) * (-1119.307) (-1114.909) [-1119.211] (-1119.451) -- 0:00:52
173000 -- (-1118.347) (-1117.151) (-1119.632) [-1116.340] * (-1117.829) (-1116.195) (-1116.323) [-1119.757] -- 0:00:52
173500 -- (-1120.145) (-1115.034) [-1116.306] (-1116.853) * (-1117.036) [-1115.388] (-1120.429) (-1122.574) -- 0:00:52
174000 -- [-1117.570] (-1116.213) (-1116.423) (-1115.814) * (-1116.308) [-1116.773] (-1119.530) (-1116.289) -- 0:00:52
174500 -- (-1117.280) (-1116.079) (-1117.245) [-1115.359] * (-1118.472) (-1115.298) [-1117.013] (-1120.193) -- 0:00:52
175000 -- (-1115.628) (-1116.351) [-1117.163] (-1115.883) * (-1117.471) (-1115.250) [-1118.454] (-1117.239) -- 0:00:51
Average standard deviation of split frequencies: 0.017946
175500 -- (-1117.527) (-1117.340) (-1116.407) [-1116.764] * [-1115.322] (-1118.386) (-1115.506) (-1119.639) -- 0:00:51
176000 -- [-1117.504] (-1115.359) (-1116.939) (-1115.692) * [-1116.693] (-1117.711) (-1117.117) (-1117.543) -- 0:00:51
176500 -- (-1118.298) (-1115.888) (-1120.547) [-1115.905] * [-1117.240] (-1117.230) (-1117.935) (-1116.604) -- 0:00:51
177000 -- (-1115.723) [-1115.422] (-1121.878) (-1117.945) * (-1117.057) [-1116.463] (-1117.634) (-1115.723) -- 0:00:51
177500 -- (-1116.631) [-1117.130] (-1122.349) (-1115.462) * (-1115.222) (-1117.753) (-1119.877) [-1116.104] -- 0:00:50
178000 -- (-1115.799) [-1116.585] (-1116.485) (-1115.975) * (-1117.473) (-1118.002) (-1118.953) [-1115.935] -- 0:00:50
178500 -- (-1117.928) [-1115.674] (-1117.172) (-1120.857) * (-1117.506) (-1118.071) (-1117.722) [-1116.217] -- 0:00:50
179000 -- (-1115.524) [-1122.033] (-1117.407) (-1124.060) * (-1127.207) [-1116.059] (-1121.363) (-1118.293) -- 0:00:50
179500 -- (-1120.277) (-1117.650) [-1115.411] (-1118.267) * (-1120.549) [-1115.954] (-1119.542) (-1119.142) -- 0:00:50
180000 -- (-1119.608) [-1116.254] (-1119.290) (-1116.645) * (-1119.610) (-1115.199) (-1120.975) [-1116.420] -- 0:00:50
Average standard deviation of split frequencies: 0.017612
180500 -- [-1119.698] (-1116.513) (-1120.304) (-1116.015) * (-1117.224) [-1120.857] (-1115.262) (-1117.174) -- 0:00:49
181000 -- [-1117.029] (-1115.727) (-1117.511) (-1115.216) * (-1119.416) (-1116.515) (-1115.066) [-1118.481] -- 0:00:49
181500 -- (-1124.386) (-1115.248) [-1117.355] (-1115.800) * (-1116.138) (-1118.405) [-1116.023] (-1117.401) -- 0:00:49
182000 -- (-1120.491) [-1116.851] (-1116.195) (-1116.003) * (-1117.412) [-1115.403] (-1120.697) (-1117.339) -- 0:00:49
182500 -- (-1115.336) (-1119.188) [-1115.533] (-1115.948) * (-1119.208) (-1117.725) [-1120.527] (-1116.626) -- 0:00:49
183000 -- (-1115.860) (-1117.669) (-1118.765) [-1116.508] * (-1118.909) [-1118.341] (-1116.339) (-1116.430) -- 0:00:49
183500 -- (-1117.071) (-1117.649) (-1116.230) [-1116.146] * (-1118.407) [-1116.594] (-1115.848) (-1116.114) -- 0:00:53
184000 -- (-1120.372) (-1115.562) (-1116.268) [-1115.838] * (-1116.796) (-1118.271) (-1117.915) [-1116.061] -- 0:00:53
184500 -- (-1122.294) [-1116.656] (-1115.721) (-1114.944) * (-1117.125) (-1119.601) [-1117.138] (-1119.657) -- 0:00:53
185000 -- (-1121.211) [-1117.897] (-1115.957) (-1115.219) * (-1118.433) (-1121.158) [-1116.620] (-1119.543) -- 0:00:52
Average standard deviation of split frequencies: 0.016220
185500 -- [-1117.873] (-1117.977) (-1115.568) (-1117.318) * (-1123.452) [-1121.844] (-1118.706) (-1125.606) -- 0:00:52
186000 -- [-1117.853] (-1119.854) (-1115.533) (-1117.460) * [-1121.367] (-1125.543) (-1116.838) (-1121.892) -- 0:00:52
186500 -- [-1116.620] (-1115.837) (-1116.130) (-1118.219) * [-1116.572] (-1118.727) (-1115.075) (-1115.988) -- 0:00:52
187000 -- [-1115.831] (-1118.351) (-1118.661) (-1116.491) * (-1116.418) [-1116.411] (-1115.388) (-1116.127) -- 0:00:52
187500 -- (-1118.138) [-1116.208] (-1117.233) (-1116.566) * (-1115.538) [-1117.945] (-1117.711) (-1118.027) -- 0:00:52
188000 -- (-1118.692) [-1117.487] (-1116.695) (-1118.810) * [-1117.863] (-1119.231) (-1119.898) (-1115.573) -- 0:00:51
188500 -- (-1117.901) (-1117.518) (-1116.022) [-1117.103] * (-1116.230) (-1117.753) (-1117.009) [-1116.149] -- 0:00:51
189000 -- (-1118.184) (-1116.033) [-1117.419] (-1118.226) * [-1116.805] (-1117.706) (-1121.714) (-1117.928) -- 0:00:51
189500 -- [-1115.843] (-1116.028) (-1117.806) (-1118.694) * [-1116.304] (-1115.107) (-1119.657) (-1115.561) -- 0:00:51
190000 -- [-1117.176] (-1115.735) (-1116.091) (-1118.821) * [-1119.613] (-1118.261) (-1119.341) (-1115.361) -- 0:00:51
Average standard deviation of split frequencies: 0.018088
190500 -- (-1117.166) (-1116.560) [-1119.025] (-1115.403) * (-1116.042) (-1118.124) [-1119.028] (-1117.657) -- 0:00:50
191000 -- (-1117.809) [-1119.614] (-1118.367) (-1116.410) * [-1117.036] (-1118.200) (-1117.305) (-1117.945) -- 0:00:50
191500 -- (-1115.890) (-1126.286) (-1118.502) [-1116.162] * (-1115.703) (-1116.936) (-1119.995) [-1116.704] -- 0:00:50
192000 -- [-1114.921] (-1120.224) (-1120.545) (-1115.864) * (-1119.313) (-1115.774) (-1120.416) [-1124.180] -- 0:00:50
192500 -- (-1115.231) [-1122.370] (-1118.492) (-1118.820) * (-1118.984) [-1116.171] (-1118.179) (-1122.381) -- 0:00:50
193000 -- (-1116.973) (-1120.581) [-1116.084] (-1116.978) * (-1117.849) (-1116.387) (-1120.237) [-1118.225] -- 0:00:50
193500 -- (-1117.778) [-1117.176] (-1115.809) (-1117.663) * [-1116.742] (-1116.385) (-1117.812) (-1117.951) -- 0:00:50
194000 -- (-1118.493) (-1116.259) (-1117.181) [-1118.773] * (-1117.845) (-1116.637) (-1118.864) [-1118.832] -- 0:00:49
194500 -- (-1117.884) (-1115.230) (-1117.198) [-1117.430] * (-1115.585) (-1116.844) [-1117.202] (-1116.480) -- 0:00:49
195000 -- (-1117.999) (-1116.396) (-1115.866) [-1115.360] * [-1115.961] (-1116.410) (-1117.231) (-1116.686) -- 0:00:49
Average standard deviation of split frequencies: 0.016456
195500 -- (-1116.496) [-1116.734] (-1116.633) (-1116.837) * [-1115.433] (-1115.554) (-1117.691) (-1118.919) -- 0:00:49
196000 -- (-1117.539) (-1117.949) [-1117.910] (-1115.852) * (-1118.053) [-1117.724] (-1116.773) (-1116.326) -- 0:00:49
196500 -- (-1118.097) (-1117.611) [-1116.392] (-1118.452) * [-1120.015] (-1118.216) (-1116.773) (-1116.327) -- 0:00:49
197000 -- [-1119.212] (-1117.048) (-1117.258) (-1119.459) * [-1117.268] (-1116.168) (-1116.665) (-1116.518) -- 0:00:48
197500 -- (-1118.412) [-1120.296] (-1119.156) (-1120.610) * (-1121.118) (-1115.779) [-1115.707] (-1119.011) -- 0:00:48
198000 -- (-1116.997) (-1118.714) [-1120.457] (-1118.812) * [-1117.878] (-1117.817) (-1115.833) (-1125.132) -- 0:00:48
198500 -- (-1122.227) (-1118.604) (-1116.432) [-1115.889] * [-1118.290] (-1117.782) (-1118.193) (-1118.056) -- 0:00:48
199000 -- (-1117.713) (-1117.788) [-1117.367] (-1115.717) * (-1117.005) (-1119.934) [-1116.087] (-1121.010) -- 0:00:48
199500 -- (-1121.618) (-1118.152) [-1118.156] (-1115.572) * (-1116.690) (-1117.609) [-1118.070] (-1118.954) -- 0:00:52
200000 -- (-1116.562) (-1118.629) (-1118.738) [-1115.559] * (-1120.132) [-1116.127] (-1119.201) (-1117.435) -- 0:00:51
Average standard deviation of split frequencies: 0.015792
200500 -- (-1118.098) [-1116.622] (-1116.912) (-1115.581) * (-1116.372) [-1117.834] (-1117.088) (-1118.122) -- 0:00:51
201000 -- (-1117.126) [-1118.003] (-1117.651) (-1117.737) * (-1115.323) [-1115.715] (-1116.670) (-1118.480) -- 0:00:51
201500 -- (-1117.364) (-1119.774) (-1119.185) [-1115.514] * [-1117.106] (-1115.354) (-1116.768) (-1116.294) -- 0:00:51
202000 -- [-1116.515] (-1119.450) (-1117.282) (-1116.003) * (-1115.063) (-1119.310) (-1116.684) [-1115.985] -- 0:00:51
202500 -- (-1119.079) (-1116.015) (-1116.983) [-1116.023] * (-1115.136) (-1116.690) (-1116.875) [-1116.926] -- 0:00:51
203000 -- (-1119.467) (-1117.187) (-1115.241) [-1115.625] * [-1115.182] (-1116.107) (-1117.976) (-1117.854) -- 0:00:51
203500 -- (-1117.153) (-1117.775) (-1117.288) [-1115.760] * (-1116.078) [-1118.544] (-1117.363) (-1119.977) -- 0:00:50
204000 -- (-1117.349) [-1115.431] (-1125.043) (-1117.967) * (-1115.738) [-1117.520] (-1116.891) (-1118.094) -- 0:00:50
204500 -- (-1118.053) (-1115.847) [-1115.522] (-1115.953) * (-1117.337) (-1116.623) [-1116.917] (-1118.024) -- 0:00:50
205000 -- (-1116.430) (-1115.567) [-1115.530] (-1120.242) * (-1116.102) [-1116.898] (-1116.397) (-1116.674) -- 0:00:50
Average standard deviation of split frequencies: 0.013730
205500 -- (-1119.730) (-1115.599) (-1117.693) [-1116.881] * (-1116.080) (-1116.125) [-1119.556] (-1116.888) -- 0:00:50
206000 -- (-1121.391) (-1115.765) (-1116.328) [-1115.984] * [-1117.506] (-1119.873) (-1122.467) (-1117.384) -- 0:00:50
206500 -- (-1115.522) (-1115.518) (-1115.596) [-1116.940] * (-1123.101) [-1117.310] (-1120.602) (-1116.504) -- 0:00:49
207000 -- [-1115.512] (-1115.949) (-1120.089) (-1117.177) * (-1118.809) [-1118.409] (-1116.535) (-1115.648) -- 0:00:49
207500 -- (-1117.435) [-1115.084] (-1117.323) (-1118.901) * (-1116.354) [-1117.215] (-1117.011) (-1116.487) -- 0:00:49
208000 -- [-1115.518] (-1115.084) (-1116.850) (-1117.454) * (-1117.952) [-1116.287] (-1116.992) (-1117.327) -- 0:00:49
208500 -- [-1115.503] (-1115.559) (-1116.380) (-1116.776) * (-1118.753) (-1120.404) [-1115.329] (-1117.359) -- 0:00:49
209000 -- (-1115.565) [-1118.478] (-1118.181) (-1122.516) * (-1116.481) (-1116.133) [-1116.808] (-1117.331) -- 0:00:49
209500 -- (-1115.385) [-1115.364] (-1118.253) (-1123.297) * [-1116.951] (-1116.204) (-1116.150) (-1115.953) -- 0:00:49
210000 -- (-1116.618) [-1114.862] (-1116.079) (-1117.672) * (-1118.787) [-1119.810] (-1119.424) (-1116.027) -- 0:00:48
Average standard deviation of split frequencies: 0.013923
210500 -- (-1116.412) [-1114.862] (-1117.972) (-1115.894) * (-1116.291) [-1117.471] (-1118.899) (-1118.376) -- 0:00:48
211000 -- (-1117.651) (-1115.806) [-1116.129] (-1115.806) * (-1115.938) [-1117.341] (-1117.230) (-1118.787) -- 0:00:48
211500 -- (-1118.308) (-1117.963) [-1116.509] (-1119.438) * (-1116.296) (-1116.492) [-1116.033] (-1120.185) -- 0:00:48
212000 -- (-1117.953) (-1116.573) (-1118.383) [-1116.525] * (-1116.927) (-1118.636) [-1116.522] (-1121.624) -- 0:00:48
212500 -- [-1117.522] (-1116.325) (-1121.255) (-1118.976) * [-1116.878] (-1117.221) (-1116.062) (-1115.734) -- 0:00:48
213000 -- (-1116.741) (-1115.182) (-1119.296) [-1116.931] * (-1120.322) [-1117.175] (-1121.843) (-1117.304) -- 0:00:48
213500 -- [-1116.105] (-1115.088) (-1122.194) (-1116.038) * (-1119.809) (-1120.911) [-1116.896] (-1119.818) -- 0:00:47
214000 -- [-1115.598] (-1119.476) (-1120.775) (-1116.474) * (-1117.542) (-1120.266) (-1121.752) [-1123.290] -- 0:00:47
214500 -- [-1115.966] (-1116.339) (-1118.803) (-1118.795) * (-1118.019) (-1119.227) [-1121.504] (-1119.665) -- 0:00:47
215000 -- [-1116.233] (-1117.798) (-1116.398) (-1118.147) * [-1120.210] (-1120.488) (-1122.911) (-1118.830) -- 0:00:47
Average standard deviation of split frequencies: 0.014635
215500 -- [-1118.296] (-1115.416) (-1116.262) (-1116.405) * (-1118.237) [-1117.527] (-1117.138) (-1125.469) -- 0:00:50
216000 -- (-1115.254) [-1116.780] (-1116.966) (-1117.928) * (-1119.875) (-1117.753) (-1119.362) [-1117.393] -- 0:00:50
216500 -- (-1118.644) (-1117.119) (-1118.574) [-1116.976] * (-1118.707) (-1118.068) [-1118.527] (-1121.446) -- 0:00:50
217000 -- (-1116.655) (-1118.429) (-1120.012) [-1117.784] * (-1120.678) (-1118.367) [-1116.842] (-1123.771) -- 0:00:50
217500 -- [-1115.670] (-1121.715) (-1116.567) (-1119.252) * [-1117.154] (-1118.480) (-1116.886) (-1119.196) -- 0:00:50
218000 -- (-1115.540) [-1118.133] (-1116.470) (-1115.474) * (-1116.677) (-1116.630) [-1117.052] (-1118.738) -- 0:00:50
218500 -- (-1118.167) (-1117.013) (-1116.369) [-1114.972] * (-1119.187) (-1117.723) [-1116.061] (-1116.401) -- 0:00:50
219000 -- (-1115.845) [-1115.034] (-1118.023) (-1115.997) * (-1118.982) (-1118.646) [-1118.765] (-1119.421) -- 0:00:49
219500 -- [-1115.878] (-1116.743) (-1119.933) (-1117.121) * (-1118.066) [-1115.485] (-1117.869) (-1120.063) -- 0:00:49
220000 -- [-1116.690] (-1115.226) (-1123.821) (-1117.077) * [-1117.785] (-1120.277) (-1117.870) (-1118.709) -- 0:00:49
Average standard deviation of split frequencies: 0.014451
220500 -- (-1116.890) [-1116.788] (-1119.618) (-1118.299) * (-1116.997) (-1120.445) [-1117.126] (-1117.300) -- 0:00:49
221000 -- (-1118.013) [-1119.178] (-1116.297) (-1122.376) * (-1121.200) [-1117.159] (-1118.078) (-1116.413) -- 0:00:49
221500 -- [-1119.199] (-1118.993) (-1115.648) (-1120.110) * [-1116.463] (-1116.020) (-1123.648) (-1117.624) -- 0:00:49
222000 -- (-1118.079) (-1120.582) [-1115.426] (-1121.691) * (-1117.159) (-1121.652) [-1122.819] (-1116.955) -- 0:00:49
222500 -- (-1117.476) (-1118.259) [-1115.550] (-1116.098) * (-1114.780) [-1122.954] (-1119.596) (-1116.472) -- 0:00:48
223000 -- (-1116.084) (-1118.967) [-1115.421] (-1116.828) * [-1115.442] (-1117.184) (-1118.240) (-1118.197) -- 0:00:48
223500 -- (-1116.608) (-1116.312) [-1116.485] (-1116.189) * [-1115.026] (-1117.190) (-1116.114) (-1116.930) -- 0:00:48
224000 -- (-1117.510) [-1117.076] (-1118.182) (-1119.147) * (-1115.322) [-1115.838] (-1115.677) (-1117.027) -- 0:00:48
224500 -- (-1119.304) (-1118.047) [-1117.219] (-1121.163) * (-1115.483) [-1120.084] (-1116.859) (-1117.623) -- 0:00:48
225000 -- [-1116.909] (-1117.774) (-1118.617) (-1116.843) * [-1116.366] (-1118.572) (-1119.989) (-1117.444) -- 0:00:48
Average standard deviation of split frequencies: 0.014356
225500 -- (-1117.161) (-1115.172) [-1118.908] (-1118.466) * (-1116.492) [-1115.881] (-1117.560) (-1117.576) -- 0:00:48
226000 -- (-1116.741) (-1122.481) [-1116.947] (-1116.483) * [-1115.771] (-1120.520) (-1115.565) (-1116.182) -- 0:00:47
226500 -- (-1120.934) (-1122.262) [-1120.509] (-1116.475) * [-1116.013] (-1115.968) (-1117.778) (-1118.635) -- 0:00:47
227000 -- (-1116.803) (-1116.818) (-1119.626) [-1116.176] * (-1117.311) [-1116.620] (-1117.997) (-1115.734) -- 0:00:47
227500 -- (-1119.229) (-1117.748) [-1116.160] (-1117.424) * [-1117.929] (-1116.122) (-1116.520) (-1115.996) -- 0:00:47
228000 -- (-1117.651) [-1115.983] (-1120.636) (-1117.971) * (-1117.405) (-1118.989) [-1116.697] (-1116.648) -- 0:00:47
228500 -- (-1131.315) [-1115.229] (-1117.892) (-1119.647) * (-1115.581) (-1116.102) [-1115.076] (-1116.367) -- 0:00:47
229000 -- (-1117.797) [-1115.222] (-1119.518) (-1118.374) * (-1116.655) [-1117.492] (-1118.277) (-1119.063) -- 0:00:47
229500 -- (-1118.774) (-1117.022) (-1115.785) [-1115.458] * (-1117.243) (-1115.648) (-1119.913) [-1116.443] -- 0:00:47
230000 -- [-1117.993] (-1116.033) (-1116.435) (-1119.784) * (-1117.536) [-1115.483] (-1117.505) (-1115.998) -- 0:00:46
Average standard deviation of split frequencies: 0.013464
230500 -- [-1115.882] (-1118.424) (-1116.188) (-1120.581) * [-1115.634] (-1116.435) (-1116.880) (-1116.163) -- 0:00:46
231000 -- (-1119.588) (-1116.880) [-1115.918] (-1117.998) * (-1122.777) (-1117.537) [-1117.712] (-1117.329) -- 0:00:46
231500 -- (-1118.539) (-1117.218) (-1116.269) [-1118.062] * (-1121.637) [-1116.684] (-1116.769) (-1115.444) -- 0:00:49
232000 -- (-1118.983) [-1115.561] (-1117.534) (-1117.522) * (-1118.155) [-1116.901] (-1116.398) (-1115.993) -- 0:00:49
232500 -- (-1118.599) (-1116.224) (-1118.752) [-1119.610] * (-1116.636) (-1119.651) (-1118.416) [-1115.825] -- 0:00:49
233000 -- [-1119.266] (-1117.310) (-1117.804) (-1116.376) * (-1117.051) (-1120.438) [-1120.855] (-1115.838) -- 0:00:49
233500 -- (-1121.485) (-1117.866) [-1115.313] (-1116.852) * (-1116.805) (-1115.525) [-1118.150] (-1116.468) -- 0:00:49
234000 -- (-1120.579) [-1116.253] (-1115.876) (-1117.021) * (-1117.639) [-1115.429] (-1115.525) (-1115.392) -- 0:00:49
234500 -- [-1117.573] (-1116.495) (-1116.439) (-1118.586) * (-1115.838) (-1118.292) (-1117.697) [-1117.634] -- 0:00:48
235000 -- (-1115.879) [-1120.077] (-1116.074) (-1118.295) * (-1115.839) (-1116.562) [-1117.483] (-1116.237) -- 0:00:48
Average standard deviation of split frequencies: 0.013160
235500 -- (-1116.186) (-1117.605) (-1121.888) [-1117.220] * (-1117.994) [-1118.727] (-1117.428) (-1115.635) -- 0:00:48
236000 -- (-1116.320) [-1115.770] (-1115.518) (-1116.541) * (-1117.149) (-1116.282) (-1120.365) [-1116.859] -- 0:00:48
236500 -- [-1117.746] (-1115.476) (-1115.840) (-1122.242) * (-1117.613) [-1116.156] (-1118.842) (-1116.070) -- 0:00:48
237000 -- [-1115.730] (-1115.658) (-1116.897) (-1116.158) * (-1119.342) [-1117.230] (-1118.900) (-1116.034) -- 0:00:48
237500 -- [-1115.238] (-1115.587) (-1118.038) (-1119.981) * (-1119.325) [-1118.850] (-1117.707) (-1115.617) -- 0:00:48
238000 -- (-1115.211) [-1116.787] (-1119.362) (-1116.351) * (-1118.058) [-1117.742] (-1119.981) (-1117.006) -- 0:00:48
238500 -- (-1116.117) [-1116.803] (-1122.562) (-1117.098) * (-1116.174) [-1119.295] (-1116.379) (-1116.278) -- 0:00:47
239000 -- [-1118.973] (-1115.107) (-1117.219) (-1119.805) * (-1119.690) (-1116.960) (-1117.252) [-1116.905] -- 0:00:47
239500 -- [-1122.398] (-1115.404) (-1118.509) (-1118.974) * [-1118.195] (-1119.181) (-1119.354) (-1116.991) -- 0:00:47
240000 -- (-1115.607) (-1117.244) (-1118.248) [-1122.277] * (-1119.323) (-1117.353) (-1116.466) [-1116.524] -- 0:00:47
Average standard deviation of split frequencies: 0.010406
240500 -- [-1119.817] (-1116.635) (-1121.911) (-1123.388) * (-1115.288) (-1118.635) (-1116.756) [-1116.416] -- 0:00:47
241000 -- (-1120.414) [-1115.617] (-1117.819) (-1123.958) * [-1115.995] (-1115.739) (-1118.166) (-1117.579) -- 0:00:47
241500 -- (-1115.839) (-1119.531) [-1117.276] (-1124.041) * (-1119.511) (-1117.258) (-1117.483) [-1115.869] -- 0:00:47
242000 -- (-1118.382) (-1116.357) [-1118.872] (-1120.520) * (-1117.933) (-1115.830) (-1117.188) [-1115.675] -- 0:00:46
242500 -- (-1116.218) (-1115.262) [-1116.863] (-1118.868) * [-1116.595] (-1118.865) (-1115.329) (-1115.881) -- 0:00:46
243000 -- (-1116.429) (-1115.573) (-1117.299) [-1117.459] * (-1117.102) (-1115.640) (-1115.317) [-1115.959] -- 0:00:46
243500 -- [-1116.100] (-1115.798) (-1117.875) (-1115.810) * (-1120.461) (-1117.873) [-1116.694] (-1115.624) -- 0:00:46
244000 -- (-1116.310) (-1116.646) [-1115.803] (-1116.095) * (-1119.844) (-1117.292) [-1116.035] (-1120.507) -- 0:00:46
244500 -- (-1117.782) (-1118.940) (-1115.843) [-1115.539] * (-1117.391) (-1118.477) [-1117.394] (-1123.133) -- 0:00:46
245000 -- (-1120.828) (-1115.578) (-1117.429) [-1115.390] * (-1119.519) [-1116.041] (-1116.726) (-1119.835) -- 0:00:46
Average standard deviation of split frequencies: 0.009941
245500 -- [-1118.307] (-1115.232) (-1118.795) (-1118.283) * (-1118.849) [-1116.563] (-1117.750) (-1116.108) -- 0:00:46
246000 -- (-1117.586) (-1118.833) [-1116.512] (-1120.661) * (-1118.718) (-1117.481) [-1116.828] (-1116.306) -- 0:00:45
246500 -- (-1118.414) (-1117.433) (-1118.048) [-1121.420] * (-1118.598) [-1116.650] (-1115.441) (-1118.225) -- 0:00:45
247000 -- (-1119.877) (-1118.718) [-1116.260] (-1116.347) * (-1117.591) (-1115.647) (-1117.951) [-1116.861] -- 0:00:45
247500 -- (-1119.952) [-1116.430] (-1115.993) (-1115.685) * (-1119.035) (-1117.237) [-1121.008] (-1115.616) -- 0:00:48
248000 -- (-1118.098) (-1120.498) (-1117.793) [-1116.539] * (-1116.977) (-1117.430) [-1115.770] (-1119.661) -- 0:00:48
248500 -- (-1117.726) [-1119.376] (-1115.605) (-1119.360) * (-1116.302) (-1117.893) [-1115.908] (-1118.600) -- 0:00:48
249000 -- (-1115.383) (-1119.401) (-1116.115) [-1118.281] * (-1115.732) (-1122.085) [-1116.458] (-1117.169) -- 0:00:48
249500 -- (-1115.784) [-1118.888] (-1118.924) (-1116.346) * (-1115.737) (-1119.823) [-1116.001] (-1120.554) -- 0:00:48
250000 -- [-1115.343] (-1120.303) (-1117.814) (-1117.531) * (-1117.057) (-1117.520) [-1115.995] (-1118.608) -- 0:00:48
Average standard deviation of split frequencies: 0.010696
250500 -- (-1116.932) [-1118.157] (-1130.025) (-1117.028) * [-1115.462] (-1118.432) (-1118.095) (-1118.161) -- 0:00:47
251000 -- [-1116.040] (-1115.496) (-1118.349) (-1118.271) * (-1119.613) (-1116.964) (-1117.501) [-1118.235] -- 0:00:47
251500 -- (-1118.304) [-1117.781] (-1118.412) (-1117.342) * (-1115.519) (-1117.756) (-1115.580) [-1115.615] -- 0:00:47
252000 -- (-1115.916) (-1117.107) [-1119.519] (-1117.268) * [-1115.347] (-1120.200) (-1115.267) (-1116.957) -- 0:00:47
252500 -- (-1117.599) [-1117.489] (-1118.984) (-1119.260) * [-1115.097] (-1118.639) (-1116.864) (-1121.602) -- 0:00:47
253000 -- (-1119.870) (-1117.891) [-1118.757] (-1116.005) * (-1121.307) [-1120.011] (-1117.580) (-1116.602) -- 0:00:47
253500 -- [-1116.298] (-1117.843) (-1115.932) (-1116.043) * [-1117.337] (-1115.174) (-1116.426) (-1119.767) -- 0:00:47
254000 -- (-1116.285) (-1118.257) [-1115.624] (-1115.566) * (-1118.684) (-1116.188) [-1116.602] (-1116.709) -- 0:00:46
254500 -- (-1116.831) (-1115.917) [-1117.052] (-1116.778) * (-1118.712) (-1118.391) [-1116.963] (-1116.698) -- 0:00:46
255000 -- (-1116.743) [-1115.917] (-1117.147) (-1118.380) * (-1120.541) (-1116.622) (-1117.586) [-1115.436] -- 0:00:46
Average standard deviation of split frequencies: 0.009552
255500 -- (-1117.063) [-1115.441] (-1115.730) (-1115.317) * (-1118.665) (-1119.748) [-1119.316] (-1116.722) -- 0:00:46
256000 -- [-1116.455] (-1115.398) (-1115.990) (-1114.938) * (-1120.063) [-1118.957] (-1119.368) (-1120.310) -- 0:00:46
256500 -- (-1116.752) [-1116.233] (-1118.387) (-1120.536) * (-1120.366) (-1116.841) (-1115.761) [-1116.968] -- 0:00:46
257000 -- [-1116.944] (-1116.301) (-1118.485) (-1117.104) * (-1117.104) (-1116.197) [-1115.800] (-1120.007) -- 0:00:46
257500 -- (-1117.089) (-1115.159) [-1118.628] (-1116.850) * (-1117.207) [-1115.697] (-1115.095) (-1122.173) -- 0:00:46
258000 -- [-1120.771] (-1115.778) (-1117.046) (-1117.713) * (-1117.776) [-1115.081] (-1119.071) (-1121.304) -- 0:00:46
258500 -- (-1119.572) (-1115.452) (-1116.189) [-1116.194] * [-1119.093] (-1116.042) (-1115.357) (-1117.579) -- 0:00:45
259000 -- (-1119.091) (-1116.384) [-1116.655] (-1117.043) * (-1119.017) (-1115.270) (-1116.467) [-1118.302] -- 0:00:45
259500 -- (-1118.209) (-1115.839) [-1116.589] (-1116.617) * (-1119.384) [-1117.353] (-1115.952) (-1118.897) -- 0:00:45
260000 -- (-1116.424) (-1116.693) (-1117.419) [-1117.313] * (-1119.215) (-1118.081) [-1116.049] (-1116.576) -- 0:00:45
Average standard deviation of split frequencies: 0.009947
260500 -- (-1116.026) (-1116.518) [-1115.838] (-1115.550) * (-1118.956) (-1118.158) (-1116.317) [-1117.227] -- 0:00:45
261000 -- (-1116.187) (-1116.788) [-1116.831] (-1115.400) * (-1120.040) [-1117.440] (-1115.460) (-1116.285) -- 0:00:45
261500 -- (-1117.468) [-1116.718] (-1118.208) (-1115.309) * (-1120.030) (-1116.656) [-1115.096] (-1116.089) -- 0:00:45
262000 -- (-1120.331) (-1116.365) [-1117.868] (-1119.637) * (-1119.607) (-1117.908) (-1115.058) [-1115.680] -- 0:00:45
262500 -- (-1115.710) (-1121.193) [-1116.141] (-1116.940) * (-1116.065) (-1117.853) [-1115.982] (-1115.052) -- 0:00:44
263000 -- (-1115.292) [-1118.567] (-1116.148) (-1115.548) * (-1116.373) (-1119.275) (-1115.843) [-1118.464] -- 0:00:44
263500 -- [-1116.005] (-1116.641) (-1116.387) (-1116.739) * (-1116.349) (-1116.553) (-1116.091) [-1117.648] -- 0:00:47
264000 -- (-1116.399) (-1116.588) (-1118.263) [-1118.109] * [-1117.559] (-1116.203) (-1117.801) (-1117.710) -- 0:00:47
264500 -- (-1120.656) (-1118.406) [-1116.760] (-1117.898) * [-1116.810] (-1121.915) (-1116.516) (-1117.924) -- 0:00:47
265000 -- (-1121.753) [-1116.430] (-1116.807) (-1120.383) * [-1116.027] (-1116.236) (-1117.029) (-1116.300) -- 0:00:47
Average standard deviation of split frequencies: 0.009591
265500 -- [-1118.008] (-1121.948) (-1115.370) (-1117.420) * (-1116.122) [-1117.299] (-1118.523) (-1116.622) -- 0:00:47
266000 -- (-1115.791) (-1118.531) (-1115.643) [-1117.253] * (-1116.143) (-1116.416) (-1116.107) [-1116.890] -- 0:00:46
266500 -- [-1115.802] (-1116.064) (-1115.628) (-1119.345) * (-1115.089) (-1116.294) (-1116.531) [-1117.482] -- 0:00:46
267000 -- (-1114.794) (-1116.919) [-1115.351] (-1119.156) * [-1117.258] (-1119.886) (-1119.724) (-1115.890) -- 0:00:46
267500 -- (-1115.117) (-1118.998) [-1115.414] (-1121.009) * [-1117.784] (-1115.288) (-1118.777) (-1115.541) -- 0:00:46
268000 -- [-1116.288] (-1120.041) (-1117.507) (-1117.613) * [-1120.401] (-1118.257) (-1116.923) (-1115.848) -- 0:00:46
268500 -- (-1118.357) (-1118.913) [-1118.223] (-1118.187) * (-1119.596) (-1116.768) [-1115.683] (-1117.870) -- 0:00:46
269000 -- (-1117.842) (-1118.706) (-1118.851) [-1118.686] * (-1117.361) [-1115.985] (-1117.477) (-1118.572) -- 0:00:46
269500 -- (-1123.976) (-1117.764) [-1116.544] (-1117.474) * (-1117.361) [-1115.374] (-1116.823) (-1117.453) -- 0:00:46
270000 -- (-1118.312) [-1115.998] (-1118.532) (-1116.717) * (-1116.821) (-1115.480) (-1117.156) [-1115.906] -- 0:00:45
Average standard deviation of split frequencies: 0.009482
270500 -- [-1117.835] (-1115.885) (-1117.823) (-1115.328) * [-1117.647] (-1115.480) (-1117.277) (-1118.930) -- 0:00:45
271000 -- (-1118.275) (-1115.453) [-1116.120] (-1118.672) * (-1117.296) (-1115.262) (-1115.972) [-1116.157] -- 0:00:45
271500 -- (-1120.071) (-1115.680) (-1116.984) [-1115.345] * (-1117.968) (-1116.217) (-1118.832) [-1117.595] -- 0:00:45
272000 -- (-1119.300) [-1115.467] (-1117.478) (-1117.832) * (-1117.355) [-1116.233] (-1115.461) (-1117.642) -- 0:00:45
272500 -- (-1116.870) (-1115.746) (-1117.012) [-1119.983] * (-1119.676) (-1115.845) [-1116.665] (-1117.517) -- 0:00:45
273000 -- (-1118.437) (-1115.516) [-1115.959] (-1117.690) * [-1117.355] (-1118.016) (-1118.189) (-1121.526) -- 0:00:45
273500 -- (-1118.494) (-1115.439) [-1115.972] (-1119.281) * (-1119.241) (-1117.954) [-1116.084] (-1117.742) -- 0:00:45
274000 -- (-1119.856) (-1115.961) (-1118.094) [-1120.281] * (-1118.368) (-1122.010) (-1116.905) [-1117.340] -- 0:00:45
274500 -- (-1120.870) [-1117.159] (-1117.177) (-1117.111) * [-1116.275] (-1122.010) (-1118.375) (-1116.550) -- 0:00:44
275000 -- (-1117.965) (-1115.633) (-1118.238) [-1115.122] * (-1117.086) (-1117.628) [-1118.359] (-1115.182) -- 0:00:44
Average standard deviation of split frequencies: 0.010248
275500 -- [-1118.221] (-1115.499) (-1115.950) (-1115.321) * (-1118.663) [-1117.129] (-1117.904) (-1117.007) -- 0:00:44
276000 -- (-1120.188) [-1116.543] (-1120.240) (-1115.892) * (-1118.134) (-1118.511) (-1118.446) [-1116.634] -- 0:00:44
276500 -- (-1120.046) [-1121.465] (-1117.885) (-1116.862) * (-1115.676) (-1115.522) (-1120.472) [-1117.500] -- 0:00:44
277000 -- (-1117.388) (-1122.300) (-1116.915) [-1116.295] * (-1116.309) (-1117.791) [-1118.061] (-1116.887) -- 0:00:44
277500 -- (-1116.505) (-1120.693) (-1115.633) [-1116.533] * (-1115.684) (-1118.749) (-1118.011) [-1116.198] -- 0:00:44
278000 -- (-1117.410) (-1119.020) [-1116.501] (-1117.409) * (-1117.094) [-1115.217] (-1117.444) (-1115.283) -- 0:00:44
278500 -- (-1116.507) (-1119.406) (-1117.498) [-1116.535] * (-1117.898) [-1117.718] (-1116.266) (-1117.273) -- 0:00:44
279000 -- (-1124.465) (-1118.097) [-1116.960] (-1115.197) * (-1117.201) (-1117.233) (-1116.938) [-1117.980] -- 0:00:43
279500 -- (-1116.570) (-1119.458) (-1115.233) [-1115.603] * (-1117.337) [-1115.869] (-1118.780) (-1121.843) -- 0:00:43
280000 -- [-1119.261] (-1116.202) (-1115.687) (-1119.050) * (-1116.527) [-1116.727] (-1119.435) (-1120.293) -- 0:00:46
Average standard deviation of split frequencies: 0.009287
280500 -- [-1119.333] (-1115.710) (-1116.687) (-1119.128) * (-1116.138) (-1116.860) [-1115.502] (-1118.899) -- 0:00:46
281000 -- [-1117.057] (-1116.806) (-1116.249) (-1117.611) * [-1117.451] (-1117.716) (-1117.059) (-1117.133) -- 0:00:46
281500 -- (-1116.662) (-1117.260) [-1118.333] (-1117.016) * (-1116.438) (-1116.006) [-1116.567] (-1122.279) -- 0:00:45
282000 -- [-1116.913] (-1116.926) (-1118.256) (-1118.016) * (-1116.535) (-1115.737) (-1120.931) [-1117.645] -- 0:00:45
282500 -- (-1119.225) (-1116.778) [-1117.229] (-1115.881) * [-1120.225] (-1121.392) (-1119.960) (-1117.721) -- 0:00:45
283000 -- (-1117.252) (-1116.681) (-1115.577) [-1116.586] * [-1116.121] (-1118.088) (-1116.597) (-1116.689) -- 0:00:45
283500 -- [-1116.829] (-1115.676) (-1117.045) (-1117.082) * [-1115.440] (-1117.069) (-1117.337) (-1116.323) -- 0:00:45
284000 -- (-1116.926) (-1117.704) [-1120.606] (-1116.041) * (-1116.992) (-1115.002) (-1118.478) [-1116.592] -- 0:00:45
284500 -- (-1117.642) (-1119.847) (-1118.247) [-1115.344] * (-1115.272) [-1115.570] (-1118.918) (-1117.144) -- 0:00:45
285000 -- [-1117.884] (-1120.285) (-1119.305) (-1115.845) * [-1119.260] (-1116.338) (-1118.942) (-1116.096) -- 0:00:45
Average standard deviation of split frequencies: 0.009523
285500 -- (-1118.002) (-1120.282) [-1117.117] (-1115.119) * (-1115.709) (-1117.157) [-1116.780] (-1118.144) -- 0:00:45
286000 -- [-1120.079] (-1117.118) (-1117.254) (-1116.219) * (-1115.288) (-1117.097) (-1117.486) [-1116.483] -- 0:00:44
286500 -- (-1119.606) (-1117.193) (-1119.446) [-1116.182] * (-1116.445) [-1117.152] (-1119.420) (-1115.695) -- 0:00:44
287000 -- [-1115.083] (-1116.329) (-1117.914) (-1118.606) * [-1115.999] (-1120.575) (-1116.423) (-1115.751) -- 0:00:44
287500 -- [-1115.426] (-1115.748) (-1116.699) (-1117.946) * (-1118.658) (-1123.157) (-1118.409) [-1116.902] -- 0:00:44
288000 -- (-1116.276) (-1118.054) (-1121.018) [-1116.762] * (-1117.541) [-1117.761] (-1116.578) (-1117.031) -- 0:00:44
288500 -- (-1115.725) (-1117.255) (-1116.913) [-1118.185] * (-1118.476) (-1117.757) [-1117.751] (-1115.863) -- 0:00:44
289000 -- (-1117.819) (-1117.483) (-1121.694) [-1118.257] * [-1119.561] (-1116.290) (-1118.248) (-1117.106) -- 0:00:44
289500 -- [-1116.858] (-1115.404) (-1119.424) (-1118.924) * (-1118.424) [-1115.530] (-1116.297) (-1121.789) -- 0:00:44
290000 -- (-1117.527) [-1116.585] (-1121.689) (-1116.597) * (-1117.956) (-1118.848) [-1115.814] (-1122.855) -- 0:00:44
Average standard deviation of split frequencies: 0.010091
290500 -- (-1120.178) (-1117.039) (-1119.171) [-1119.191] * (-1120.331) [-1120.941] (-1117.318) (-1121.884) -- 0:00:43
291000 -- (-1117.897) (-1116.273) [-1121.308] (-1119.318) * [-1117.543] (-1116.166) (-1117.641) (-1116.100) -- 0:00:43
291500 -- (-1117.076) (-1115.296) [-1119.313] (-1117.473) * (-1118.877) (-1116.636) (-1117.819) [-1116.393] -- 0:00:43
292000 -- (-1116.562) (-1118.816) [-1118.560] (-1118.940) * (-1117.004) [-1118.024] (-1117.093) (-1115.608) -- 0:00:43
292500 -- [-1115.484] (-1115.057) (-1118.430) (-1118.482) * (-1117.230) [-1116.033] (-1115.707) (-1117.260) -- 0:00:43
293000 -- (-1116.714) [-1115.569] (-1117.631) (-1116.616) * (-1117.016) (-1116.166) (-1117.039) [-1118.378] -- 0:00:43
293500 -- (-1115.437) (-1119.016) (-1121.227) [-1116.865] * (-1115.884) (-1119.056) (-1118.019) [-1115.614] -- 0:00:43
294000 -- (-1119.485) (-1115.673) [-1117.851] (-1117.647) * (-1116.192) (-1115.411) (-1117.937) [-1116.029] -- 0:00:43
294500 -- (-1117.597) (-1115.900) (-1118.381) [-1117.638] * [-1115.102] (-1115.412) (-1117.959) (-1115.834) -- 0:00:43
295000 -- (-1116.984) [-1117.633] (-1114.938) (-1118.081) * (-1115.653) [-1116.412] (-1116.251) (-1115.493) -- 0:00:43
Average standard deviation of split frequencies: 0.009732
295500 -- (-1115.724) [-1115.021] (-1116.455) (-1120.482) * (-1117.227) (-1117.200) (-1116.660) [-1115.502] -- 0:00:42
296000 -- (-1115.509) (-1115.442) [-1115.310] (-1121.747) * (-1118.213) [-1116.160] (-1119.662) (-1117.473) -- 0:00:45
296500 -- (-1116.071) (-1118.704) [-1118.089] (-1117.894) * [-1115.018] (-1115.555) (-1119.293) (-1117.712) -- 0:00:45
297000 -- (-1117.157) [-1118.069] (-1117.095) (-1117.876) * [-1116.362] (-1115.160) (-1118.986) (-1116.896) -- 0:00:44
297500 -- (-1118.407) (-1116.920) [-1119.400] (-1120.541) * (-1116.213) (-1116.479) (-1122.212) [-1121.626] -- 0:00:44
298000 -- [-1117.576] (-1119.781) (-1118.798) (-1119.095) * (-1117.509) (-1117.899) (-1118.420) [-1122.465] -- 0:00:44
298500 -- (-1116.761) (-1120.198) (-1115.946) [-1118.557] * (-1120.684) (-1115.534) [-1119.275] (-1121.738) -- 0:00:44
299000 -- (-1117.377) (-1120.269) [-1117.199] (-1117.388) * (-1118.410) (-1115.799) [-1115.780] (-1118.647) -- 0:00:44
299500 -- (-1117.512) (-1119.797) (-1115.774) [-1118.252] * [-1117.902] (-1116.280) (-1116.042) (-1118.806) -- 0:00:44
300000 -- (-1117.854) (-1118.260) (-1115.750) [-1115.964] * (-1123.890) (-1116.510) [-1116.798] (-1116.952) -- 0:00:44
Average standard deviation of split frequencies: 0.009668
300500 -- [-1117.218] (-1117.210) (-1116.127) (-1115.698) * (-1121.116) (-1116.460) (-1118.269) [-1116.477] -- 0:00:44
301000 -- (-1119.176) (-1117.516) [-1116.694] (-1116.535) * [-1119.962] (-1116.336) (-1117.537) (-1116.893) -- 0:00:44
301500 -- (-1117.021) (-1117.690) (-1116.902) [-1116.647] * [-1117.790] (-1115.323) (-1120.291) (-1117.214) -- 0:00:44
302000 -- (-1116.761) (-1118.802) [-1115.609] (-1119.185) * (-1120.818) [-1115.257] (-1121.539) (-1117.358) -- 0:00:43
302500 -- (-1116.136) (-1115.896) (-1115.605) [-1117.071] * (-1118.591) [-1116.050] (-1116.875) (-1119.161) -- 0:00:43
303000 -- (-1116.931) (-1117.154) [-1115.330] (-1116.458) * (-1121.132) (-1115.255) [-1116.520] (-1116.286) -- 0:00:43
303500 -- (-1117.628) (-1116.540) [-1115.830] (-1117.664) * (-1115.528) (-1116.278) [-1116.843] (-1118.150) -- 0:00:43
304000 -- (-1116.774) [-1117.034] (-1117.187) (-1117.153) * (-1115.779) [-1117.825] (-1116.624) (-1118.981) -- 0:00:43
304500 -- (-1116.532) (-1117.934) (-1118.000) [-1115.684] * (-1116.438) (-1116.198) [-1118.626] (-1120.936) -- 0:00:43
305000 -- (-1116.862) [-1118.360] (-1120.247) (-1116.372) * (-1115.977) [-1116.782] (-1118.198) (-1119.186) -- 0:00:43
Average standard deviation of split frequencies: 0.008131
305500 -- (-1117.194) [-1116.738] (-1117.984) (-1119.276) * (-1116.745) [-1120.950] (-1118.372) (-1118.264) -- 0:00:43
306000 -- (-1116.533) [-1117.845] (-1121.341) (-1118.408) * (-1117.441) (-1115.726) [-1118.041] (-1117.593) -- 0:00:43
306500 -- (-1116.157) (-1116.003) [-1117.304] (-1120.087) * (-1116.669) (-1115.439) (-1117.825) [-1115.189] -- 0:00:42
307000 -- (-1116.382) [-1115.281] (-1116.814) (-1117.331) * (-1115.564) (-1117.413) (-1118.515) [-1115.512] -- 0:00:42
307500 -- (-1116.793) [-1115.279] (-1119.250) (-1117.331) * (-1116.581) (-1121.082) (-1119.869) [-1116.978] -- 0:00:42
308000 -- (-1116.331) (-1116.238) (-1116.946) [-1119.988] * (-1116.160) (-1117.702) (-1119.367) [-1116.170] -- 0:00:42
308500 -- [-1116.479] (-1120.772) (-1115.564) (-1121.140) * (-1116.248) (-1117.485) [-1116.273] (-1117.347) -- 0:00:42
309000 -- (-1117.746) (-1115.965) [-1115.102] (-1118.586) * (-1118.134) [-1116.293] (-1116.521) (-1117.808) -- 0:00:42
309500 -- (-1116.929) (-1117.216) (-1118.434) [-1118.678] * (-1116.432) (-1117.764) [-1116.248] (-1117.065) -- 0:00:42
310000 -- (-1116.964) (-1119.266) [-1115.350] (-1116.664) * [-1116.497] (-1119.170) (-1117.666) (-1118.479) -- 0:00:42
Average standard deviation of split frequencies: 0.007924
310500 -- (-1117.133) (-1116.859) (-1115.356) [-1116.828] * (-1116.464) (-1117.454) (-1116.401) [-1118.408] -- 0:00:42
311000 -- (-1120.062) (-1116.621) [-1115.200] (-1116.299) * (-1115.539) (-1116.358) (-1116.857) [-1115.569] -- 0:00:42
311500 -- (-1119.046) (-1115.893) [-1115.026] (-1117.378) * (-1116.238) (-1116.363) [-1115.674] (-1116.123) -- 0:00:41
312000 -- (-1121.466) [-1115.043] (-1115.170) (-1117.016) * (-1115.844) [-1118.903] (-1117.044) (-1115.297) -- 0:00:44
312500 -- [-1120.480] (-1115.101) (-1115.842) (-1121.069) * [-1115.814] (-1123.465) (-1116.626) (-1116.083) -- 0:00:44
313000 -- [-1117.072] (-1115.101) (-1115.767) (-1121.497) * [-1116.523] (-1121.678) (-1118.008) (-1117.656) -- 0:00:43
313500 -- (-1116.570) [-1120.508] (-1118.007) (-1122.585) * [-1115.801] (-1118.359) (-1117.816) (-1120.186) -- 0:00:43
314000 -- [-1116.158] (-1118.136) (-1117.984) (-1116.863) * [-1116.744] (-1115.144) (-1115.298) (-1116.496) -- 0:00:43
314500 -- (-1116.849) (-1117.071) [-1118.794] (-1116.183) * (-1115.987) (-1115.100) [-1116.177] (-1118.360) -- 0:00:43
315000 -- (-1116.987) (-1117.525) [-1117.680] (-1116.960) * (-1115.224) (-1117.702) [-1115.784] (-1116.278) -- 0:00:43
Average standard deviation of split frequencies: 0.007210
315500 -- (-1118.462) [-1116.195] (-1116.402) (-1116.836) * (-1117.329) [-1116.298] (-1117.995) (-1116.596) -- 0:00:43
316000 -- [-1118.437] (-1115.880) (-1116.587) (-1117.134) * (-1117.003) (-1116.754) (-1117.661) [-1116.652] -- 0:00:43
316500 -- (-1115.255) [-1115.153] (-1116.489) (-1119.447) * (-1115.641) (-1115.818) (-1117.542) [-1118.233] -- 0:00:43
317000 -- (-1116.067) (-1116.504) [-1122.925] (-1116.837) * (-1118.708) [-1117.468] (-1116.832) (-1119.446) -- 0:00:43
317500 -- (-1117.789) (-1115.903) [-1123.680] (-1117.417) * [-1117.130] (-1116.673) (-1116.157) (-1121.636) -- 0:00:42
318000 -- (-1118.467) [-1120.036] (-1119.185) (-1117.179) * [-1116.177] (-1116.872) (-1117.845) (-1120.756) -- 0:00:42
318500 -- [-1117.404] (-1116.248) (-1118.644) (-1118.177) * (-1119.074) (-1117.254) [-1119.408] (-1117.096) -- 0:00:42
319000 -- (-1123.539) (-1115.866) (-1117.356) [-1118.442] * (-1119.175) (-1122.502) (-1120.049) [-1115.843] -- 0:00:42
319500 -- [-1116.868] (-1115.613) (-1116.946) (-1117.830) * [-1116.415] (-1119.405) (-1123.883) (-1115.235) -- 0:00:42
320000 -- (-1117.677) [-1115.335] (-1116.565) (-1116.962) * (-1116.046) (-1118.712) (-1122.657) [-1115.235] -- 0:00:42
Average standard deviation of split frequencies: 0.007105
320500 -- (-1117.406) (-1115.529) [-1117.590] (-1119.815) * [-1115.287] (-1120.888) (-1116.432) (-1116.215) -- 0:00:42
321000 -- (-1117.720) (-1119.505) [-1115.638] (-1121.043) * (-1114.962) (-1117.595) (-1119.876) [-1115.807] -- 0:00:42
321500 -- [-1116.908] (-1116.907) (-1115.523) (-1116.959) * (-1117.293) (-1121.103) (-1119.213) [-1116.898] -- 0:00:42
322000 -- [-1118.959] (-1118.018) (-1126.278) (-1115.836) * (-1117.796) [-1120.893] (-1117.303) (-1118.102) -- 0:00:42
322500 -- (-1117.108) (-1117.992) [-1116.717] (-1117.498) * [-1117.931] (-1119.307) (-1118.467) (-1121.219) -- 0:00:42
323000 -- (-1117.259) (-1117.590) [-1115.964] (-1117.498) * (-1120.595) [-1119.853] (-1117.118) (-1118.395) -- 0:00:41
323500 -- (-1122.851) [-1118.174] (-1117.089) (-1117.498) * (-1122.353) [-1118.767] (-1115.958) (-1118.561) -- 0:00:41
324000 -- (-1126.970) (-1117.558) (-1118.273) [-1115.478] * (-1117.037) (-1119.053) (-1119.604) [-1117.014] -- 0:00:41
324500 -- (-1117.964) (-1117.150) [-1121.086] (-1116.546) * (-1117.412) [-1119.768] (-1120.470) (-1120.280) -- 0:00:41
325000 -- [-1116.296] (-1117.738) (-1119.719) (-1120.726) * [-1116.989] (-1116.681) (-1120.944) (-1120.217) -- 0:00:41
Average standard deviation of split frequencies: 0.007953
325500 -- (-1118.094) (-1118.003) [-1117.173] (-1121.564) * (-1118.277) (-1115.095) [-1117.257] (-1118.421) -- 0:00:41
326000 -- (-1115.644) [-1117.435] (-1115.801) (-1118.646) * (-1118.599) (-1116.136) [-1117.160] (-1122.738) -- 0:00:41
326500 -- (-1117.232) (-1117.350) [-1116.191] (-1115.578) * (-1124.853) [-1115.940] (-1117.157) (-1116.265) -- 0:00:41
327000 -- (-1117.211) [-1115.139] (-1117.868) (-1116.010) * (-1119.240) (-1116.860) [-1115.772] (-1116.662) -- 0:00:41
327500 -- [-1118.724] (-1115.906) (-1119.365) (-1115.784) * [-1115.746] (-1114.866) (-1120.669) (-1115.921) -- 0:00:41
328000 -- [-1117.320] (-1118.140) (-1117.401) (-1115.186) * (-1115.642) [-1115.384] (-1115.967) (-1115.814) -- 0:00:40
328500 -- [-1119.749] (-1115.741) (-1119.207) (-1117.834) * (-1116.466) [-1115.943] (-1116.614) (-1116.287) -- 0:00:42
329000 -- (-1117.518) (-1116.480) (-1118.729) [-1117.981] * (-1116.465) [-1116.895] (-1115.827) (-1115.094) -- 0:00:42
329500 -- (-1117.336) [-1115.587] (-1117.448) (-1119.736) * (-1116.685) [-1116.643] (-1115.412) (-1115.675) -- 0:00:42
330000 -- (-1120.653) [-1116.007] (-1119.438) (-1116.534) * [-1118.380] (-1114.948) (-1115.710) (-1116.119) -- 0:00:42
Average standard deviation of split frequencies: 0.007128
330500 -- (-1118.488) [-1115.531] (-1119.533) (-1118.327) * (-1118.741) (-1116.117) [-1116.157] (-1116.545) -- 0:00:42
331000 -- (-1116.564) (-1116.082) [-1119.100] (-1116.914) * (-1115.509) (-1117.927) (-1116.753) [-1117.290] -- 0:00:42
331500 -- (-1116.868) [-1116.539] (-1118.865) (-1116.965) * [-1115.646] (-1117.096) (-1118.402) (-1116.596) -- 0:00:42
332000 -- (-1115.777) (-1117.461) [-1115.852] (-1118.939) * [-1116.572] (-1116.611) (-1115.519) (-1117.356) -- 0:00:42
332500 -- (-1115.205) [-1116.118] (-1122.990) (-1116.869) * (-1115.485) [-1115.885] (-1118.098) (-1120.663) -- 0:00:42
333000 -- (-1115.899) (-1115.532) [-1124.585] (-1117.101) * (-1114.919) [-1117.626] (-1117.100) (-1117.620) -- 0:00:42
333500 -- (-1117.378) (-1116.606) (-1118.316) [-1115.552] * [-1114.986] (-1116.685) (-1117.682) (-1115.144) -- 0:00:41
334000 -- (-1116.159) (-1115.829) [-1115.440] (-1117.582) * (-1114.999) (-1117.336) (-1118.197) [-1118.457] -- 0:00:41
334500 -- (-1115.376) [-1120.975] (-1117.253) (-1119.435) * (-1115.879) [-1117.539] (-1115.913) (-1118.551) -- 0:00:41
335000 -- (-1116.667) (-1118.377) [-1116.557] (-1116.683) * (-1130.089) (-1117.236) [-1115.313] (-1117.343) -- 0:00:41
Average standard deviation of split frequencies: 0.007561
335500 -- (-1117.778) (-1116.811) [-1117.326] (-1116.463) * [-1117.287] (-1117.610) (-1115.715) (-1117.249) -- 0:00:41
336000 -- (-1116.943) [-1115.840] (-1120.051) (-1118.035) * (-1115.686) (-1120.096) (-1117.496) [-1119.098] -- 0:00:41
336500 -- (-1118.956) (-1115.970) [-1118.163] (-1116.040) * (-1115.011) (-1120.463) [-1119.286] (-1117.647) -- 0:00:41
337000 -- (-1124.473) (-1116.148) [-1116.186] (-1115.900) * [-1115.011] (-1117.668) (-1118.155) (-1117.379) -- 0:00:41
337500 -- [-1118.125] (-1116.939) (-1121.468) (-1118.440) * (-1115.354) (-1116.591) [-1115.276] (-1119.552) -- 0:00:41
338000 -- (-1115.299) (-1115.914) (-1119.684) [-1117.218] * (-1116.942) [-1118.427] (-1116.936) (-1115.430) -- 0:00:41
338500 -- (-1116.293) (-1115.452) (-1121.714) [-1121.385] * (-1115.290) (-1117.667) [-1118.447] (-1119.180) -- 0:00:41
339000 -- (-1115.067) (-1116.415) [-1118.988] (-1121.028) * (-1117.301) (-1116.247) [-1117.869] (-1119.050) -- 0:00:40
339500 -- (-1119.440) (-1117.700) [-1115.620] (-1118.301) * [-1115.640] (-1116.446) (-1118.838) (-1119.048) -- 0:00:40
340000 -- (-1116.654) [-1120.631] (-1115.973) (-1117.551) * (-1115.280) [-1120.180] (-1116.590) (-1116.023) -- 0:00:40
Average standard deviation of split frequencies: 0.007489
340500 -- (-1117.195) [-1120.653] (-1114.970) (-1117.650) * [-1116.877] (-1119.561) (-1116.233) (-1119.368) -- 0:00:40
341000 -- (-1116.745) (-1117.462) [-1117.253] (-1119.064) * (-1116.930) (-1117.766) [-1117.572] (-1117.254) -- 0:00:40
341500 -- (-1117.363) (-1117.464) [-1120.629] (-1116.904) * (-1124.520) [-1118.929] (-1116.905) (-1116.554) -- 0:00:40
342000 -- [-1117.323] (-1117.060) (-1116.190) (-1116.164) * (-1118.836) (-1120.098) [-1115.725] (-1116.870) -- 0:00:40
342500 -- (-1116.465) (-1116.207) (-1115.975) [-1118.710] * (-1118.621) (-1118.445) (-1115.334) [-1115.001] -- 0:00:40
343000 -- [-1117.489] (-1116.355) (-1119.956) (-1120.566) * (-1115.677) (-1119.088) [-1115.546] (-1115.037) -- 0:00:40
343500 -- [-1120.445] (-1117.163) (-1117.508) (-1118.183) * (-1116.504) (-1120.376) (-1117.167) [-1117.318] -- 0:00:40
344000 -- (-1122.342) [-1118.715] (-1115.310) (-1115.732) * (-1116.385) (-1122.781) [-1115.355] (-1119.852) -- 0:00:40
344500 -- (-1116.573) (-1118.541) (-1120.265) [-1116.480] * [-1116.345] (-1118.999) (-1117.515) (-1121.809) -- 0:00:39
345000 -- [-1116.432] (-1121.095) (-1117.401) (-1118.126) * (-1115.959) (-1115.239) [-1117.369] (-1116.025) -- 0:00:41
Average standard deviation of split frequencies: 0.008629
345500 -- (-1115.365) [-1120.817] (-1117.549) (-1118.421) * (-1116.211) [-1119.141] (-1119.799) (-1115.172) -- 0:00:41
346000 -- [-1115.677] (-1117.815) (-1115.874) (-1117.797) * [-1116.017] (-1115.636) (-1121.165) (-1114.965) -- 0:00:41
346500 -- (-1117.239) (-1120.085) [-1116.060] (-1116.461) * (-1118.374) (-1115.318) [-1118.082] (-1115.404) -- 0:00:41
347000 -- [-1115.895] (-1126.497) (-1116.923) (-1116.585) * (-1121.305) [-1115.415] (-1116.411) (-1116.604) -- 0:00:41
347500 -- [-1117.330] (-1120.814) (-1117.826) (-1116.912) * (-1121.158) (-1116.626) [-1116.234] (-1116.310) -- 0:00:41
348000 -- [-1116.773] (-1120.075) (-1117.613) (-1119.074) * (-1118.461) (-1116.635) (-1117.177) [-1115.550] -- 0:00:41
348500 -- (-1118.770) (-1117.226) (-1115.101) [-1116.514] * (-1116.976) (-1119.061) (-1117.536) [-1115.190] -- 0:00:41
349000 -- (-1117.102) [-1119.302] (-1116.110) (-1117.463) * (-1116.735) (-1116.985) (-1117.059) [-1115.632] -- 0:00:41
349500 -- (-1116.002) (-1117.735) (-1117.243) [-1115.691] * (-1119.632) (-1116.064) [-1115.958] (-1116.415) -- 0:00:40
350000 -- (-1117.456) [-1119.122] (-1117.106) (-1115.743) * (-1119.091) (-1117.118) (-1116.166) [-1117.018] -- 0:00:40
Average standard deviation of split frequencies: 0.008514
350500 -- (-1119.284) (-1118.182) (-1117.425) [-1116.596] * [-1119.261] (-1121.248) (-1117.726) (-1115.818) -- 0:00:40
351000 -- (-1118.032) [-1117.298] (-1116.059) (-1115.283) * (-1117.622) (-1117.749) [-1116.200] (-1116.967) -- 0:00:40
351500 -- [-1118.029] (-1118.694) (-1115.601) (-1119.896) * (-1118.129) (-1118.007) [-1115.809] (-1115.649) -- 0:00:40
352000 -- (-1117.012) [-1116.399] (-1115.822) (-1118.113) * (-1120.021) (-1115.194) (-1117.060) [-1115.868] -- 0:00:40
352500 -- (-1117.451) (-1117.845) (-1115.822) [-1116.672] * [-1120.785] (-1116.265) (-1116.877) (-1118.963) -- 0:00:40
353000 -- [-1116.232] (-1117.190) (-1115.527) (-1116.364) * [-1117.566] (-1116.706) (-1116.447) (-1124.845) -- 0:00:40
353500 -- (-1116.027) (-1118.959) (-1120.672) [-1117.240] * (-1116.722) (-1115.743) (-1115.960) [-1115.438] -- 0:00:40
354000 -- (-1116.671) (-1114.882) (-1118.391) [-1116.235] * (-1116.930) [-1117.425] (-1119.443) (-1118.469) -- 0:00:40
354500 -- (-1115.834) (-1116.475) (-1117.502) [-1115.801] * [-1115.738] (-1114.921) (-1116.209) (-1117.378) -- 0:00:40
355000 -- [-1115.230] (-1118.513) (-1115.225) (-1115.914) * (-1115.805) (-1119.707) [-1116.170] (-1115.936) -- 0:00:39
Average standard deviation of split frequencies: 0.008534
355500 -- [-1115.932] (-1118.409) (-1115.820) (-1119.262) * [-1118.866] (-1116.515) (-1115.524) (-1120.500) -- 0:00:39
356000 -- (-1115.655) (-1119.985) [-1117.511] (-1117.949) * [-1116.077] (-1119.482) (-1117.123) (-1117.334) -- 0:00:39
356500 -- [-1116.442] (-1118.668) (-1124.206) (-1117.755) * [-1116.335] (-1120.152) (-1118.468) (-1116.685) -- 0:00:39
357000 -- [-1117.595] (-1117.068) (-1119.329) (-1118.568) * (-1115.410) (-1116.325) [-1117.954] (-1116.761) -- 0:00:39
357500 -- (-1118.143) (-1115.698) (-1117.367) [-1119.674] * (-1116.373) (-1118.739) [-1119.230] (-1116.567) -- 0:00:39
358000 -- (-1116.776) (-1122.294) [-1115.867] (-1115.928) * [-1119.680] (-1117.728) (-1117.074) (-1116.637) -- 0:00:39
358500 -- (-1116.630) (-1117.770) [-1115.763] (-1120.779) * (-1121.465) [-1115.318] (-1116.457) (-1116.890) -- 0:00:39
359000 -- (-1118.291) [-1118.451] (-1116.124) (-1118.774) * [-1116.871] (-1116.008) (-1116.050) (-1117.265) -- 0:00:39
359500 -- (-1116.946) [-1117.485] (-1117.341) (-1118.165) * (-1116.750) [-1116.525] (-1115.828) (-1117.349) -- 0:00:39
360000 -- [-1115.623] (-1119.327) (-1115.550) (-1119.272) * (-1116.837) (-1119.071) [-1115.762] (-1118.947) -- 0:00:39
Average standard deviation of split frequencies: 0.008641
360500 -- [-1115.616] (-1120.065) (-1116.646) (-1120.448) * [-1116.525] (-1119.871) (-1115.942) (-1117.839) -- 0:00:39
361000 -- [-1116.809] (-1119.044) (-1117.168) (-1124.239) * (-1116.790) (-1121.408) [-1114.907] (-1116.423) -- 0:00:40
361500 -- (-1118.176) [-1115.078] (-1116.897) (-1116.989) * (-1116.590) (-1117.920) [-1115.040] (-1120.181) -- 0:00:40
362000 -- (-1116.301) [-1115.719] (-1116.989) (-1118.117) * (-1116.736) (-1118.613) (-1116.602) [-1116.246] -- 0:00:40
362500 -- (-1118.699) (-1119.384) (-1117.242) [-1118.119] * [-1118.500] (-1117.354) (-1118.932) (-1117.083) -- 0:00:40
363000 -- (-1116.312) (-1118.689) (-1116.785) [-1120.791] * (-1117.780) [-1116.517] (-1117.480) (-1117.073) -- 0:00:40
363500 -- (-1116.564) (-1118.068) (-1115.503) [-1115.661] * [-1120.809] (-1116.009) (-1119.780) (-1117.708) -- 0:00:40
364000 -- (-1118.648) [-1121.867] (-1115.115) (-1116.130) * (-1117.804) (-1115.354) (-1121.346) [-1120.822] -- 0:00:40
364500 -- (-1116.141) (-1117.915) [-1115.534] (-1120.726) * [-1120.322] (-1121.080) (-1119.113) (-1116.552) -- 0:00:40
365000 -- (-1116.293) (-1122.184) (-1115.705) [-1116.704] * (-1118.341) (-1119.077) (-1118.422) [-1115.891] -- 0:00:40
Average standard deviation of split frequencies: 0.007943
365500 -- (-1117.524) [-1120.136] (-1117.581) (-1115.068) * (-1116.255) [-1116.438] (-1117.550) (-1115.430) -- 0:00:39
366000 -- (-1121.087) (-1120.018) [-1115.489] (-1117.297) * [-1116.519] (-1117.642) (-1115.676) (-1117.016) -- 0:00:39
366500 -- (-1116.681) (-1118.172) (-1114.972) [-1116.836] * (-1118.257) [-1116.114] (-1115.751) (-1117.627) -- 0:00:39
367000 -- (-1116.537) (-1119.502) [-1117.596] (-1117.913) * (-1115.572) (-1117.879) [-1116.057] (-1117.728) -- 0:00:39
367500 -- (-1116.149) (-1117.450) [-1118.413] (-1117.912) * (-1116.501) (-1119.827) (-1117.918) [-1118.408] -- 0:00:39
368000 -- [-1117.511] (-1116.164) (-1116.382) (-1116.340) * (-1116.413) (-1122.803) (-1117.636) [-1116.810] -- 0:00:39
368500 -- (-1118.201) (-1118.505) (-1120.414) [-1115.195] * (-1116.350) [-1119.278] (-1117.625) (-1117.564) -- 0:00:39
369000 -- (-1116.661) [-1117.685] (-1120.542) (-1115.607) * (-1119.533) [-1117.467] (-1116.442) (-1119.258) -- 0:00:39
369500 -- (-1117.755) (-1121.129) (-1120.393) [-1117.261] * (-1116.858) [-1117.631] (-1118.098) (-1116.108) -- 0:00:39
370000 -- (-1120.242) [-1119.062] (-1125.533) (-1118.548) * (-1118.807) (-1118.960) (-1117.255) [-1116.443] -- 0:00:39
Average standard deviation of split frequencies: 0.008753
370500 -- (-1119.371) (-1115.944) (-1120.341) [-1117.832] * [-1116.886] (-1114.835) (-1117.762) (-1118.195) -- 0:00:39
371000 -- (-1118.631) (-1116.127) (-1116.551) [-1118.086] * (-1118.795) [-1115.306] (-1116.448) (-1119.031) -- 0:00:38
371500 -- [-1119.208] (-1115.522) (-1116.434) (-1115.545) * [-1115.812] (-1116.745) (-1116.922) (-1118.312) -- 0:00:38
372000 -- (-1117.199) (-1116.791) [-1117.142] (-1117.990) * (-1116.079) [-1115.775] (-1115.416) (-1120.050) -- 0:00:38
372500 -- (-1115.970) (-1116.396) (-1117.047) [-1119.595] * (-1116.711) [-1116.601] (-1123.565) (-1117.532) -- 0:00:38
373000 -- [-1117.310] (-1119.068) (-1116.699) (-1119.233) * [-1115.361] (-1116.386) (-1119.215) (-1115.372) -- 0:00:38
373500 -- (-1117.474) (-1117.154) (-1116.359) [-1117.637] * (-1118.521) (-1116.245) (-1120.588) [-1115.492] -- 0:00:38
374000 -- (-1117.943) (-1117.670) (-1117.278) [-1117.832] * (-1120.450) (-1116.793) (-1119.517) [-1117.118] -- 0:00:38
374500 -- (-1115.830) [-1118.053] (-1118.447) (-1120.186) * [-1119.255] (-1121.807) (-1117.612) (-1117.475) -- 0:00:38
375000 -- [-1116.590] (-1118.743) (-1117.705) (-1121.028) * [-1116.224] (-1120.475) (-1119.714) (-1115.767) -- 0:00:38
Average standard deviation of split frequencies: 0.008997
375500 -- (-1118.818) (-1116.816) [-1115.455] (-1115.375) * (-1116.660) (-1120.387) [-1115.827] (-1115.746) -- 0:00:38
376000 -- (-1116.558) [-1116.274] (-1117.855) (-1118.144) * (-1115.254) (-1117.932) [-1116.458] (-1119.819) -- 0:00:38
376500 -- (-1119.598) (-1118.561) [-1116.939] (-1118.013) * [-1116.769] (-1116.559) (-1116.324) (-1117.283) -- 0:00:38
377000 -- [-1117.655] (-1117.954) (-1117.699) (-1117.430) * (-1117.433) [-1116.459] (-1116.518) (-1119.593) -- 0:00:38
377500 -- [-1119.062] (-1117.271) (-1120.613) (-1117.508) * [-1116.194] (-1115.795) (-1117.876) (-1117.508) -- 0:00:39
378000 -- (-1119.219) (-1116.992) [-1117.287] (-1121.070) * (-1114.940) (-1117.177) [-1115.690] (-1115.174) -- 0:00:39
378500 -- (-1117.456) (-1118.819) (-1117.754) [-1118.719] * (-1116.003) [-1116.860] (-1121.503) (-1115.431) -- 0:00:39
379000 -- (-1117.935) (-1117.070) [-1116.125] (-1119.551) * (-1117.507) (-1116.411) (-1124.734) [-1118.449] -- 0:00:39
379500 -- (-1116.146) [-1116.297] (-1115.121) (-1119.285) * (-1117.019) [-1116.154] (-1123.256) (-1115.180) -- 0:00:39
380000 -- (-1116.585) [-1116.485] (-1115.764) (-1117.496) * (-1118.923) (-1116.066) (-1119.759) [-1115.834] -- 0:00:39
Average standard deviation of split frequencies: 0.008669
380500 -- (-1116.698) (-1117.503) [-1121.032] (-1117.419) * (-1116.319) (-1118.842) [-1118.498] (-1116.001) -- 0:00:39
381000 -- (-1116.431) (-1119.280) (-1116.058) [-1115.666] * [-1115.598] (-1117.591) (-1115.803) (-1116.809) -- 0:00:38
381500 -- (-1119.574) (-1117.398) [-1116.728] (-1115.485) * [-1115.784] (-1116.757) (-1119.275) (-1121.227) -- 0:00:38
382000 -- (-1117.121) [-1116.613] (-1116.575) (-1117.084) * (-1116.679) [-1116.664] (-1118.256) (-1117.563) -- 0:00:38
382500 -- (-1116.341) [-1116.434] (-1116.141) (-1115.491) * (-1116.914) (-1118.423) [-1120.581] (-1117.404) -- 0:00:38
383000 -- (-1115.092) (-1118.710) (-1119.084) [-1116.758] * (-1116.996) (-1117.017) (-1118.171) [-1119.700] -- 0:00:38
383500 -- (-1115.871) [-1119.349] (-1116.030) (-1116.704) * (-1117.014) [-1121.248] (-1118.015) (-1116.897) -- 0:00:38
384000 -- [-1116.672] (-1116.717) (-1116.525) (-1117.427) * (-1120.928) (-1122.567) (-1117.444) [-1117.170] -- 0:00:38
384500 -- [-1118.190] (-1115.041) (-1115.156) (-1116.992) * (-1118.212) (-1122.300) (-1116.502) [-1118.443] -- 0:00:38
385000 -- [-1115.823] (-1116.351) (-1115.084) (-1116.425) * (-1120.860) (-1126.314) (-1116.987) [-1119.154] -- 0:00:38
Average standard deviation of split frequencies: 0.008345
385500 -- [-1115.190] (-1116.587) (-1115.997) (-1117.326) * (-1119.744) (-1122.406) (-1116.757) [-1118.115] -- 0:00:38
386000 -- (-1115.490) [-1115.232] (-1123.740) (-1118.428) * (-1120.041) (-1119.127) [-1118.327] (-1116.331) -- 0:00:38
386500 -- (-1117.292) (-1117.480) (-1118.593) [-1117.766] * (-1118.727) (-1120.496) [-1116.707] (-1115.823) -- 0:00:38
387000 -- (-1117.905) (-1119.223) [-1117.514] (-1118.777) * (-1118.607) [-1119.334] (-1116.608) (-1120.797) -- 0:00:38
387500 -- (-1117.100) (-1116.554) (-1117.622) [-1116.314] * [-1118.670] (-1117.745) (-1116.221) (-1117.581) -- 0:00:37
388000 -- (-1117.839) (-1118.477) (-1117.671) [-1116.505] * (-1119.209) (-1116.855) [-1116.195] (-1115.675) -- 0:00:37
388500 -- [-1115.246] (-1115.807) (-1116.663) (-1117.746) * (-1117.305) (-1119.565) [-1115.185] (-1116.278) -- 0:00:37
389000 -- (-1117.284) (-1115.583) (-1117.059) [-1117.448] * (-1116.925) (-1120.699) [-1116.789] (-1117.263) -- 0:00:37
389500 -- (-1117.285) [-1115.310] (-1118.198) (-1117.735) * (-1117.115) (-1117.823) (-1117.697) [-1117.613] -- 0:00:37
390000 -- (-1117.663) (-1116.283) (-1116.843) [-1115.299] * (-1115.779) (-1118.857) [-1117.941] (-1117.509) -- 0:00:37
Average standard deviation of split frequencies: 0.008589
390500 -- (-1119.026) (-1117.631) [-1117.118] (-1115.792) * (-1115.525) [-1117.383] (-1117.217) (-1116.864) -- 0:00:37
391000 -- [-1119.956] (-1116.320) (-1116.728) (-1115.793) * (-1115.871) (-1122.410) [-1115.939] (-1118.748) -- 0:00:37
391500 -- (-1116.741) [-1115.828] (-1115.591) (-1117.374) * [-1115.217] (-1116.530) (-1117.175) (-1118.204) -- 0:00:37
392000 -- (-1115.115) [-1115.547] (-1117.421) (-1120.477) * (-1117.842) [-1118.624] (-1117.694) (-1117.159) -- 0:00:37
392500 -- (-1116.294) (-1115.701) [-1116.231] (-1116.959) * (-1119.281) [-1116.762] (-1117.274) (-1122.116) -- 0:00:37
393000 -- [-1116.722] (-1116.400) (-1117.724) (-1115.472) * (-1121.463) (-1115.206) [-1118.878] (-1120.112) -- 0:00:37
393500 -- (-1117.586) [-1117.026] (-1117.390) (-1115.292) * (-1117.778) (-1118.006) (-1116.580) [-1121.438] -- 0:00:38
394000 -- (-1118.957) [-1120.248] (-1116.739) (-1117.309) * (-1117.590) [-1117.655] (-1120.312) (-1120.237) -- 0:00:38
394500 -- (-1123.698) (-1117.317) [-1117.163] (-1117.607) * (-1116.923) [-1114.949] (-1117.246) (-1116.911) -- 0:00:38
395000 -- (-1121.663) [-1116.546] (-1115.718) (-1118.771) * (-1118.251) [-1117.209] (-1116.940) (-1117.013) -- 0:00:38
Average standard deviation of split frequencies: 0.008184
395500 -- (-1120.199) (-1122.543) [-1115.424] (-1120.520) * [-1117.618] (-1120.257) (-1116.298) (-1117.244) -- 0:00:38
396000 -- (-1118.493) (-1123.653) (-1117.700) [-1121.472] * (-1118.521) (-1116.191) (-1117.474) [-1120.618] -- 0:00:38
396500 -- (-1117.920) (-1120.047) (-1119.800) [-1115.563] * (-1120.672) (-1117.715) [-1117.183] (-1117.946) -- 0:00:38
397000 -- (-1117.917) (-1118.024) [-1115.624] (-1119.125) * (-1117.879) (-1115.657) (-1116.599) [-1118.505] -- 0:00:37
397500 -- (-1117.181) [-1117.770] (-1117.656) (-1117.726) * (-1115.018) [-1116.914] (-1116.775) (-1117.302) -- 0:00:37
398000 -- (-1118.176) (-1116.948) [-1115.444] (-1119.219) * (-1115.850) [-1118.449] (-1117.409) (-1122.866) -- 0:00:37
398500 -- (-1116.532) (-1116.341) (-1115.527) [-1115.707] * (-1117.747) (-1116.813) [-1117.397] (-1118.143) -- 0:00:37
399000 -- (-1119.172) (-1117.173) (-1116.327) [-1115.011] * (-1117.408) (-1115.175) [-1116.715] (-1115.903) -- 0:00:37
399500 -- (-1116.717) (-1117.507) [-1116.278] (-1116.271) * (-1117.628) [-1115.858] (-1116.075) (-1116.039) -- 0:00:37
400000 -- [-1120.153] (-1116.964) (-1115.611) (-1116.200) * (-1118.727) (-1118.302) (-1116.380) [-1116.257] -- 0:00:37
Average standard deviation of split frequencies: 0.008015
400500 -- (-1117.981) (-1115.459) (-1116.065) [-1117.759] * [-1115.892] (-1119.647) (-1118.032) (-1115.767) -- 0:00:37
401000 -- [-1116.654] (-1116.873) (-1116.749) (-1118.530) * (-1115.857) [-1119.065] (-1116.198) (-1118.182) -- 0:00:37
401500 -- (-1117.287) [-1119.592] (-1117.463) (-1116.313) * [-1115.866] (-1120.554) (-1120.633) (-1117.561) -- 0:00:37
402000 -- (-1116.889) (-1116.867) [-1118.454] (-1117.012) * (-1116.804) [-1116.832] (-1116.754) (-1117.894) -- 0:00:37
402500 -- (-1117.347) (-1115.397) (-1118.769) [-1117.392] * (-1116.890) [-1116.956] (-1122.267) (-1115.725) -- 0:00:37
403000 -- (-1116.922) (-1116.421) (-1123.591) [-1116.255] * (-1116.265) (-1115.718) [-1117.196] (-1116.643) -- 0:00:37
403500 -- (-1117.808) [-1118.328] (-1126.911) (-1116.250) * (-1118.067) (-1115.751) [-1120.721] (-1118.914) -- 0:00:36
404000 -- (-1117.403) (-1117.859) [-1116.523] (-1115.740) * (-1117.993) [-1116.985] (-1116.180) (-1121.365) -- 0:00:36
404500 -- (-1117.550) [-1117.127] (-1117.344) (-1120.748) * (-1119.030) (-1119.583) [-1116.770] (-1115.506) -- 0:00:36
405000 -- (-1116.010) [-1116.712] (-1121.387) (-1116.291) * (-1121.077) (-1116.045) [-1115.640] (-1115.316) -- 0:00:36
Average standard deviation of split frequencies: 0.008563
405500 -- (-1116.390) (-1116.081) (-1119.855) [-1117.060] * (-1119.154) (-1116.311) [-1115.754] (-1117.557) -- 0:00:36
406000 -- [-1115.719] (-1116.660) (-1119.681) (-1116.447) * (-1118.344) [-1115.862] (-1117.491) (-1119.051) -- 0:00:36
406500 -- [-1116.834] (-1119.542) (-1115.831) (-1115.950) * (-1118.762) (-1118.008) [-1115.384] (-1118.380) -- 0:00:36
407000 -- [-1116.577] (-1122.510) (-1117.628) (-1115.943) * (-1123.595) (-1118.928) (-1116.592) [-1118.302] -- 0:00:36
407500 -- (-1115.494) (-1120.066) (-1116.594) [-1115.500] * (-1116.404) (-1118.668) [-1115.551] (-1117.692) -- 0:00:36
408000 -- (-1115.882) (-1123.725) [-1117.591] (-1115.930) * (-1115.544) [-1116.883] (-1115.036) (-1116.008) -- 0:00:36
408500 -- [-1117.083] (-1120.086) (-1115.994) (-1117.284) * (-1117.822) (-1115.740) (-1116.768) [-1115.882] -- 0:00:36
409000 -- (-1116.999) (-1118.569) (-1116.035) [-1116.830] * (-1118.156) [-1115.194] (-1118.004) (-1116.247) -- 0:00:36
409500 -- (-1116.631) (-1117.523) (-1116.875) [-1116.857] * [-1116.373] (-1116.040) (-1115.631) (-1117.391) -- 0:00:37
410000 -- (-1115.607) [-1117.245] (-1119.459) (-1120.873) * (-1116.680) [-1119.177] (-1115.431) (-1115.995) -- 0:00:37
Average standard deviation of split frequencies: 0.008609
410500 -- (-1118.918) (-1115.341) [-1117.860] (-1115.421) * [-1117.746] (-1116.883) (-1115.996) (-1117.246) -- 0:00:37
411000 -- (-1120.235) [-1116.982] (-1116.867) (-1118.354) * (-1117.931) [-1116.779] (-1117.175) (-1118.499) -- 0:00:37
411500 -- (-1120.514) (-1115.061) [-1116.723] (-1118.099) * [-1116.970] (-1115.799) (-1116.104) (-1117.065) -- 0:00:37
412000 -- (-1118.964) (-1116.742) [-1116.356] (-1116.715) * [-1116.323] (-1115.847) (-1115.590) (-1117.050) -- 0:00:37
412500 -- (-1119.785) (-1118.935) [-1116.844] (-1116.922) * [-1115.804] (-1117.947) (-1122.224) (-1120.661) -- 0:00:37
413000 -- (-1116.742) [-1116.743] (-1118.055) (-1117.595) * (-1117.731) (-1122.734) [-1115.867] (-1119.491) -- 0:00:36
413500 -- (-1117.217) (-1116.046) [-1116.500] (-1116.051) * (-1115.249) [-1117.795] (-1117.269) (-1119.462) -- 0:00:36
414000 -- (-1114.963) (-1115.776) (-1116.197) [-1118.882] * (-1120.026) (-1119.119) (-1117.039) [-1115.912] -- 0:00:36
414500 -- (-1115.361) (-1119.695) [-1117.525] (-1116.735) * [-1121.151] (-1119.032) (-1119.589) (-1115.292) -- 0:00:36
415000 -- [-1115.726] (-1115.025) (-1116.906) (-1118.380) * [-1118.861] (-1118.216) (-1116.943) (-1116.049) -- 0:00:36
Average standard deviation of split frequencies: 0.009065
415500 -- (-1117.869) (-1117.100) [-1117.729] (-1115.680) * (-1118.612) (-1116.968) (-1120.365) [-1115.496] -- 0:00:36
416000 -- (-1115.203) [-1116.720] (-1117.191) (-1124.735) * (-1120.794) [-1118.065] (-1122.838) (-1114.918) -- 0:00:36
416500 -- [-1115.992] (-1117.609) (-1117.448) (-1116.313) * (-1116.814) (-1117.660) [-1117.855] (-1114.918) -- 0:00:36
417000 -- (-1115.667) (-1115.712) [-1117.818] (-1117.232) * (-1115.781) (-1116.982) [-1119.264] (-1115.606) -- 0:00:36
417500 -- (-1116.161) (-1119.044) (-1119.002) [-1116.291] * (-1117.266) (-1116.825) [-1116.613] (-1120.768) -- 0:00:36
418000 -- (-1116.280) [-1117.985] (-1118.473) (-1116.957) * (-1117.008) (-1116.571) (-1115.409) [-1117.063] -- 0:00:36
418500 -- [-1115.498] (-1120.356) (-1118.583) (-1118.990) * (-1116.083) [-1114.892] (-1115.264) (-1117.937) -- 0:00:36
419000 -- [-1115.109] (-1117.168) (-1116.235) (-1118.503) * (-1118.893) (-1116.754) (-1117.911) [-1115.754] -- 0:00:36
419500 -- (-1117.514) (-1116.741) (-1115.573) [-1120.033] * [-1117.466] (-1115.472) (-1119.116) (-1119.357) -- 0:00:35
420000 -- [-1115.490] (-1114.944) (-1115.741) (-1115.863) * (-1118.278) (-1117.054) [-1116.423] (-1119.012) -- 0:00:35
Average standard deviation of split frequencies: 0.009665
420500 -- (-1117.005) (-1117.916) [-1117.094] (-1116.100) * (-1118.778) [-1117.340] (-1116.341) (-1119.807) -- 0:00:35
421000 -- [-1117.554] (-1117.202) (-1117.709) (-1118.289) * [-1116.124] (-1118.972) (-1116.781) (-1117.525) -- 0:00:35
421500 -- (-1116.421) [-1116.702] (-1116.051) (-1119.421) * (-1116.401) [-1118.838] (-1116.430) (-1121.460) -- 0:00:35
422000 -- (-1117.133) (-1116.436) [-1114.981] (-1116.606) * (-1116.371) (-1117.958) (-1115.416) [-1120.713] -- 0:00:35
422500 -- [-1118.579] (-1117.781) (-1117.591) (-1119.961) * (-1115.675) (-1119.108) (-1117.304) [-1117.008] -- 0:00:35
423000 -- (-1119.153) [-1116.945] (-1120.004) (-1117.132) * (-1115.890) (-1118.760) (-1118.096) [-1119.167] -- 0:00:35
423500 -- [-1117.529] (-1117.930) (-1116.298) (-1116.321) * (-1118.341) (-1118.717) [-1117.450] (-1119.489) -- 0:00:35
424000 -- [-1116.554] (-1115.771) (-1118.874) (-1115.701) * (-1119.182) (-1117.566) [-1116.109] (-1115.404) -- 0:00:35
424500 -- [-1118.718] (-1116.086) (-1117.582) (-1121.839) * [-1117.708] (-1118.185) (-1116.079) (-1115.457) -- 0:00:35
425000 -- (-1116.123) [-1114.969] (-1118.544) (-1124.000) * (-1116.320) (-1117.664) [-1115.473] (-1115.566) -- 0:00:35
Average standard deviation of split frequencies: 0.009829
425500 -- [-1118.020] (-1117.308) (-1118.244) (-1121.034) * (-1116.299) (-1118.773) (-1116.181) [-1115.944] -- 0:00:35
426000 -- [-1117.622] (-1120.322) (-1116.826) (-1127.740) * (-1115.741) (-1118.863) (-1120.332) [-1116.086] -- 0:00:36
426500 -- (-1119.560) (-1118.293) [-1116.516] (-1123.525) * (-1118.232) [-1118.408] (-1116.861) (-1116.384) -- 0:00:36
427000 -- [-1117.086] (-1119.982) (-1117.743) (-1115.910) * (-1115.623) (-1117.523) (-1117.560) [-1117.282] -- 0:00:36
427500 -- (-1124.447) [-1116.613] (-1117.849) (-1115.798) * (-1117.225) (-1116.750) [-1117.539] (-1116.543) -- 0:00:36
428000 -- (-1118.974) [-1116.544] (-1116.511) (-1116.376) * (-1118.684) (-1120.910) [-1117.024] (-1117.305) -- 0:00:36
428500 -- [-1115.866] (-1116.887) (-1115.734) (-1115.832) * [-1115.948] (-1116.925) (-1118.930) (-1116.397) -- 0:00:36
429000 -- [-1116.995] (-1117.545) (-1116.851) (-1120.276) * (-1119.074) [-1115.956] (-1118.044) (-1117.734) -- 0:00:35
429500 -- [-1118.009] (-1118.788) (-1117.340) (-1122.067) * [-1117.218] (-1116.084) (-1116.818) (-1116.531) -- 0:00:35
430000 -- (-1117.954) (-1121.229) (-1117.016) [-1117.151] * [-1115.405] (-1117.392) (-1116.126) (-1115.819) -- 0:00:35
Average standard deviation of split frequencies: 0.010672
430500 -- (-1117.874) (-1117.899) [-1114.847] (-1119.252) * (-1115.508) [-1117.073] (-1117.267) (-1118.133) -- 0:00:35
431000 -- (-1118.760) [-1116.421] (-1116.487) (-1116.822) * (-1115.287) (-1116.711) [-1116.801] (-1114.991) -- 0:00:35
431500 -- (-1115.980) (-1116.529) (-1116.397) [-1116.308] * (-1115.739) [-1115.605] (-1117.720) (-1119.817) -- 0:00:35
432000 -- [-1117.170] (-1116.860) (-1123.055) (-1117.104) * (-1115.252) [-1116.127] (-1119.477) (-1122.673) -- 0:00:35
432500 -- (-1120.496) [-1116.103] (-1118.611) (-1117.163) * (-1118.942) (-1117.336) [-1120.131] (-1128.536) -- 0:00:35
433000 -- (-1118.617) (-1117.679) (-1122.730) [-1117.914] * (-1119.309) (-1118.130) [-1116.383] (-1119.400) -- 0:00:35
433500 -- [-1117.662] (-1124.280) (-1120.414) (-1118.695) * (-1115.880) (-1118.868) [-1116.771] (-1119.152) -- 0:00:35
434000 -- (-1117.332) [-1122.602] (-1123.176) (-1115.779) * (-1119.317) (-1117.339) [-1116.932] (-1117.176) -- 0:00:35
434500 -- (-1117.803) (-1121.933) (-1119.195) [-1116.654] * (-1117.404) [-1115.636] (-1116.817) (-1116.017) -- 0:00:35
435000 -- (-1116.596) (-1116.514) (-1120.538) [-1115.770] * (-1117.780) (-1115.605) [-1116.701] (-1115.902) -- 0:00:35
Average standard deviation of split frequencies: 0.011150
435500 -- (-1116.972) [-1116.177] (-1121.072) (-1117.469) * (-1118.318) [-1117.975] (-1116.607) (-1116.201) -- 0:00:34
436000 -- (-1120.826) [-1116.251] (-1126.942) (-1119.330) * [-1116.693] (-1117.143) (-1115.945) (-1118.122) -- 0:00:34
436500 -- (-1116.021) (-1122.355) [-1117.763] (-1118.092) * (-1116.337) [-1116.772] (-1117.857) (-1115.375) -- 0:00:34
437000 -- [-1116.494] (-1117.946) (-1116.456) (-1117.949) * (-1120.599) [-1118.296] (-1119.623) (-1121.822) -- 0:00:34
437500 -- [-1117.682] (-1117.020) (-1120.911) (-1119.148) * (-1115.935) (-1115.564) [-1119.919] (-1122.723) -- 0:00:34
438000 -- [-1116.962] (-1118.753) (-1123.189) (-1118.719) * (-1115.314) [-1116.796] (-1117.855) (-1121.778) -- 0:00:34
438500 -- (-1119.306) (-1115.747) (-1118.861) [-1115.746] * (-1115.474) (-1115.978) [-1117.425] (-1118.130) -- 0:00:34
439000 -- [-1117.620] (-1116.035) (-1116.768) (-1116.522) * (-1120.116) [-1116.256] (-1121.679) (-1118.775) -- 0:00:34
439500 -- (-1116.668) [-1117.503] (-1119.916) (-1120.896) * [-1115.705] (-1117.434) (-1116.266) (-1119.819) -- 0:00:34
440000 -- (-1120.969) [-1117.638] (-1119.300) (-1117.442) * [-1115.712] (-1116.154) (-1116.460) (-1116.492) -- 0:00:34
Average standard deviation of split frequencies: 0.011099
440500 -- (-1119.049) (-1117.223) (-1123.910) [-1119.383] * (-1116.109) (-1120.037) (-1116.874) [-1116.859] -- 0:00:34
441000 -- (-1117.298) (-1118.055) (-1118.582) [-1115.985] * [-1116.346] (-1119.066) (-1116.817) (-1116.524) -- 0:00:34
441500 -- (-1117.250) [-1117.262] (-1115.975) (-1115.745) * [-1117.072] (-1117.721) (-1118.770) (-1117.508) -- 0:00:34
442000 -- (-1116.878) (-1118.572) [-1118.537] (-1118.029) * (-1116.136) (-1118.071) (-1118.889) [-1116.345] -- 0:00:35
442500 -- (-1117.822) (-1116.695) [-1116.498] (-1117.898) * [-1117.614] (-1115.562) (-1123.833) (-1116.279) -- 0:00:35
443000 -- (-1117.934) (-1119.060) (-1115.436) [-1117.351] * (-1118.971) [-1115.509] (-1122.213) (-1118.559) -- 0:00:35
443500 -- (-1119.103) (-1118.765) [-1115.513] (-1115.503) * [-1119.267] (-1116.578) (-1115.873) (-1116.561) -- 0:00:35
444000 -- (-1119.791) (-1116.832) [-1116.824] (-1116.770) * (-1116.126) (-1116.322) [-1116.316] (-1116.627) -- 0:00:35
444500 -- (-1119.285) [-1115.545] (-1115.100) (-1119.198) * (-1116.966) (-1115.188) [-1116.739] (-1117.452) -- 0:00:34
445000 -- [-1118.788] (-1117.901) (-1116.957) (-1116.059) * (-1116.044) (-1118.294) [-1116.103] (-1116.830) -- 0:00:34
Average standard deviation of split frequencies: 0.010636
445500 -- (-1118.248) [-1115.591] (-1116.600) (-1116.613) * [-1117.001] (-1118.355) (-1116.550) (-1118.517) -- 0:00:34
446000 -- (-1118.244) [-1115.173] (-1116.398) (-1116.167) * (-1119.443) (-1117.101) [-1116.550] (-1118.050) -- 0:00:34
446500 -- [-1119.060] (-1116.775) (-1116.520) (-1116.849) * (-1116.229) (-1118.220) (-1115.394) [-1121.119] -- 0:00:34
447000 -- (-1116.093) [-1116.495] (-1118.839) (-1117.320) * (-1115.632) (-1121.675) (-1116.186) [-1116.250] -- 0:00:34
447500 -- [-1118.107] (-1118.255) (-1117.598) (-1119.200) * (-1120.106) [-1119.724] (-1116.988) (-1117.941) -- 0:00:34
448000 -- (-1118.732) (-1122.757) (-1116.124) [-1117.868] * (-1117.124) (-1115.249) [-1117.134] (-1118.545) -- 0:00:34
448500 -- [-1118.132] (-1116.164) (-1115.999) (-1116.439) * (-1120.449) (-1116.281) (-1117.555) [-1116.362] -- 0:00:34
449000 -- (-1120.640) (-1126.948) [-1119.344] (-1118.506) * (-1121.927) [-1117.513] (-1116.597) (-1115.315) -- 0:00:34
449500 -- (-1116.189) (-1118.724) [-1116.408] (-1118.012) * (-1121.863) (-1117.659) (-1116.396) [-1120.120] -- 0:00:34
450000 -- [-1120.075] (-1118.785) (-1116.140) (-1115.575) * [-1116.657] (-1121.292) (-1116.660) (-1117.870) -- 0:00:34
Average standard deviation of split frequencies: 0.009937
450500 -- [-1121.031] (-1119.726) (-1118.326) (-1116.133) * [-1116.149] (-1115.887) (-1117.172) (-1117.511) -- 0:00:34
451000 -- (-1119.140) (-1118.023) (-1120.906) [-1118.850] * (-1116.472) (-1116.275) [-1115.893] (-1117.088) -- 0:00:34
451500 -- [-1115.594] (-1116.470) (-1121.406) (-1117.287) * (-1121.105) [-1117.007] (-1115.625) (-1122.460) -- 0:00:34
452000 -- (-1118.539) (-1116.872) [-1117.901] (-1118.801) * (-1121.509) (-1119.716) (-1120.615) [-1118.860] -- 0:00:33
452500 -- [-1115.908] (-1115.274) (-1119.977) (-1120.293) * [-1119.050] (-1117.285) (-1115.791) (-1118.851) -- 0:00:33
453000 -- [-1116.518] (-1118.674) (-1118.219) (-1118.091) * [-1117.059] (-1115.377) (-1116.472) (-1119.182) -- 0:00:33
453500 -- (-1116.377) [-1118.876] (-1116.038) (-1118.960) * (-1122.461) [-1117.936] (-1117.963) (-1121.200) -- 0:00:33
454000 -- (-1117.775) (-1119.927) [-1117.899] (-1116.756) * (-1116.109) [-1120.332] (-1115.545) (-1118.700) -- 0:00:33
454500 -- (-1122.742) (-1118.366) (-1116.212) [-1116.090] * [-1116.123] (-1118.264) (-1116.567) (-1117.551) -- 0:00:33
455000 -- [-1117.255] (-1119.603) (-1119.181) (-1116.056) * (-1116.142) (-1117.305) (-1115.175) [-1118.037] -- 0:00:33
Average standard deviation of split frequencies: 0.010467
455500 -- (-1119.529) (-1116.133) [-1117.885] (-1116.064) * (-1116.407) (-1117.257) (-1115.388) [-1118.424] -- 0:00:33
456000 -- [-1117.911] (-1119.313) (-1115.763) (-1116.950) * (-1116.037) (-1115.674) [-1116.348] (-1117.913) -- 0:00:33
456500 -- [-1119.197] (-1121.025) (-1117.597) (-1118.236) * [-1121.448] (-1115.847) (-1122.721) (-1115.741) -- 0:00:33
457000 -- (-1120.910) (-1116.747) [-1116.202] (-1117.093) * [-1120.518] (-1115.582) (-1116.780) (-1115.435) -- 0:00:33
457500 -- (-1116.589) (-1117.834) (-1117.437) [-1115.721] * (-1116.469) [-1115.795] (-1117.947) (-1117.045) -- 0:00:33
458000 -- (-1116.889) (-1117.459) (-1117.069) [-1115.848] * [-1116.113] (-1117.622) (-1117.323) (-1117.753) -- 0:00:33
458500 -- (-1122.180) (-1118.079) (-1116.564) [-1115.079] * (-1116.612) [-1115.215] (-1117.304) (-1117.929) -- 0:00:34
459000 -- [-1116.763] (-1117.468) (-1117.954) (-1116.142) * (-1115.349) [-1115.983] (-1120.364) (-1118.814) -- 0:00:34
459500 -- (-1115.724) (-1115.793) [-1115.604] (-1116.157) * (-1115.932) [-1116.081] (-1117.840) (-1117.255) -- 0:00:34
460000 -- [-1118.729] (-1115.442) (-1115.498) (-1118.188) * (-1115.928) (-1118.448) (-1116.843) [-1117.328] -- 0:00:34
Average standard deviation of split frequencies: 0.010169
460500 -- (-1117.711) [-1118.316] (-1116.018) (-1115.812) * [-1115.700] (-1118.086) (-1117.999) (-1117.231) -- 0:00:33
461000 -- (-1116.482) (-1121.473) [-1115.342] (-1119.204) * (-1115.885) [-1117.329] (-1119.339) (-1119.487) -- 0:00:33
461500 -- [-1115.573] (-1116.934) (-1115.496) (-1119.153) * [-1115.920] (-1117.188) (-1117.030) (-1117.947) -- 0:00:33
462000 -- (-1116.755) (-1115.401) (-1114.974) [-1116.065] * (-1116.923) (-1116.961) [-1116.586] (-1117.768) -- 0:00:33
462500 -- (-1117.396) (-1115.880) (-1117.506) [-1115.326] * (-1117.055) [-1119.594] (-1117.826) (-1126.448) -- 0:00:33
463000 -- [-1118.680] (-1116.780) (-1119.645) (-1117.161) * [-1115.288] (-1121.122) (-1118.340) (-1120.753) -- 0:00:33
463500 -- [-1116.522] (-1119.493) (-1116.795) (-1118.844) * (-1115.715) (-1117.802) [-1118.501] (-1120.486) -- 0:00:33
464000 -- (-1115.737) [-1118.413] (-1115.537) (-1117.264) * (-1117.437) [-1117.223] (-1120.080) (-1123.632) -- 0:00:33
464500 -- (-1117.660) [-1116.429] (-1117.646) (-1115.028) * [-1116.215] (-1117.019) (-1116.528) (-1116.549) -- 0:00:33
465000 -- (-1118.066) (-1116.892) [-1116.910] (-1115.650) * (-1116.756) (-1117.287) [-1116.136] (-1118.014) -- 0:00:33
Average standard deviation of split frequencies: 0.010242
465500 -- (-1118.618) [-1120.579] (-1114.820) (-1117.623) * [-1119.722] (-1116.359) (-1118.713) (-1117.328) -- 0:00:33
466000 -- (-1117.757) (-1114.945) [-1115.588] (-1116.904) * (-1118.256) [-1117.109] (-1117.366) (-1118.415) -- 0:00:33
466500 -- (-1118.105) [-1115.491] (-1117.088) (-1115.445) * (-1117.657) (-1115.948) (-1116.302) [-1118.413] -- 0:00:33
467000 -- (-1118.785) [-1118.816] (-1118.351) (-1117.993) * (-1116.578) (-1117.618) (-1115.458) [-1116.873] -- 0:00:33
467500 -- (-1117.481) (-1116.734) (-1117.608) [-1117.939] * (-1115.985) [-1118.807] (-1118.789) (-1121.530) -- 0:00:33
468000 -- (-1118.598) (-1119.391) (-1117.259) [-1116.159] * (-1116.134) (-1115.558) (-1116.592) [-1117.864] -- 0:00:32
468500 -- [-1116.859] (-1117.103) (-1116.039) (-1117.648) * (-1117.206) (-1116.972) (-1116.634) [-1116.862] -- 0:00:32
469000 -- (-1115.605) (-1118.729) (-1117.666) [-1115.508] * (-1120.486) (-1116.321) [-1116.253] (-1116.824) -- 0:00:32
469500 -- [-1116.413] (-1116.501) (-1116.876) (-1118.140) * [-1117.227] (-1116.237) (-1117.864) (-1117.534) -- 0:00:32
470000 -- (-1117.018) (-1116.707) (-1117.346) [-1116.417] * [-1117.947] (-1116.292) (-1115.927) (-1115.775) -- 0:00:32
Average standard deviation of split frequencies: 0.010203
470500 -- [-1118.616] (-1116.576) (-1118.582) (-1116.840) * (-1115.697) (-1116.237) [-1122.464] (-1119.776) -- 0:00:32
471000 -- (-1118.067) (-1117.315) [-1116.604] (-1117.386) * (-1118.492) [-1116.354] (-1115.996) (-1116.623) -- 0:00:32
471500 -- (-1116.864) (-1117.861) [-1117.043] (-1116.399) * [-1116.603] (-1115.656) (-1116.466) (-1116.086) -- 0:00:32
472000 -- [-1115.698] (-1116.874) (-1120.580) (-1120.416) * [-1116.278] (-1115.889) (-1115.803) (-1120.272) -- 0:00:32
472500 -- (-1115.599) (-1118.188) (-1116.004) [-1116.830] * (-1116.280) (-1117.266) (-1115.520) [-1117.346] -- 0:00:32
473000 -- (-1115.728) (-1120.541) (-1117.361) [-1115.544] * [-1117.090] (-1116.370) (-1117.536) (-1115.518) -- 0:00:32
473500 -- (-1115.822) (-1116.151) (-1116.055) [-1115.731] * [-1115.377] (-1115.697) (-1117.706) (-1119.070) -- 0:00:32
474000 -- (-1115.592) [-1117.780] (-1116.777) (-1120.764) * (-1116.410) (-1116.648) [-1117.049] (-1118.117) -- 0:00:32
474500 -- (-1114.869) (-1117.479) [-1117.995] (-1116.485) * (-1119.942) (-1118.959) [-1115.847] (-1122.825) -- 0:00:33
475000 -- (-1114.872) [-1115.608] (-1123.217) (-1124.393) * (-1123.345) (-1116.793) (-1116.856) [-1116.707] -- 0:00:33
Average standard deviation of split frequencies: 0.010275
475500 -- [-1115.235] (-1116.688) (-1118.391) (-1121.247) * (-1116.732) [-1116.908] (-1115.942) (-1117.881) -- 0:00:33
476000 -- (-1115.186) (-1118.323) [-1117.639] (-1117.630) * (-1117.095) [-1117.903] (-1117.422) (-1119.185) -- 0:00:33
476500 -- (-1115.881) (-1122.804) [-1118.695] (-1119.875) * (-1115.675) [-1118.274] (-1119.898) (-1119.106) -- 0:00:32
477000 -- (-1116.162) (-1118.653) [-1118.327] (-1118.662) * (-1116.368) (-1118.004) (-1116.965) [-1119.014] -- 0:00:32
477500 -- (-1116.286) (-1120.356) (-1118.600) [-1118.354] * (-1123.293) (-1115.076) (-1115.932) [-1115.358] -- 0:00:32
478000 -- (-1117.832) [-1121.315] (-1120.083) (-1115.919) * (-1124.401) (-1115.841) [-1115.924] (-1115.288) -- 0:00:32
478500 -- [-1115.506] (-1122.365) (-1120.080) (-1119.016) * [-1115.798] (-1118.149) (-1116.929) (-1115.619) -- 0:00:32
479000 -- [-1115.813] (-1122.777) (-1117.194) (-1117.743) * (-1119.256) [-1117.303] (-1121.043) (-1119.542) -- 0:00:32
479500 -- (-1116.550) (-1117.853) (-1118.293) [-1116.514] * (-1117.185) (-1116.652) [-1121.297] (-1117.332) -- 0:00:32
480000 -- (-1117.934) (-1116.461) (-1115.421) [-1115.667] * (-1116.475) (-1118.055) (-1117.806) [-1118.765] -- 0:00:32
Average standard deviation of split frequencies: 0.009072
480500 -- (-1118.507) [-1115.749] (-1116.274) (-1119.951) * (-1117.350) (-1120.986) [-1117.325] (-1118.842) -- 0:00:32
481000 -- [-1119.497] (-1118.063) (-1122.868) (-1117.191) * (-1115.244) [-1120.778] (-1118.045) (-1117.351) -- 0:00:32
481500 -- (-1120.750) [-1120.158] (-1119.387) (-1116.013) * [-1116.099] (-1119.922) (-1123.533) (-1116.877) -- 0:00:32
482000 -- [-1119.466] (-1118.195) (-1116.313) (-1121.133) * (-1115.556) (-1118.460) (-1118.437) [-1115.902] -- 0:00:32
482500 -- (-1120.485) [-1116.217] (-1116.105) (-1115.528) * [-1116.830] (-1122.665) (-1121.639) (-1116.929) -- 0:00:32
483000 -- [-1118.122] (-1115.180) (-1117.272) (-1116.077) * [-1120.018] (-1117.319) (-1118.219) (-1118.934) -- 0:00:32
483500 -- (-1116.795) (-1115.314) [-1115.518] (-1117.518) * (-1119.406) (-1116.060) (-1117.871) [-1116.438] -- 0:00:32
484000 -- (-1116.619) [-1116.914] (-1117.472) (-1116.196) * (-1120.856) [-1116.653] (-1116.382) (-1121.420) -- 0:00:31
484500 -- [-1116.452] (-1115.852) (-1115.342) (-1117.479) * (-1115.548) (-1115.288) (-1115.961) [-1118.220] -- 0:00:31
485000 -- (-1115.602) [-1115.177] (-1115.389) (-1118.193) * [-1115.576] (-1118.245) (-1115.552) (-1117.339) -- 0:00:31
Average standard deviation of split frequencies: 0.009275
485500 -- (-1115.766) [-1115.452] (-1116.229) (-1116.484) * [-1115.342] (-1117.798) (-1118.252) (-1117.340) -- 0:00:31
486000 -- [-1116.107] (-1118.222) (-1115.643) (-1118.131) * [-1118.177] (-1119.408) (-1116.137) (-1119.261) -- 0:00:31
486500 -- (-1115.838) [-1115.757] (-1117.984) (-1117.582) * (-1119.267) [-1115.352] (-1124.783) (-1119.499) -- 0:00:31
487000 -- (-1120.246) (-1117.443) (-1118.813) [-1116.615] * (-1119.802) (-1116.793) [-1118.941] (-1116.891) -- 0:00:31
487500 -- [-1118.710] (-1114.807) (-1120.236) (-1117.417) * (-1116.669) (-1116.873) (-1118.117) [-1117.703] -- 0:00:31
488000 -- (-1117.235) (-1118.326) [-1117.921] (-1117.289) * (-1116.172) (-1119.449) [-1117.159] (-1115.664) -- 0:00:31
488500 -- (-1117.576) (-1119.518) [-1117.247] (-1117.643) * (-1116.138) (-1118.278) [-1115.235] (-1116.018) -- 0:00:31
489000 -- (-1115.666) [-1116.740] (-1117.143) (-1118.049) * (-1116.138) (-1115.494) (-1116.977) [-1118.166] -- 0:00:31
489500 -- (-1118.337) (-1115.240) (-1118.617) [-1116.364] * (-1117.165) (-1116.365) [-1117.981] (-1117.333) -- 0:00:31
490000 -- (-1118.942) [-1115.811] (-1118.826) (-1117.271) * (-1117.725) [-1120.835] (-1118.074) (-1118.273) -- 0:00:31
Average standard deviation of split frequencies: 0.009007
490500 -- (-1122.613) (-1116.649) (-1120.726) [-1117.700] * (-1117.122) [-1119.157] (-1123.185) (-1116.612) -- 0:00:32
491000 -- (-1118.774) (-1115.050) (-1115.944) [-1118.695] * [-1116.757] (-1119.526) (-1122.913) (-1116.692) -- 0:00:32
491500 -- [-1116.729] (-1118.618) (-1115.950) (-1116.415) * [-1117.650] (-1119.163) (-1118.139) (-1116.586) -- 0:00:32
492000 -- (-1117.810) (-1116.746) [-1117.538] (-1116.444) * (-1119.499) (-1117.008) (-1118.167) [-1117.163] -- 0:00:32
492500 -- (-1115.764) (-1118.213) [-1118.631] (-1115.566) * [-1118.088] (-1118.151) (-1117.484) (-1117.631) -- 0:00:31
493000 -- (-1115.854) (-1118.929) [-1122.569] (-1116.599) * [-1121.083] (-1115.820) (-1117.376) (-1115.821) -- 0:00:31
493500 -- (-1116.793) (-1119.736) [-1117.688] (-1117.591) * [-1119.282] (-1116.909) (-1116.514) (-1117.141) -- 0:00:31
494000 -- [-1115.769] (-1118.272) (-1118.913) (-1123.174) * (-1117.325) (-1123.992) [-1116.448] (-1117.508) -- 0:00:31
494500 -- (-1115.270) (-1120.131) (-1115.711) [-1120.851] * (-1117.695) (-1125.485) (-1115.212) [-1118.693] -- 0:00:31
495000 -- (-1115.456) (-1123.385) [-1117.672] (-1117.235) * (-1121.836) [-1116.249] (-1115.040) (-1118.213) -- 0:00:31
Average standard deviation of split frequencies: 0.008673
495500 -- [-1115.125] (-1116.181) (-1119.626) (-1115.920) * (-1119.441) (-1117.374) [-1116.699] (-1119.140) -- 0:00:31
496000 -- (-1115.154) (-1116.272) (-1119.967) [-1115.578] * (-1117.167) [-1115.317] (-1118.034) (-1118.300) -- 0:00:31
496500 -- (-1115.166) [-1116.537] (-1124.705) (-1122.220) * (-1117.766) [-1116.413] (-1118.198) (-1117.943) -- 0:00:31
497000 -- (-1116.981) (-1116.486) [-1117.102] (-1119.125) * [-1117.621] (-1116.949) (-1124.657) (-1119.164) -- 0:00:31
497500 -- (-1116.739) (-1119.409) (-1121.051) [-1117.277] * (-1115.830) (-1116.957) (-1117.378) [-1115.224] -- 0:00:31
498000 -- (-1117.105) (-1115.742) [-1116.274] (-1121.764) * [-1116.003] (-1118.106) (-1119.567) (-1115.133) -- 0:00:31
498500 -- (-1116.956) (-1115.715) [-1115.702] (-1118.075) * (-1115.877) (-1120.681) [-1116.776] (-1116.548) -- 0:00:31
499000 -- (-1115.299) [-1119.742] (-1116.842) (-1117.917) * (-1121.849) (-1116.464) (-1117.256) [-1116.363] -- 0:00:31
499500 -- (-1115.577) [-1119.219] (-1116.629) (-1115.778) * (-1125.229) (-1116.935) [-1117.326] (-1116.708) -- 0:00:31
500000 -- (-1118.934) [-1118.940] (-1115.794) (-1118.123) * (-1118.985) (-1121.561) [-1116.144] (-1115.587) -- 0:00:31
Average standard deviation of split frequencies: 0.008239
500500 -- [-1116.836] (-1119.250) (-1120.616) (-1117.641) * (-1116.681) (-1119.620) [-1117.539] (-1116.744) -- 0:00:30
501000 -- (-1115.789) (-1117.535) (-1116.923) [-1116.712] * (-1120.782) (-1116.796) (-1116.719) [-1116.483] -- 0:00:30
501500 -- [-1116.834] (-1119.751) (-1120.355) (-1116.673) * (-1123.084) (-1116.149) (-1116.034) [-1116.266] -- 0:00:30
502000 -- (-1117.545) (-1122.506) (-1117.737) [-1116.545] * (-1120.218) (-1115.105) (-1118.298) [-1117.605] -- 0:00:30
502500 -- (-1116.903) (-1115.469) [-1116.744] (-1117.205) * (-1119.151) (-1119.690) [-1117.096] (-1117.577) -- 0:00:30
503000 -- [-1116.618] (-1120.399) (-1116.749) (-1117.435) * (-1120.978) [-1117.298] (-1118.411) (-1116.445) -- 0:00:30
503500 -- [-1120.229] (-1115.498) (-1117.550) (-1116.537) * (-1122.256) [-1117.145] (-1119.433) (-1116.943) -- 0:00:30
504000 -- (-1117.161) (-1116.039) [-1118.556] (-1115.865) * (-1117.018) (-1118.777) [-1122.006] (-1118.369) -- 0:00:30
504500 -- (-1116.791) [-1118.571] (-1120.955) (-1115.165) * (-1116.863) (-1116.951) [-1118.322] (-1117.197) -- 0:00:30
505000 -- (-1119.714) (-1119.083) (-1116.278) [-1115.183] * (-1116.042) (-1118.500) (-1116.974) [-1116.364] -- 0:00:30
Average standard deviation of split frequencies: 0.008559
505500 -- [-1118.246] (-1117.963) (-1115.823) (-1115.178) * (-1115.923) [-1116.966] (-1118.086) (-1118.158) -- 0:00:30
506000 -- (-1117.784) (-1116.599) (-1117.053) [-1114.897] * (-1118.229) (-1116.012) [-1117.925] (-1115.869) -- 0:00:30
506500 -- (-1118.761) (-1117.863) (-1118.895) [-1114.886] * [-1117.013] (-1118.395) (-1119.924) (-1117.999) -- 0:00:30
507000 -- [-1117.911] (-1117.187) (-1118.509) (-1117.733) * (-1116.815) [-1116.666] (-1116.695) (-1120.791) -- 0:00:31
507500 -- (-1118.006) [-1115.716] (-1115.087) (-1118.324) * (-1116.086) (-1115.624) [-1120.658] (-1116.337) -- 0:00:31
508000 -- (-1121.590) (-1116.680) [-1116.917] (-1118.085) * [-1114.992] (-1116.657) (-1118.207) (-1117.977) -- 0:00:30
508500 -- [-1117.432] (-1117.274) (-1118.872) (-1116.869) * (-1114.993) [-1116.781] (-1118.563) (-1117.392) -- 0:00:30
509000 -- (-1116.259) (-1118.873) [-1116.802] (-1116.611) * [-1114.898] (-1115.943) (-1120.200) (-1119.127) -- 0:00:30
509500 -- (-1123.267) (-1117.416) (-1115.415) [-1116.087] * [-1116.636] (-1116.068) (-1122.802) (-1118.083) -- 0:00:30
510000 -- (-1118.227) (-1118.253) (-1116.096) [-1116.074] * (-1119.204) [-1116.951] (-1116.038) (-1117.423) -- 0:00:30
Average standard deviation of split frequencies: 0.008308
510500 -- [-1115.919] (-1120.457) (-1116.885) (-1116.813) * (-1115.676) (-1117.521) [-1116.038] (-1116.218) -- 0:00:30
511000 -- (-1115.795) (-1116.731) (-1119.272) [-1116.461] * (-1116.975) (-1123.906) (-1116.010) [-1117.761] -- 0:00:30
511500 -- (-1117.378) (-1119.802) (-1116.435) [-1116.164] * (-1118.046) (-1119.084) [-1116.183] (-1122.171) -- 0:00:30
512000 -- [-1115.628] (-1116.089) (-1117.942) (-1116.027) * (-1116.650) (-1116.875) [-1116.167] (-1118.568) -- 0:00:30
512500 -- (-1115.881) (-1116.357) [-1115.486] (-1116.815) * (-1115.658) (-1116.459) [-1115.575] (-1116.862) -- 0:00:30
513000 -- (-1115.348) [-1119.010] (-1119.026) (-1115.840) * (-1120.250) [-1118.354] (-1115.635) (-1117.977) -- 0:00:30
513500 -- (-1115.650) (-1119.499) [-1115.625] (-1116.240) * (-1119.733) (-1120.389) (-1116.213) [-1119.837] -- 0:00:30
514000 -- [-1119.281] (-1118.918) (-1119.055) (-1118.431) * (-1117.621) (-1116.586) (-1116.423) [-1116.607] -- 0:00:30
514500 -- (-1122.389) [-1119.471] (-1118.310) (-1117.383) * (-1116.331) (-1116.800) [-1118.608] (-1115.787) -- 0:00:30
515000 -- [-1116.593] (-1119.349) (-1118.322) (-1121.619) * [-1115.581] (-1118.119) (-1119.732) (-1117.529) -- 0:00:30
Average standard deviation of split frequencies: 0.007994
515500 -- (-1115.300) (-1117.229) [-1120.648] (-1116.536) * [-1119.379] (-1117.887) (-1116.549) (-1119.053) -- 0:00:30
516000 -- [-1117.956] (-1120.021) (-1120.880) (-1118.112) * (-1116.692) (-1118.258) [-1115.942] (-1119.461) -- 0:00:30
516500 -- (-1117.849) [-1116.736] (-1118.751) (-1118.567) * (-1117.996) [-1118.080] (-1116.993) (-1117.544) -- 0:00:29
517000 -- [-1116.370] (-1116.261) (-1116.016) (-1116.366) * (-1116.843) (-1117.312) (-1115.970) [-1116.154] -- 0:00:29
517500 -- [-1116.224] (-1120.533) (-1119.973) (-1117.994) * (-1116.479) (-1118.746) [-1115.891] (-1120.012) -- 0:00:29
518000 -- (-1117.446) (-1116.218) [-1117.761] (-1118.654) * (-1115.350) [-1121.066] (-1115.645) (-1119.783) -- 0:00:29
518500 -- [-1117.205] (-1117.443) (-1119.614) (-1117.945) * [-1115.685] (-1120.563) (-1120.022) (-1118.260) -- 0:00:29
519000 -- (-1119.998) (-1115.267) (-1118.721) [-1116.790] * (-1115.713) (-1117.103) [-1119.528] (-1116.327) -- 0:00:29
519500 -- (-1119.775) (-1121.898) (-1116.788) [-1117.525] * (-1117.260) [-1117.207] (-1115.526) (-1117.600) -- 0:00:29
520000 -- [-1116.308] (-1119.851) (-1117.341) (-1121.520) * (-1115.520) (-1115.661) [-1118.459] (-1117.980) -- 0:00:29
Average standard deviation of split frequencies: 0.007922
520500 -- (-1115.188) (-1118.825) (-1116.937) [-1118.782] * (-1115.506) [-1115.613] (-1116.672) (-1117.372) -- 0:00:29
521000 -- (-1115.798) (-1116.844) (-1116.195) [-1117.245] * (-1116.507) (-1117.625) [-1122.953] (-1122.469) -- 0:00:29
521500 -- (-1117.025) (-1116.723) (-1120.428) [-1117.263] * (-1116.777) (-1118.162) (-1116.254) [-1116.334] -- 0:00:29
522000 -- [-1117.031] (-1116.998) (-1119.991) (-1116.913) * [-1118.506] (-1118.237) (-1117.712) (-1117.863) -- 0:00:29
522500 -- [-1118.633] (-1119.648) (-1117.132) (-1114.910) * (-1117.635) (-1120.291) (-1116.777) [-1117.536] -- 0:00:29
523000 -- [-1115.526] (-1115.549) (-1115.939) (-1120.017) * [-1117.384] (-1116.804) (-1117.219) (-1117.166) -- 0:00:29
523500 -- (-1119.227) (-1115.915) (-1118.244) [-1115.550] * [-1118.809] (-1118.760) (-1116.328) (-1121.011) -- 0:00:30
524000 -- [-1116.344] (-1118.578) (-1116.624) (-1115.629) * (-1117.982) (-1117.095) [-1116.006] (-1115.989) -- 0:00:29
524500 -- (-1115.831) (-1117.961) (-1116.537) [-1115.328] * (-1122.102) [-1118.190] (-1116.982) (-1116.204) -- 0:00:29
525000 -- (-1116.017) (-1116.354) (-1117.878) [-1116.579] * (-1117.012) [-1117.841] (-1118.457) (-1119.275) -- 0:00:29
Average standard deviation of split frequencies: 0.008010
525500 -- [-1115.215] (-1117.522) (-1118.535) (-1118.350) * (-1116.800) [-1116.255] (-1116.960) (-1119.753) -- 0:00:29
526000 -- (-1115.373) (-1118.595) [-1119.014] (-1118.477) * [-1115.688] (-1117.008) (-1118.495) (-1115.964) -- 0:00:29
526500 -- (-1122.416) (-1117.254) [-1115.799] (-1116.350) * [-1115.884] (-1115.800) (-1115.726) (-1117.171) -- 0:00:29
527000 -- (-1121.971) [-1117.960] (-1116.836) (-1118.105) * (-1115.377) (-1115.695) [-1117.364] (-1116.265) -- 0:00:29
527500 -- (-1123.571) [-1117.063] (-1120.057) (-1119.379) * (-1115.826) (-1117.491) [-1116.442] (-1117.812) -- 0:00:29
528000 -- (-1115.827) (-1115.132) [-1117.071] (-1116.835) * (-1117.645) (-1116.543) (-1115.802) [-1116.032] -- 0:00:29
528500 -- (-1117.326) (-1115.753) (-1118.367) [-1118.645] * (-1119.632) (-1115.438) (-1115.736) [-1116.219] -- 0:00:29
529000 -- (-1116.476) [-1117.160] (-1115.067) (-1120.754) * (-1117.583) (-1118.071) (-1117.144) [-1115.885] -- 0:00:29
529500 -- (-1116.418) (-1118.230) (-1115.300) [-1119.684] * [-1117.883] (-1116.453) (-1118.011) (-1120.404) -- 0:00:29
530000 -- (-1115.913) (-1120.578) (-1115.300) [-1117.594] * (-1117.372) [-1116.364] (-1119.207) (-1116.813) -- 0:00:29
Average standard deviation of split frequencies: 0.008161
530500 -- (-1116.293) (-1121.369) [-1116.832] (-1122.644) * (-1122.850) (-1116.133) (-1120.206) [-1118.670] -- 0:00:29
531000 -- (-1118.259) (-1117.756) (-1118.228) [-1117.043] * (-1118.798) (-1116.679) (-1115.859) [-1117.130] -- 0:00:29
531500 -- (-1118.964) [-1117.195] (-1115.540) (-1119.257) * (-1117.871) [-1117.192] (-1115.222) (-1117.908) -- 0:00:29
532000 -- (-1121.108) (-1120.380) [-1115.432] (-1117.667) * (-1118.788) (-1120.794) [-1115.505] (-1117.109) -- 0:00:29
532500 -- [-1116.998] (-1118.272) (-1116.543) (-1117.051) * (-1118.386) (-1117.399) (-1115.516) [-1119.582] -- 0:00:28
533000 -- (-1118.950) [-1117.554] (-1117.816) (-1115.511) * (-1117.200) [-1117.011] (-1115.833) (-1116.418) -- 0:00:28
533500 -- (-1119.056) (-1116.620) (-1119.054) [-1115.346] * [-1116.964] (-1116.727) (-1117.487) (-1120.876) -- 0:00:28
534000 -- (-1117.299) (-1117.587) [-1117.664] (-1115.761) * (-1115.785) (-1118.886) [-1117.199] (-1118.187) -- 0:00:28
534500 -- (-1118.799) [-1116.149] (-1117.923) (-1115.072) * (-1115.884) (-1118.028) (-1118.233) [-1117.118] -- 0:00:28
535000 -- (-1117.272) (-1115.474) [-1118.418] (-1115.073) * [-1116.469] (-1119.078) (-1118.080) (-1116.303) -- 0:00:28
Average standard deviation of split frequencies: 0.008410
535500 -- (-1117.082) (-1115.826) [-1116.408] (-1116.348) * (-1116.887) (-1119.203) [-1119.172] (-1116.113) -- 0:00:28
536000 -- (-1120.209) (-1117.475) (-1116.032) [-1116.787] * [-1116.088] (-1117.285) (-1116.709) (-1116.884) -- 0:00:28
536500 -- (-1116.525) [-1117.949] (-1115.335) (-1123.422) * [-1120.528] (-1115.775) (-1116.280) (-1116.685) -- 0:00:28
537000 -- (-1116.285) (-1115.459) [-1116.630] (-1120.790) * (-1118.221) [-1115.723] (-1115.353) (-1116.737) -- 0:00:28
537500 -- (-1116.942) [-1116.867] (-1116.729) (-1120.481) * (-1121.556) [-1115.353] (-1115.378) (-1115.766) -- 0:00:28
538000 -- [-1116.511] (-1116.155) (-1116.808) (-1121.841) * (-1124.476) (-1115.886) (-1115.134) [-1117.355] -- 0:00:28
538500 -- [-1116.761] (-1116.830) (-1116.720) (-1116.356) * (-1119.301) (-1117.359) [-1117.235] (-1117.693) -- 0:00:28
539000 -- [-1119.051] (-1116.681) (-1116.212) (-1119.788) * (-1116.805) [-1116.203] (-1117.718) (-1115.818) -- 0:00:28
539500 -- (-1117.783) (-1115.681) (-1117.177) [-1117.944] * (-1116.917) (-1120.800) [-1117.088] (-1115.868) -- 0:00:28
540000 -- (-1118.165) (-1116.320) [-1117.185] (-1117.779) * (-1116.803) [-1118.691] (-1121.287) (-1116.051) -- 0:00:28
Average standard deviation of split frequencies: 0.007902
540500 -- (-1119.099) (-1116.151) [-1117.349] (-1115.930) * (-1121.278) [-1116.475] (-1120.862) (-1119.606) -- 0:00:28
541000 -- (-1118.729) (-1116.882) (-1116.459) [-1116.232] * (-1119.745) [-1116.690] (-1117.116) (-1115.713) -- 0:00:28
541500 -- (-1118.517) (-1116.548) (-1117.870) [-1120.552] * [-1120.162] (-1116.781) (-1117.800) (-1119.495) -- 0:00:28
542000 -- (-1119.731) (-1117.386) (-1117.983) [-1119.148] * (-1116.981) (-1116.889) [-1117.763] (-1117.560) -- 0:00:28
542500 -- (-1117.558) (-1117.302) [-1118.620] (-1118.028) * (-1116.471) [-1117.019] (-1124.604) (-1117.374) -- 0:00:28
543000 -- (-1118.542) (-1118.445) (-1120.259) [-1115.122] * (-1118.951) (-1116.840) (-1117.131) [-1124.325] -- 0:00:28
543500 -- (-1118.236) (-1117.478) (-1117.993) [-1117.213] * (-1116.233) (-1116.554) (-1117.801) [-1116.160] -- 0:00:28
544000 -- (-1116.523) (-1117.095) (-1118.209) [-1119.354] * (-1117.253) (-1118.447) (-1119.759) [-1116.345] -- 0:00:28
544500 -- (-1116.667) [-1116.040] (-1116.583) (-1116.129) * (-1115.110) (-1118.696) (-1117.852) [-1116.852] -- 0:00:28
545000 -- (-1116.282) (-1115.990) (-1124.092) [-1115.149] * (-1115.948) (-1118.353) (-1120.065) [-1118.596] -- 0:00:28
Average standard deviation of split frequencies: 0.007878
545500 -- (-1116.111) (-1118.060) (-1121.944) [-1115.385] * [-1115.655] (-1118.954) (-1116.162) (-1116.365) -- 0:00:28
546000 -- (-1115.551) (-1117.553) (-1118.238) [-1115.947] * (-1121.108) (-1121.543) [-1116.634] (-1120.445) -- 0:00:28
546500 -- [-1115.919] (-1117.151) (-1117.068) (-1116.234) * (-1117.424) (-1121.359) [-1117.302] (-1119.252) -- 0:00:28
547000 -- [-1116.146] (-1116.237) (-1117.182) (-1119.268) * (-1115.934) (-1115.443) (-1117.874) [-1116.083] -- 0:00:28
547500 -- (-1118.630) [-1119.565] (-1116.385) (-1118.189) * [-1116.863] (-1122.225) (-1117.025) (-1115.901) -- 0:00:28
548000 -- (-1116.853) [-1118.068] (-1117.019) (-1117.916) * (-1118.824) [-1119.232] (-1116.829) (-1115.409) -- 0:00:28
548500 -- (-1122.767) (-1116.462) (-1119.816) [-1117.499] * (-1118.182) (-1118.289) (-1116.264) [-1116.448] -- 0:00:27
549000 -- (-1121.203) (-1117.011) (-1116.581) [-1116.694] * [-1118.793] (-1117.532) (-1116.492) (-1116.856) -- 0:00:27
549500 -- (-1119.380) (-1115.041) (-1116.193) [-1119.202] * (-1116.880) (-1115.344) (-1117.522) [-1116.678] -- 0:00:27
550000 -- [-1117.834] (-1116.527) (-1117.931) (-1117.603) * [-1120.708] (-1116.333) (-1117.697) (-1116.035) -- 0:00:27
Average standard deviation of split frequencies: 0.007972
550500 -- (-1116.826) (-1116.105) [-1116.246] (-1117.499) * (-1123.038) (-1117.309) (-1117.796) [-1116.035] -- 0:00:27
551000 -- (-1120.317) [-1116.891] (-1115.896) (-1115.908) * (-1118.966) (-1119.591) [-1117.654] (-1115.739) -- 0:00:27
551500 -- [-1115.923] (-1116.355) (-1117.483) (-1117.664) * [-1115.286] (-1118.601) (-1118.528) (-1115.723) -- 0:00:27
552000 -- (-1117.584) (-1116.438) (-1118.911) [-1116.608] * [-1115.235] (-1117.997) (-1117.401) (-1115.064) -- 0:00:27
552500 -- [-1117.013] (-1118.276) (-1121.070) (-1115.120) * (-1115.878) (-1115.323) (-1116.607) [-1116.357] -- 0:00:27
553000 -- (-1116.944) (-1115.782) [-1117.981] (-1115.817) * [-1117.373] (-1115.317) (-1116.641) (-1117.497) -- 0:00:27
553500 -- (-1117.267) (-1115.788) [-1116.524] (-1120.342) * (-1116.320) (-1116.835) [-1118.749] (-1117.810) -- 0:00:27
554000 -- (-1118.052) (-1116.945) (-1123.159) [-1117.384] * [-1116.178] (-1116.869) (-1116.072) (-1118.262) -- 0:00:27
554500 -- (-1123.037) [-1119.865] (-1118.575) (-1117.114) * (-1116.148) [-1116.476] (-1116.317) (-1121.896) -- 0:00:27
555000 -- (-1115.096) (-1118.211) (-1117.879) [-1117.396] * (-1123.435) (-1117.691) (-1116.165) [-1120.294] -- 0:00:27
Average standard deviation of split frequencies: 0.007631
555500 -- [-1115.585] (-1116.439) (-1119.434) (-1120.524) * (-1119.775) [-1116.133] (-1116.656) (-1117.841) -- 0:00:27
556000 -- (-1116.503) (-1118.948) [-1116.431] (-1120.602) * [-1116.907] (-1120.594) (-1115.113) (-1121.382) -- 0:00:27
556500 -- (-1117.583) [-1117.071] (-1117.679) (-1117.643) * (-1115.842) [-1118.088] (-1115.620) (-1119.534) -- 0:00:27
557000 -- (-1115.896) (-1115.850) [-1116.673] (-1115.557) * (-1116.155) [-1119.207] (-1115.955) (-1116.151) -- 0:00:27
557500 -- (-1116.137) [-1115.312] (-1116.552) (-1117.523) * (-1116.747) (-1117.437) (-1119.320) [-1117.106] -- 0:00:27
558000 -- (-1116.096) (-1117.083) [-1115.478] (-1115.970) * (-1117.835) [-1115.228] (-1119.603) (-1115.674) -- 0:00:27
558500 -- (-1117.601) (-1117.708) [-1117.932] (-1116.006) * [-1115.081] (-1117.076) (-1120.770) (-1117.662) -- 0:00:27
559000 -- (-1120.915) [-1115.618] (-1118.896) (-1125.414) * (-1116.400) (-1116.102) (-1116.439) [-1115.952] -- 0:00:27
559500 -- [-1118.127] (-1116.450) (-1117.945) (-1118.925) * (-1119.431) [-1116.590] (-1118.185) (-1117.513) -- 0:00:27
560000 -- (-1119.245) (-1116.891) (-1116.554) [-1120.963] * (-1120.982) [-1120.686] (-1118.850) (-1118.453) -- 0:00:27
Average standard deviation of split frequencies: 0.007199
560500 -- (-1117.033) (-1117.238) [-1117.762] (-1117.701) * [-1117.155] (-1120.070) (-1120.167) (-1117.460) -- 0:00:27
561000 -- [-1117.950] (-1120.920) (-1122.058) (-1117.819) * (-1120.279) [-1116.374] (-1115.414) (-1117.652) -- 0:00:27
561500 -- (-1118.871) (-1115.962) [-1118.113] (-1116.373) * [-1118.919] (-1120.360) (-1115.620) (-1118.028) -- 0:00:27
562000 -- [-1118.584] (-1115.737) (-1119.487) (-1117.251) * (-1117.089) (-1116.920) [-1116.419] (-1118.485) -- 0:00:27
562500 -- (-1119.732) [-1116.995] (-1119.516) (-1118.462) * [-1115.560] (-1119.275) (-1116.048) (-1118.668) -- 0:00:27
563000 -- (-1120.032) [-1116.871] (-1118.695) (-1118.128) * (-1115.416) [-1117.175] (-1117.082) (-1117.301) -- 0:00:27
563500 -- (-1116.962) (-1119.458) [-1117.066] (-1117.979) * (-1116.905) (-1116.833) [-1116.112] (-1119.354) -- 0:00:27
564000 -- (-1121.350) [-1116.017] (-1115.186) (-1117.816) * (-1115.513) [-1120.588] (-1120.683) (-1119.869) -- 0:00:27
564500 -- (-1116.574) [-1115.693] (-1119.740) (-1117.119) * [-1115.221] (-1116.124) (-1116.732) (-1117.215) -- 0:00:27
565000 -- [-1115.815] (-1116.982) (-1122.046) (-1116.318) * [-1116.479] (-1118.850) (-1115.478) (-1116.651) -- 0:00:26
Average standard deviation of split frequencies: 0.006923
565500 -- (-1115.716) [-1115.577] (-1118.146) (-1117.380) * (-1116.904) (-1119.443) (-1116.738) [-1115.585] -- 0:00:26
566000 -- (-1116.087) (-1115.938) [-1115.569] (-1119.223) * [-1116.534] (-1116.919) (-1118.584) (-1122.996) -- 0:00:26
566500 -- [-1116.246] (-1117.068) (-1115.570) (-1117.320) * [-1117.126] (-1116.690) (-1117.360) (-1121.996) -- 0:00:26
567000 -- (-1116.138) [-1117.994] (-1115.477) (-1116.487) * (-1116.169) (-1119.415) [-1116.136] (-1117.858) -- 0:00:26
567500 -- (-1117.664) (-1116.229) (-1115.440) [-1117.770] * [-1120.071] (-1119.171) (-1118.124) (-1120.522) -- 0:00:26
568000 -- (-1119.006) (-1115.649) [-1117.617] (-1117.631) * (-1120.128) (-1117.399) (-1120.906) [-1117.247] -- 0:00:26
568500 -- [-1117.896] (-1115.632) (-1118.115) (-1117.478) * (-1117.237) (-1121.101) [-1116.131] (-1119.863) -- 0:00:26
569000 -- (-1119.503) [-1118.497] (-1116.314) (-1116.688) * [-1116.188] (-1114.964) (-1117.839) (-1118.285) -- 0:00:26
569500 -- (-1115.350) [-1116.543] (-1118.243) (-1119.862) * [-1115.482] (-1118.322) (-1115.174) (-1116.549) -- 0:00:26
570000 -- [-1122.905] (-1117.908) (-1116.549) (-1120.976) * (-1120.368) (-1117.144) [-1116.037] (-1115.953) -- 0:00:26
Average standard deviation of split frequencies: 0.006867
570500 -- (-1123.725) (-1120.320) [-1116.336] (-1119.590) * (-1121.488) (-1116.369) [-1117.532] (-1116.306) -- 0:00:26
571000 -- [-1119.574] (-1119.035) (-1116.421) (-1117.266) * (-1121.073) [-1117.020] (-1119.220) (-1117.190) -- 0:00:26
571500 -- [-1116.602] (-1115.941) (-1119.565) (-1119.302) * [-1117.323] (-1117.203) (-1118.919) (-1115.768) -- 0:00:26
572000 -- (-1117.347) (-1117.081) (-1117.085) [-1117.833] * (-1116.654) (-1118.209) (-1117.571) [-1119.162] -- 0:00:26
572500 -- (-1115.503) [-1118.068] (-1117.086) (-1117.525) * (-1117.013) [-1117.050] (-1116.534) (-1116.971) -- 0:00:26
573000 -- (-1115.111) (-1118.445) [-1117.410] (-1116.516) * (-1118.454) (-1116.668) [-1116.657] (-1115.626) -- 0:00:26
573500 -- (-1114.992) (-1118.333) (-1115.966) [-1116.164] * (-1117.390) (-1117.100) [-1119.656] (-1115.626) -- 0:00:26
574000 -- (-1117.473) (-1118.603) (-1116.028) [-1118.026] * (-1115.915) [-1118.076] (-1119.191) (-1115.626) -- 0:00:26
574500 -- (-1115.887) (-1119.175) [-1117.169] (-1117.274) * (-1118.210) [-1117.118] (-1120.002) (-1115.763) -- 0:00:26
575000 -- [-1115.789] (-1118.761) (-1117.084) (-1115.255) * (-1119.526) (-1116.333) (-1122.347) [-1115.771] -- 0:00:26
Average standard deviation of split frequencies: 0.007366
575500 -- (-1118.585) (-1116.221) (-1118.030) [-1117.606] * [-1115.393] (-1115.557) (-1116.122) (-1115.675) -- 0:00:26
576000 -- [-1117.848] (-1117.179) (-1118.271) (-1116.875) * (-1117.804) (-1116.932) [-1115.869] (-1115.986) -- 0:00:26
576500 -- (-1119.076) [-1115.447] (-1116.549) (-1116.504) * [-1116.044] (-1118.753) (-1115.208) (-1116.620) -- 0:00:26
577000 -- [-1118.128] (-1114.969) (-1117.795) (-1117.866) * (-1121.751) [-1116.333] (-1114.821) (-1115.787) -- 0:00:26
577500 -- [-1119.814] (-1115.147) (-1122.951) (-1116.482) * (-1118.879) (-1117.870) [-1117.958] (-1116.556) -- 0:00:26
578000 -- (-1116.859) (-1117.458) (-1115.875) [-1117.849] * (-1117.136) [-1115.419] (-1116.222) (-1118.436) -- 0:00:26
578500 -- (-1121.901) (-1122.633) (-1119.570) [-1116.604] * (-1116.948) (-1118.335) [-1116.476] (-1117.005) -- 0:00:26
579000 -- (-1115.198) (-1118.619) (-1118.177) [-1117.324] * (-1115.818) (-1119.766) [-1118.975] (-1115.935) -- 0:00:26
579500 -- (-1116.031) [-1116.169] (-1117.867) (-1119.826) * (-1116.029) [-1115.447] (-1120.890) (-1116.428) -- 0:00:26
580000 -- (-1117.256) (-1117.869) [-1116.102] (-1118.340) * (-1116.513) (-1118.728) (-1115.014) [-1120.066] -- 0:00:26
Average standard deviation of split frequencies: 0.007036
580500 -- [-1119.725] (-1115.151) (-1118.897) (-1116.275) * (-1117.117) (-1116.185) (-1116.746) [-1118.067] -- 0:00:26
581000 -- (-1120.505) [-1118.665] (-1117.182) (-1118.002) * (-1115.465) (-1116.359) (-1116.853) [-1116.988] -- 0:00:25
581500 -- (-1119.552) (-1115.575) [-1118.516] (-1118.657) * (-1115.273) [-1119.941] (-1115.039) (-1121.611) -- 0:00:25
582000 -- (-1121.717) (-1117.800) [-1121.026] (-1118.140) * [-1115.255] (-1117.765) (-1115.661) (-1117.331) -- 0:00:25
582500 -- (-1119.201) (-1118.151) (-1118.428) [-1116.510] * (-1119.758) (-1123.794) (-1115.396) [-1116.167] -- 0:00:25
583000 -- [-1115.214] (-1121.019) (-1116.788) (-1119.412) * (-1115.039) [-1120.331] (-1115.338) (-1116.045) -- 0:00:25
583500 -- (-1118.207) (-1123.288) (-1116.814) [-1117.099] * (-1117.781) (-1122.516) [-1116.487] (-1116.519) -- 0:00:25
584000 -- (-1115.927) [-1117.197] (-1116.221) (-1115.956) * (-1117.170) [-1118.135] (-1116.370) (-1116.795) -- 0:00:25
584500 -- (-1118.292) (-1118.270) [-1115.221] (-1118.050) * (-1117.945) (-1115.657) (-1117.786) [-1119.689] -- 0:00:25
585000 -- (-1117.845) (-1116.794) [-1115.958] (-1115.820) * (-1119.279) (-1115.658) [-1116.697] (-1118.649) -- 0:00:25
Average standard deviation of split frequencies: 0.006972
585500 -- (-1118.766) (-1116.466) (-1115.962) [-1116.538] * [-1119.468] (-1115.883) (-1116.650) (-1121.463) -- 0:00:25
586000 -- (-1116.545) (-1117.886) [-1115.674] (-1116.080) * [-1115.296] (-1118.871) (-1116.454) (-1126.568) -- 0:00:25
586500 -- (-1118.104) (-1116.998) [-1116.452] (-1115.613) * (-1118.394) [-1116.223] (-1116.093) (-1123.542) -- 0:00:25
587000 -- (-1118.939) (-1120.414) (-1119.585) [-1117.584] * (-1116.104) (-1116.223) (-1116.551) [-1118.756] -- 0:00:25
587500 -- (-1116.196) (-1123.198) [-1115.195] (-1116.713) * [-1115.091] (-1118.562) (-1119.711) (-1116.152) -- 0:00:25
588000 -- [-1116.736] (-1115.942) (-1115.413) (-1117.325) * (-1117.630) [-1118.191] (-1117.785) (-1118.191) -- 0:00:25
588500 -- [-1115.328] (-1116.586) (-1117.635) (-1118.809) * [-1118.558] (-1119.920) (-1117.783) (-1118.426) -- 0:00:25
589000 -- (-1115.360) (-1116.387) (-1118.747) [-1116.999] * (-1116.843) (-1122.003) (-1117.185) [-1117.307] -- 0:00:25
589500 -- (-1115.698) (-1116.695) [-1117.700] (-1122.874) * [-1116.336] (-1121.788) (-1115.935) (-1118.148) -- 0:00:25
590000 -- (-1117.370) (-1117.054) [-1115.889] (-1122.959) * [-1116.361] (-1117.464) (-1117.653) (-1116.368) -- 0:00:25
Average standard deviation of split frequencies: 0.007289
590500 -- (-1116.337) (-1117.347) [-1117.038] (-1116.158) * [-1116.417] (-1120.731) (-1118.077) (-1122.786) -- 0:00:25
591000 -- (-1115.876) (-1118.465) (-1115.773) [-1116.758] * (-1118.116) (-1120.640) (-1119.212) [-1120.891] -- 0:00:25
591500 -- (-1119.476) [-1123.838] (-1119.644) (-1117.360) * (-1125.793) (-1117.657) (-1116.927) [-1116.140] -- 0:00:25
592000 -- (-1116.225) (-1119.174) (-1116.619) [-1117.751] * (-1124.638) [-1117.321] (-1116.200) (-1116.962) -- 0:00:25
592500 -- [-1116.617] (-1116.705) (-1116.437) (-1117.737) * (-1122.430) (-1116.055) [-1115.753] (-1116.138) -- 0:00:25
593000 -- (-1116.628) (-1116.472) [-1116.493] (-1117.256) * (-1118.855) (-1117.309) (-1115.691) [-1116.098] -- 0:00:25
593500 -- (-1118.200) (-1116.769) [-1118.045] (-1117.314) * (-1128.373) (-1119.900) (-1120.076) [-1116.219] -- 0:00:25
594000 -- (-1118.745) (-1118.301) [-1115.747] (-1117.409) * (-1115.599) (-1116.544) [-1116.334] (-1116.028) -- 0:00:25
594500 -- (-1116.007) (-1117.988) (-1117.517) [-1116.350] * [-1118.364] (-1117.822) (-1116.592) (-1117.014) -- 0:00:25
595000 -- (-1116.535) (-1116.576) (-1118.745) [-1117.364] * (-1121.754) [-1115.532] (-1117.536) (-1118.268) -- 0:00:25
Average standard deviation of split frequencies: 0.007540
595500 -- (-1116.004) (-1116.092) (-1115.626) [-1119.362] * (-1123.356) [-1115.420] (-1116.379) (-1116.114) -- 0:00:25
596000 -- (-1115.793) (-1120.996) [-1116.638] (-1118.582) * (-1116.860) (-1116.831) [-1116.066] (-1117.621) -- 0:00:25
596500 -- [-1116.897] (-1118.166) (-1115.830) (-1122.121) * [-1115.241] (-1119.570) (-1116.916) (-1117.637) -- 0:00:25
597000 -- [-1116.198] (-1116.739) (-1115.830) (-1123.482) * (-1115.871) (-1117.083) (-1120.056) [-1117.333] -- 0:00:24
597500 -- (-1116.124) (-1117.904) (-1118.256) [-1118.203] * (-1117.736) (-1117.715) [-1120.056] (-1116.763) -- 0:00:24
598000 -- (-1117.054) (-1121.474) (-1115.890) [-1117.607] * (-1117.118) (-1119.625) (-1118.039) [-1115.342] -- 0:00:24
598500 -- [-1115.409] (-1120.360) (-1119.285) (-1116.037) * [-1116.329] (-1115.356) (-1120.449) (-1115.342) -- 0:00:24
599000 -- [-1117.654] (-1117.061) (-1121.253) (-1115.904) * (-1116.191) (-1120.072) (-1125.616) [-1115.776] -- 0:00:24
599500 -- (-1118.409) [-1115.722] (-1119.984) (-1125.902) * (-1118.340) (-1120.675) (-1125.797) [-1117.020] -- 0:00:24
600000 -- (-1118.012) [-1115.473] (-1116.428) (-1117.131) * (-1118.698) (-1116.062) (-1121.388) [-1116.706] -- 0:00:24
Average standard deviation of split frequencies: 0.007011
600500 -- (-1119.445) [-1115.454] (-1117.351) (-1119.954) * (-1116.646) (-1116.032) [-1119.458] (-1116.603) -- 0:00:24
601000 -- [-1116.544] (-1122.093) (-1115.692) (-1116.055) * (-1116.458) (-1117.401) [-1120.203] (-1117.241) -- 0:00:24
601500 -- (-1114.920) (-1116.108) (-1116.697) [-1115.003] * (-1116.465) (-1117.959) (-1119.644) [-1116.054] -- 0:00:24
602000 -- (-1116.918) (-1116.409) [-1116.644] (-1115.198) * (-1115.898) [-1115.287] (-1117.210) (-1115.856) -- 0:00:24
602500 -- (-1117.145) [-1115.206] (-1118.389) (-1117.775) * [-1122.787] (-1115.847) (-1122.949) (-1117.321) -- 0:00:24
603000 -- (-1115.545) (-1115.998) [-1119.329] (-1115.916) * (-1123.315) [-1117.603] (-1119.728) (-1115.895) -- 0:00:24
603500 -- (-1115.891) [-1115.266] (-1117.306) (-1116.561) * (-1122.473) (-1117.917) [-1117.881] (-1117.022) -- 0:00:24
604000 -- [-1116.535] (-1115.426) (-1115.644) (-1118.683) * (-1120.772) [-1116.070] (-1115.719) (-1115.967) -- 0:00:24
604500 -- (-1119.292) (-1115.776) (-1116.277) [-1115.963] * [-1117.404] (-1117.542) (-1115.767) (-1116.458) -- 0:00:24
605000 -- (-1117.009) (-1120.616) [-1120.084] (-1115.611) * (-1115.942) [-1117.599] (-1122.257) (-1115.862) -- 0:00:24
Average standard deviation of split frequencies: 0.006586
605500 -- (-1117.236) [-1119.052] (-1117.849) (-1121.355) * [-1116.533] (-1124.428) (-1117.024) (-1116.236) -- 0:00:24
606000 -- (-1122.761) [-1115.766] (-1116.091) (-1116.425) * (-1120.203) (-1119.014) [-1118.321] (-1116.922) -- 0:00:24
606500 -- [-1116.735] (-1115.942) (-1116.076) (-1117.020) * [-1117.613] (-1117.234) (-1117.358) (-1117.866) -- 0:00:24
607000 -- (-1119.088) (-1116.943) (-1114.988) [-1118.463] * [-1117.529] (-1115.676) (-1118.572) (-1116.573) -- 0:00:24
607500 -- (-1118.466) (-1115.967) [-1115.014] (-1117.387) * [-1116.782] (-1115.746) (-1117.062) (-1116.546) -- 0:00:24
608000 -- (-1116.039) [-1116.102] (-1115.027) (-1120.280) * (-1119.594) (-1117.296) [-1119.235] (-1115.150) -- 0:00:24
608500 -- (-1117.112) (-1117.042) (-1124.912) [-1119.172] * (-1115.849) [-1116.704] (-1116.095) (-1115.332) -- 0:00:24
609000 -- (-1116.168) (-1121.140) (-1119.975) [-1116.588] * (-1118.460) [-1116.714] (-1119.613) (-1116.815) -- 0:00:24
609500 -- (-1119.460) (-1116.964) (-1118.398) [-1116.039] * [-1117.626] (-1116.973) (-1116.045) (-1115.968) -- 0:00:24
610000 -- (-1115.467) [-1115.529] (-1117.966) (-1117.013) * (-1117.497) (-1116.335) (-1117.526) [-1116.083] -- 0:00:24
Average standard deviation of split frequencies: 0.006690
610500 -- (-1120.604) (-1116.405) [-1116.482] (-1116.276) * (-1118.596) (-1115.700) (-1120.154) [-1117.024] -- 0:00:24
611000 -- [-1117.333] (-1117.003) (-1117.553) (-1118.249) * [-1117.454] (-1116.864) (-1117.757) (-1116.385) -- 0:00:24
611500 -- (-1116.405) (-1120.594) (-1117.012) [-1117.014] * [-1116.729] (-1119.443) (-1119.440) (-1116.161) -- 0:00:24
612000 -- (-1115.732) (-1116.541) (-1115.987) [-1117.313] * [-1117.242] (-1116.377) (-1122.548) (-1116.112) -- 0:00:24
612500 -- [-1115.065] (-1118.260) (-1117.717) (-1119.692) * (-1115.764) (-1117.673) (-1119.816) [-1120.095] -- 0:00:24
613000 -- (-1117.333) [-1115.613] (-1116.676) (-1117.112) * (-1116.374) (-1116.268) [-1116.806] (-1117.500) -- 0:00:23
613500 -- (-1116.236) [-1115.542] (-1116.480) (-1119.608) * [-1115.366] (-1115.815) (-1117.075) (-1117.610) -- 0:00:23
614000 -- (-1117.797) (-1116.353) [-1119.785] (-1121.843) * (-1118.529) (-1117.474) (-1117.704) [-1119.778] -- 0:00:23
614500 -- (-1118.061) (-1118.488) [-1117.940] (-1122.088) * (-1117.108) (-1116.295) [-1118.162] (-1118.303) -- 0:00:23
615000 -- (-1118.424) (-1116.036) [-1116.145] (-1115.945) * (-1115.141) (-1119.509) (-1120.436) [-1118.567] -- 0:00:23
Average standard deviation of split frequencies: 0.007079
615500 -- (-1120.506) [-1115.435] (-1119.703) (-1117.539) * (-1116.090) [-1117.968] (-1120.509) (-1117.083) -- 0:00:23
616000 -- (-1121.119) (-1115.586) (-1116.349) [-1119.505] * (-1118.077) (-1120.272) (-1119.582) [-1118.686] -- 0:00:23
616500 -- (-1119.117) [-1115.225] (-1116.085) (-1117.240) * (-1116.034) [-1117.234] (-1117.082) (-1116.017) -- 0:00:23
617000 -- (-1120.485) (-1116.469) (-1115.876) [-1115.760] * [-1114.931] (-1118.859) (-1120.299) (-1118.971) -- 0:00:23
617500 -- [-1118.327] (-1117.302) (-1115.667) (-1117.917) * [-1114.884] (-1117.847) (-1115.896) (-1116.454) -- 0:00:23
618000 -- [-1116.521] (-1117.245) (-1118.596) (-1116.763) * (-1115.689) [-1121.519] (-1118.632) (-1120.059) -- 0:00:23
618500 -- (-1117.978) (-1119.508) (-1115.787) [-1116.337] * [-1115.558] (-1118.556) (-1119.947) (-1119.420) -- 0:00:23
619000 -- (-1117.131) (-1116.450) [-1117.407] (-1116.263) * (-1115.680) [-1117.624] (-1119.886) (-1119.366) -- 0:00:23
619500 -- (-1116.338) [-1115.866] (-1118.636) (-1117.028) * (-1115.224) (-1115.766) (-1122.996) [-1117.880] -- 0:00:23
620000 -- (-1116.529) (-1114.885) (-1117.762) [-1117.124] * (-1117.003) (-1116.364) [-1116.787] (-1117.372) -- 0:00:23
Average standard deviation of split frequencies: 0.007310
620500 -- (-1116.021) [-1119.528] (-1117.476) (-1118.515) * (-1116.455) [-1116.445] (-1115.962) (-1116.316) -- 0:00:23
621000 -- (-1115.984) [-1118.301] (-1115.401) (-1119.316) * (-1116.912) (-1117.373) (-1116.682) [-1118.801] -- 0:00:23
621500 -- (-1115.127) [-1120.636] (-1118.843) (-1117.698) * (-1117.062) (-1120.063) [-1119.102] (-1118.826) -- 0:00:23
622000 -- [-1116.023] (-1117.687) (-1115.627) (-1126.078) * (-1117.433) [-1116.118] (-1119.472) (-1120.461) -- 0:00:23
622500 -- (-1116.315) (-1117.742) [-1117.970] (-1118.560) * [-1117.656] (-1116.412) (-1115.357) (-1118.204) -- 0:00:23
623000 -- (-1115.171) (-1118.358) [-1115.725] (-1117.568) * (-1115.655) (-1116.204) [-1115.114] (-1120.687) -- 0:00:23
623500 -- (-1117.532) (-1120.792) (-1115.935) [-1118.327] * (-1117.253) (-1115.516) (-1115.116) [-1116.388] -- 0:00:23
624000 -- (-1115.099) (-1116.259) (-1115.990) [-1117.392] * (-1119.147) (-1116.124) [-1115.180] (-1115.778) -- 0:00:23
624500 -- [-1118.013] (-1116.716) (-1115.651) (-1115.971) * (-1117.074) [-1117.347] (-1115.919) (-1115.114) -- 0:00:23
625000 -- (-1116.430) (-1116.267) [-1118.069] (-1119.232) * (-1119.042) (-1116.756) [-1117.882] (-1120.718) -- 0:00:23
Average standard deviation of split frequencies: 0.007342
625500 -- (-1116.321) (-1116.262) (-1122.072) [-1119.462] * (-1116.869) (-1118.053) (-1115.333) [-1117.531] -- 0:00:23
626000 -- (-1115.190) (-1118.217) (-1119.016) [-1116.274] * (-1119.080) (-1115.881) (-1120.146) [-1115.410] -- 0:00:23
626500 -- (-1118.800) (-1116.972) (-1115.155) [-1116.739] * (-1117.948) [-1117.362] (-1118.737) (-1116.458) -- 0:00:23
627000 -- (-1117.624) (-1116.393) [-1115.721] (-1119.703) * [-1115.520] (-1116.500) (-1122.582) (-1115.793) -- 0:00:23
627500 -- [-1116.764] (-1118.006) (-1116.368) (-1124.034) * [-1116.789] (-1119.482) (-1115.614) (-1119.791) -- 0:00:23
628000 -- (-1121.462) [-1119.823] (-1117.785) (-1114.926) * [-1116.697] (-1119.151) (-1116.162) (-1119.538) -- 0:00:23
628500 -- (-1119.693) (-1117.428) (-1116.432) [-1115.481] * [-1116.139] (-1118.470) (-1118.848) (-1123.436) -- 0:00:23
629000 -- [-1115.899] (-1117.114) (-1116.226) (-1116.432) * (-1115.915) [-1117.166] (-1120.746) (-1121.700) -- 0:00:23
629500 -- (-1115.328) (-1116.933) [-1117.508] (-1117.581) * (-1117.646) (-1117.775) (-1120.166) [-1115.906] -- 0:00:22
630000 -- [-1117.056] (-1116.464) (-1116.461) (-1116.516) * (-1117.701) (-1117.676) [-1120.164] (-1116.873) -- 0:00:22
Average standard deviation of split frequencies: 0.007241
630500 -- (-1117.612) [-1116.094] (-1117.235) (-1116.647) * (-1119.560) (-1118.187) (-1116.565) [-1118.684] -- 0:00:22
631000 -- (-1116.223) (-1118.453) [-1118.259] (-1120.743) * [-1118.879] (-1118.371) (-1117.813) (-1119.521) -- 0:00:22
631500 -- (-1117.895) (-1119.120) (-1117.290) [-1121.432] * (-1119.679) (-1116.343) (-1119.696) [-1118.333] -- 0:00:22
632000 -- [-1115.655] (-1118.013) (-1125.328) (-1116.839) * [-1117.369] (-1117.938) (-1117.812) (-1116.843) -- 0:00:22
632500 -- [-1117.416] (-1116.709) (-1122.236) (-1118.820) * [-1116.583] (-1117.585) (-1119.806) (-1119.025) -- 0:00:22
633000 -- (-1118.410) (-1116.245) (-1115.491) [-1118.478] * [-1116.735] (-1117.200) (-1117.102) (-1115.475) -- 0:00:22
633500 -- (-1117.138) (-1119.885) (-1116.538) [-1117.452] * (-1116.615) [-1115.826] (-1115.569) (-1115.287) -- 0:00:22
634000 -- (-1116.129) [-1114.978] (-1118.847) (-1116.918) * [-1115.940] (-1115.967) (-1116.692) (-1118.674) -- 0:00:22
634500 -- [-1118.963] (-1120.881) (-1115.575) (-1116.456) * [-1118.209] (-1115.568) (-1118.809) (-1119.533) -- 0:00:22
635000 -- (-1116.132) (-1119.703) [-1115.730] (-1117.020) * (-1118.740) (-1117.022) (-1124.077) [-1116.562] -- 0:00:22
Average standard deviation of split frequencies: 0.007857
635500 -- [-1116.540] (-1121.539) (-1118.728) (-1124.510) * (-1121.417) [-1116.023] (-1120.477) (-1118.800) -- 0:00:22
636000 -- (-1118.303) (-1125.926) (-1118.413) [-1122.404] * (-1118.470) [-1115.119] (-1117.076) (-1116.919) -- 0:00:22
636500 -- (-1118.944) (-1118.324) [-1116.589] (-1116.491) * [-1118.147] (-1117.261) (-1120.696) (-1122.045) -- 0:00:22
637000 -- (-1116.054) (-1117.914) (-1115.882) [-1117.577] * (-1117.330) [-1116.525] (-1119.670) (-1118.124) -- 0:00:22
637500 -- (-1119.512) (-1115.837) (-1115.542) [-1115.172] * (-1117.462) (-1117.231) [-1118.059] (-1118.765) -- 0:00:22
638000 -- [-1119.835] (-1115.804) (-1115.501) (-1115.887) * (-1117.983) [-1117.140] (-1119.105) (-1117.883) -- 0:00:22
638500 -- (-1118.905) [-1116.791] (-1117.182) (-1118.240) * (-1117.420) (-1115.642) (-1119.228) [-1116.448] -- 0:00:22
639000 -- [-1118.572] (-1117.521) (-1116.343) (-1116.974) * (-1116.613) [-1117.337] (-1118.602) (-1116.443) -- 0:00:22
639500 -- (-1117.222) (-1118.067) (-1115.489) [-1116.572] * (-1120.322) (-1116.532) [-1115.547] (-1119.184) -- 0:00:22
640000 -- (-1117.045) [-1119.344] (-1116.617) (-1116.597) * (-1116.599) (-1116.539) (-1115.196) [-1115.278] -- 0:00:22
Average standard deviation of split frequencies: 0.007849
640500 -- [-1115.906] (-1121.889) (-1117.019) (-1115.420) * [-1117.330] (-1120.219) (-1118.789) (-1120.027) -- 0:00:22
641000 -- (-1116.024) (-1118.846) (-1115.147) [-1116.373] * (-1118.331) (-1118.581) [-1117.868] (-1117.158) -- 0:00:22
641500 -- (-1117.103) [-1116.140] (-1115.688) (-1118.139) * [-1118.992] (-1115.622) (-1117.115) (-1116.090) -- 0:00:22
642000 -- (-1118.184) (-1116.758) [-1115.340] (-1119.354) * [-1120.857] (-1116.482) (-1118.367) (-1115.893) -- 0:00:22
642500 -- (-1118.102) [-1116.322] (-1118.431) (-1120.340) * [-1116.005] (-1122.203) (-1118.167) (-1115.492) -- 0:00:22
643000 -- (-1116.785) [-1116.488] (-1116.055) (-1117.816) * (-1115.573) (-1117.894) [-1117.599] (-1117.705) -- 0:00:22
643500 -- (-1117.553) [-1117.172] (-1116.461) (-1120.663) * [-1120.542] (-1117.563) (-1118.046) (-1117.363) -- 0:00:22
644000 -- (-1116.290) (-1119.066) (-1118.208) [-1121.101] * [-1119.046] (-1120.228) (-1116.926) (-1116.753) -- 0:00:22
644500 -- (-1121.288) (-1117.129) (-1119.019) [-1117.105] * [-1116.271] (-1117.781) (-1115.681) (-1117.957) -- 0:00:22
645000 -- (-1117.084) [-1118.229] (-1120.201) (-1118.387) * [-1115.888] (-1116.579) (-1115.670) (-1118.153) -- 0:00:22
Average standard deviation of split frequencies: 0.007589
645500 -- [-1115.322] (-1117.333) (-1116.108) (-1116.863) * (-1117.047) (-1118.193) (-1115.927) [-1117.589] -- 0:00:21
646000 -- (-1118.779) (-1117.573) (-1115.750) [-1116.210] * (-1117.276) [-1121.932] (-1118.294) (-1119.506) -- 0:00:21
646500 -- (-1119.179) (-1119.178) [-1117.782] (-1119.330) * (-1117.606) (-1119.658) [-1116.510] (-1117.626) -- 0:00:21
647000 -- (-1116.601) [-1118.332] (-1115.843) (-1116.768) * (-1117.003) [-1118.798] (-1118.360) (-1118.287) -- 0:00:21
647500 -- (-1117.051) (-1118.969) (-1116.823) [-1117.052] * (-1115.634) (-1120.545) [-1116.494] (-1119.201) -- 0:00:21
648000 -- [-1116.136] (-1115.063) (-1117.838) (-1117.319) * [-1115.610] (-1118.860) (-1116.761) (-1116.363) -- 0:00:21
648500 -- [-1117.319] (-1115.117) (-1115.869) (-1116.500) * (-1116.301) (-1115.430) [-1117.363] (-1116.798) -- 0:00:21
649000 -- (-1119.545) (-1117.588) (-1115.775) [-1120.912] * (-1116.546) [-1117.444] (-1117.624) (-1115.111) -- 0:00:21
649500 -- (-1116.834) (-1117.422) (-1114.920) [-1119.808] * [-1116.380] (-1116.045) (-1117.406) (-1115.308) -- 0:00:21
650000 -- (-1118.675) [-1115.485] (-1115.970) (-1117.881) * (-1118.888) [-1115.507] (-1118.181) (-1115.204) -- 0:00:21
Average standard deviation of split frequencies: 0.007200
650500 -- (-1116.429) [-1115.617] (-1115.736) (-1115.624) * [-1116.325] (-1116.841) (-1116.479) (-1116.698) -- 0:00:21
651000 -- (-1117.982) (-1116.664) (-1117.027) [-1116.187] * (-1117.303) (-1117.343) (-1115.715) [-1116.243] -- 0:00:21
651500 -- [-1119.388] (-1119.059) (-1120.374) (-1117.914) * [-1115.214] (-1118.304) (-1116.500) (-1116.669) -- 0:00:21
652000 -- [-1122.131] (-1115.280) (-1119.775) (-1119.053) * (-1115.465) (-1120.703) [-1115.722] (-1120.590) -- 0:00:21
652500 -- (-1118.939) [-1115.846] (-1118.703) (-1118.659) * (-1120.235) (-1116.204) [-1115.609] (-1119.336) -- 0:00:21
653000 -- [-1118.711] (-1119.049) (-1121.300) (-1119.551) * (-1117.229) (-1115.237) [-1117.009] (-1117.217) -- 0:00:21
653500 -- (-1117.372) (-1119.455) (-1116.820) [-1117.648] * (-1117.436) (-1115.073) [-1117.031] (-1116.611) -- 0:00:21
654000 -- (-1117.381) (-1117.069) (-1118.492) [-1116.695] * [-1117.304] (-1116.512) (-1116.154) (-1118.525) -- 0:00:21
654500 -- (-1115.643) (-1117.018) [-1116.796] (-1117.666) * (-1118.237) (-1116.342) (-1117.580) [-1118.344] -- 0:00:21
655000 -- (-1120.010) (-1115.720) (-1118.814) [-1116.602] * (-1119.822) [-1117.490] (-1115.742) (-1121.298) -- 0:00:21
Average standard deviation of split frequencies: 0.007096
655500 -- (-1119.797) (-1116.634) (-1121.145) [-1115.487] * [-1116.285] (-1116.329) (-1116.451) (-1116.309) -- 0:00:21
656000 -- (-1115.885) (-1116.446) [-1120.061] (-1117.312) * [-1117.913] (-1116.932) (-1115.846) (-1116.934) -- 0:00:21
656500 -- (-1115.832) [-1115.935] (-1117.420) (-1118.250) * (-1115.630) [-1116.312] (-1117.284) (-1116.666) -- 0:00:21
657000 -- [-1116.531] (-1115.725) (-1116.747) (-1115.396) * (-1116.805) [-1119.454] (-1115.660) (-1115.528) -- 0:00:21
657500 -- (-1115.563) (-1115.732) [-1117.517] (-1120.735) * [-1116.120] (-1118.427) (-1116.997) (-1116.360) -- 0:00:21
658000 -- (-1119.078) [-1117.298] (-1117.394) (-1119.375) * (-1118.982) (-1118.359) [-1121.171] (-1115.838) -- 0:00:21
658500 -- [-1124.888] (-1118.747) (-1116.868) (-1117.282) * (-1118.685) [-1117.508] (-1116.702) (-1118.869) -- 0:00:21
659000 -- (-1116.523) (-1116.868) (-1123.398) [-1116.102] * [-1116.453] (-1119.693) (-1117.838) (-1116.371) -- 0:00:21
659500 -- (-1119.034) (-1118.119) [-1117.795] (-1116.899) * (-1116.115) [-1121.037] (-1116.475) (-1116.906) -- 0:00:21
660000 -- [-1117.386] (-1115.963) (-1116.341) (-1117.318) * (-1116.387) (-1116.987) [-1116.408] (-1115.829) -- 0:00:21
Average standard deviation of split frequencies: 0.006823
660500 -- [-1119.661] (-1122.704) (-1115.880) (-1119.589) * (-1116.891) (-1116.899) [-1116.982] (-1116.002) -- 0:00:21
661000 -- (-1121.304) (-1118.164) (-1117.373) [-1123.911] * [-1116.248] (-1115.970) (-1118.113) (-1117.930) -- 0:00:21
661500 -- (-1117.305) (-1117.812) (-1117.580) [-1116.799] * (-1118.646) [-1115.377] (-1116.082) (-1118.238) -- 0:00:20
662000 -- [-1117.049] (-1118.125) (-1120.310) (-1117.140) * (-1117.414) [-1116.857] (-1115.523) (-1120.403) -- 0:00:20
662500 -- (-1116.822) (-1119.020) (-1118.060) [-1118.876] * [-1116.492] (-1117.676) (-1118.513) (-1119.842) -- 0:00:20
663000 -- (-1117.014) (-1117.115) (-1117.658) [-1118.820] * [-1118.616] (-1115.996) (-1117.105) (-1115.652) -- 0:00:20
663500 -- (-1117.417) (-1117.789) [-1115.999] (-1119.560) * (-1119.991) (-1117.174) (-1118.882) [-1117.662] -- 0:00:20
664000 -- (-1118.348) (-1115.499) [-1116.097] (-1117.562) * (-1117.155) (-1117.115) [-1118.906] (-1116.803) -- 0:00:20
664500 -- [-1119.415] (-1117.539) (-1116.190) (-1118.889) * [-1116.856] (-1120.168) (-1116.380) (-1115.814) -- 0:00:20
665000 -- [-1119.140] (-1119.428) (-1118.196) (-1115.626) * (-1116.406) (-1117.196) [-1119.120] (-1118.499) -- 0:00:20
Average standard deviation of split frequencies: 0.006547
665500 -- (-1117.310) (-1119.054) [-1115.702] (-1118.237) * (-1116.180) [-1118.769] (-1120.196) (-1119.367) -- 0:00:20
666000 -- (-1116.483) (-1116.546) (-1116.859) [-1117.083] * (-1119.582) [-1116.394] (-1117.193) (-1117.475) -- 0:00:20
666500 -- (-1120.197) (-1117.317) [-1115.743] (-1116.592) * (-1117.018) [-1115.637] (-1117.235) (-1123.741) -- 0:00:20
667000 -- [-1119.441] (-1117.665) (-1119.213) (-1115.620) * (-1116.188) (-1116.327) (-1116.030) [-1117.444] -- 0:00:20
667500 -- (-1118.230) (-1119.242) (-1118.951) [-1116.594] * (-1118.977) (-1115.553) [-1117.991] (-1119.567) -- 0:00:20
668000 -- (-1118.061) (-1119.661) (-1118.801) [-1115.369] * (-1116.065) (-1115.035) [-1117.463] (-1116.656) -- 0:00:20
668500 -- (-1117.844) (-1116.236) (-1116.122) [-1115.780] * (-1115.618) [-1115.491] (-1119.918) (-1116.379) -- 0:00:20
669000 -- [-1116.633] (-1116.824) (-1116.435) (-1117.015) * (-1115.519) (-1120.512) [-1117.595] (-1118.902) -- 0:00:20
669500 -- (-1120.029) [-1120.100] (-1116.822) (-1116.663) * (-1115.372) (-1119.092) [-1115.660] (-1118.994) -- 0:00:20
670000 -- (-1120.640) (-1115.255) (-1117.976) [-1118.658] * (-1116.615) (-1117.684) (-1120.957) [-1118.211] -- 0:00:20
Average standard deviation of split frequencies: 0.006721
670500 -- [-1120.924] (-1121.691) (-1118.447) (-1119.417) * (-1115.861) (-1120.337) [-1115.794] (-1118.086) -- 0:00:20
671000 -- [-1115.433] (-1116.291) (-1118.151) (-1119.045) * (-1115.658) [-1116.845] (-1118.605) (-1117.187) -- 0:00:20
671500 -- (-1116.766) (-1118.454) (-1117.790) [-1116.650] * [-1120.824] (-1119.359) (-1118.195) (-1117.554) -- 0:00:20
672000 -- (-1123.671) (-1117.455) (-1116.551) [-1115.455] * (-1119.950) [-1121.340] (-1124.537) (-1118.354) -- 0:00:20
672500 -- (-1118.209) (-1116.751) [-1118.571] (-1114.967) * (-1115.664) (-1120.806) (-1115.981) [-1117.018] -- 0:00:20
673000 -- (-1118.796) [-1115.322] (-1118.459) (-1115.717) * [-1119.370] (-1115.896) (-1116.685) (-1118.427) -- 0:00:20
673500 -- [-1116.921] (-1116.473) (-1118.173) (-1116.179) * (-1117.052) [-1116.478] (-1116.024) (-1119.965) -- 0:00:20
674000 -- (-1116.968) (-1116.665) (-1119.511) [-1116.521] * (-1116.620) (-1118.071) (-1116.061) [-1115.738] -- 0:00:20
674500 -- (-1116.576) [-1116.050] (-1123.971) (-1119.721) * [-1116.738] (-1119.381) (-1115.772) (-1117.950) -- 0:00:20
675000 -- (-1117.909) (-1116.335) [-1117.584] (-1117.015) * (-1116.876) [-1115.708] (-1115.772) (-1120.914) -- 0:00:20
Average standard deviation of split frequencies: 0.006850
675500 -- (-1117.351) [-1119.519] (-1118.578) (-1119.682) * (-1116.669) (-1121.991) (-1118.242) [-1117.602] -- 0:00:20
676000 -- [-1117.163] (-1117.486) (-1118.344) (-1117.892) * (-1119.477) (-1117.179) [-1119.173] (-1118.411) -- 0:00:20
676500 -- (-1115.816) [-1118.319] (-1118.595) (-1121.344) * (-1121.182) (-1118.769) (-1117.108) [-1115.850] -- 0:00:20
677000 -- (-1117.064) [-1116.415] (-1116.465) (-1119.323) * [-1123.535] (-1122.362) (-1120.044) (-1115.776) -- 0:00:20
677500 -- (-1119.731) (-1118.499) [-1117.310] (-1116.625) * (-1117.552) (-1115.804) [-1116.692] (-1116.268) -- 0:00:19
678000 -- (-1123.075) (-1119.901) [-1115.926] (-1120.766) * (-1119.518) (-1115.872) (-1117.550) [-1117.502] -- 0:00:19
678500 -- [-1118.339] (-1122.059) (-1119.799) (-1121.297) * (-1117.005) [-1115.987] (-1119.892) (-1116.208) -- 0:00:19
679000 -- (-1118.381) [-1119.373] (-1116.359) (-1120.764) * (-1119.731) [-1116.963] (-1120.937) (-1117.167) -- 0:00:19
679500 -- (-1119.863) [-1118.509] (-1116.749) (-1120.395) * (-1118.535) (-1116.776) [-1124.192] (-1116.364) -- 0:00:19
680000 -- (-1121.608) [-1118.011] (-1117.252) (-1116.664) * (-1116.862) (-1115.496) [-1116.900] (-1115.271) -- 0:00:19
Average standard deviation of split frequencies: 0.007211
680500 -- (-1116.888) (-1116.379) (-1119.690) [-1116.808] * (-1116.704) (-1115.428) (-1119.516) [-1115.986] -- 0:00:19
681000 -- (-1116.884) [-1115.842] (-1116.747) (-1116.416) * (-1118.550) [-1114.985] (-1119.790) (-1117.066) -- 0:00:19
681500 -- [-1116.180] (-1116.749) (-1117.894) (-1118.918) * (-1116.956) [-1116.203] (-1118.228) (-1119.110) -- 0:00:19
682000 -- (-1118.879) [-1118.355] (-1116.626) (-1119.671) * [-1117.853] (-1115.412) (-1115.910) (-1116.516) -- 0:00:19
682500 -- (-1116.460) (-1119.979) (-1117.454) [-1115.325] * (-1118.087) (-1115.399) (-1119.225) [-1120.315] -- 0:00:19
683000 -- (-1121.386) (-1117.412) (-1116.546) [-1115.748] * (-1118.231) (-1117.334) [-1119.934] (-1118.152) -- 0:00:19
683500 -- (-1118.511) (-1117.219) [-1117.819] (-1115.658) * [-1116.178] (-1117.993) (-1118.916) (-1118.339) -- 0:00:19
684000 -- (-1120.169) [-1116.763] (-1116.927) (-1121.751) * (-1115.028) (-1118.091) (-1117.990) [-1117.246] -- 0:00:19
684500 -- (-1119.138) [-1115.856] (-1122.336) (-1122.267) * (-1114.935) [-1120.215] (-1121.384) (-1116.695) -- 0:00:19
685000 -- [-1117.107] (-1116.137) (-1121.442) (-1120.549) * (-1120.520) (-1119.550) [-1116.326] (-1116.472) -- 0:00:19
Average standard deviation of split frequencies: 0.007519
685500 -- (-1116.987) (-1116.038) (-1118.575) [-1115.832] * (-1117.447) (-1117.058) (-1116.960) [-1118.036] -- 0:00:19
686000 -- (-1118.607) (-1115.910) (-1117.439) [-1118.010] * (-1118.020) (-1117.562) (-1116.363) [-1116.551] -- 0:00:19
686500 -- (-1116.380) (-1117.977) (-1116.582) [-1115.670] * (-1119.138) (-1117.967) (-1118.242) [-1116.713] -- 0:00:19
687000 -- (-1123.156) (-1117.519) (-1119.329) [-1115.302] * [-1118.432] (-1120.615) (-1116.139) (-1117.445) -- 0:00:19
687500 -- (-1116.368) (-1127.512) (-1120.841) [-1115.753] * [-1120.026] (-1122.281) (-1116.153) (-1116.551) -- 0:00:19
688000 -- [-1116.179] (-1117.121) (-1115.197) (-1115.828) * (-1119.099) [-1118.267] (-1116.008) (-1121.641) -- 0:00:19
688500 -- [-1117.026] (-1117.382) (-1115.145) (-1115.643) * (-1116.131) (-1120.375) [-1115.383] (-1120.733) -- 0:00:19
689000 -- (-1118.122) [-1116.178] (-1115.903) (-1115.203) * (-1115.862) (-1117.268) [-1115.703] (-1116.598) -- 0:00:19
689500 -- (-1116.983) (-1120.502) (-1119.523) [-1118.076] * [-1117.035] (-1117.498) (-1118.151) (-1116.320) -- 0:00:19
690000 -- (-1115.728) (-1119.080) (-1120.359) [-1117.069] * (-1120.046) (-1116.225) (-1119.815) [-1119.628] -- 0:00:19
Average standard deviation of split frequencies: 0.007508
690500 -- (-1119.958) (-1119.415) (-1115.701) [-1117.072] * (-1117.716) (-1122.726) (-1116.292) [-1117.510] -- 0:00:19
691000 -- [-1117.829] (-1118.531) (-1117.195) (-1122.281) * (-1117.237) (-1116.298) (-1117.071) [-1116.887] -- 0:00:19
691500 -- [-1117.648] (-1118.141) (-1117.231) (-1115.850) * (-1120.518) (-1116.310) [-1117.847] (-1119.094) -- 0:00:19
692000 -- (-1117.678) (-1116.478) [-1117.285] (-1115.964) * (-1115.905) [-1115.802] (-1115.877) (-1118.257) -- 0:00:19
692500 -- (-1115.952) (-1120.303) [-1116.371] (-1117.413) * (-1117.027) [-1115.569] (-1118.211) (-1119.779) -- 0:00:19
693000 -- (-1116.202) [-1115.934] (-1116.381) (-1119.222) * [-1118.191] (-1115.385) (-1123.889) (-1119.507) -- 0:00:19
693500 -- (-1115.826) [-1117.210] (-1121.604) (-1118.460) * [-1117.086] (-1115.414) (-1121.013) (-1121.955) -- 0:00:19
694000 -- (-1115.826) (-1117.349) (-1117.422) [-1117.245] * (-1118.790) (-1117.386) [-1115.300] (-1116.108) -- 0:00:18
694500 -- (-1118.286) [-1118.829] (-1115.887) (-1116.378) * (-1118.456) (-1115.687) [-1115.280] (-1117.187) -- 0:00:18
695000 -- [-1117.494] (-1115.923) (-1116.806) (-1117.529) * (-1115.815) [-1117.233] (-1120.841) (-1120.729) -- 0:00:18
Average standard deviation of split frequencies: 0.007747
695500 -- (-1126.531) [-1116.924] (-1119.538) (-1116.911) * [-1116.271] (-1117.705) (-1116.813) (-1117.207) -- 0:00:18
696000 -- (-1115.868) [-1118.088] (-1115.682) (-1117.032) * (-1116.704) (-1115.814) (-1118.292) [-1117.607] -- 0:00:18
696500 -- (-1115.962) [-1116.490] (-1116.746) (-1116.934) * (-1116.904) (-1119.954) [-1118.022] (-1118.026) -- 0:00:18
697000 -- [-1116.908] (-1116.684) (-1117.461) (-1124.196) * (-1115.949) [-1120.547] (-1116.871) (-1121.318) -- 0:00:18
697500 -- (-1119.400) [-1117.162] (-1118.551) (-1117.325) * (-1116.685) (-1117.616) [-1120.851] (-1117.184) -- 0:00:18
698000 -- (-1117.882) [-1118.111] (-1115.598) (-1119.972) * (-1117.709) (-1116.910) [-1117.033] (-1116.468) -- 0:00:18
698500 -- (-1116.472) (-1119.629) [-1117.593] (-1118.005) * (-1117.642) (-1116.069) [-1115.320] (-1117.100) -- 0:00:18
699000 -- (-1116.544) (-1116.919) [-1117.610] (-1118.143) * (-1122.661) (-1115.749) (-1115.609) [-1121.031] -- 0:00:18
699500 -- (-1115.338) (-1117.341) (-1119.824) [-1116.116] * [-1115.198] (-1117.752) (-1116.543) (-1118.688) -- 0:00:18
700000 -- (-1115.338) [-1116.430] (-1119.261) (-1118.312) * [-1116.422] (-1116.742) (-1117.012) (-1119.686) -- 0:00:18
Average standard deviation of split frequencies: 0.007233
700500 -- (-1115.391) [-1117.269] (-1118.292) (-1116.397) * (-1116.320) [-1116.598] (-1117.353) (-1116.321) -- 0:00:18
701000 -- (-1116.630) (-1117.663) [-1115.657] (-1116.238) * (-1118.150) (-1119.078) (-1120.291) [-1115.228] -- 0:00:18
701500 -- (-1115.946) (-1116.344) (-1117.372) [-1115.549] * (-1117.967) (-1117.320) (-1118.108) [-1115.997] -- 0:00:18
702000 -- (-1119.381) (-1116.657) (-1116.115) [-1115.397] * (-1115.339) (-1115.599) [-1116.522] (-1116.958) -- 0:00:18
702500 -- [-1118.346] (-1119.719) (-1115.764) (-1118.491) * (-1116.412) (-1116.160) [-1117.768] (-1116.305) -- 0:00:18
703000 -- (-1118.196) (-1125.985) [-1115.898] (-1116.003) * (-1116.912) (-1115.884) (-1117.754) [-1116.894] -- 0:00:18
703500 -- [-1121.109] (-1117.240) (-1116.407) (-1116.403) * (-1115.526) (-1117.663) [-1116.061] (-1122.225) -- 0:00:18
704000 -- (-1117.680) [-1117.161] (-1121.578) (-1116.642) * (-1115.377) (-1115.823) (-1117.569) [-1117.975] -- 0:00:18
704500 -- [-1119.254] (-1118.751) (-1118.005) (-1121.696) * (-1115.662) (-1115.715) [-1119.387] (-1117.874) -- 0:00:18
705000 -- (-1116.602) (-1116.410) [-1118.987] (-1117.607) * (-1115.617) [-1116.941] (-1116.712) (-1118.865) -- 0:00:18
Average standard deviation of split frequencies: 0.007470
705500 -- [-1115.415] (-1116.619) (-1115.925) (-1118.231) * [-1115.989] (-1114.968) (-1115.422) (-1117.355) -- 0:00:18
706000 -- (-1115.370) (-1116.456) [-1115.435] (-1115.807) * (-1119.617) [-1114.817] (-1115.245) (-1118.686) -- 0:00:18
706500 -- (-1117.071) (-1114.982) (-1118.171) [-1117.771] * (-1117.837) (-1116.158) [-1116.682] (-1115.822) -- 0:00:18
707000 -- (-1116.940) [-1116.241] (-1117.223) (-1118.011) * (-1118.733) (-1119.267) (-1117.931) [-1115.722] -- 0:00:18
707500 -- (-1117.203) (-1116.912) [-1122.311] (-1119.340) * (-1119.675) (-1118.006) (-1115.257) [-1118.899] -- 0:00:18
708000 -- [-1119.029] (-1117.880) (-1116.429) (-1116.606) * (-1115.478) (-1118.830) [-1117.831] (-1120.189) -- 0:00:18
708500 -- [-1120.025] (-1116.966) (-1121.607) (-1115.456) * (-1122.702) (-1117.699) (-1120.819) [-1115.429] -- 0:00:18
709000 -- (-1119.009) (-1115.888) [-1120.774] (-1115.472) * (-1115.981) [-1117.763] (-1116.615) (-1116.715) -- 0:00:18
709500 -- [-1116.749] (-1116.827) (-1120.395) (-1115.977) * (-1119.840) [-1116.336] (-1120.415) (-1119.012) -- 0:00:18
710000 -- (-1120.264) [-1117.105] (-1120.122) (-1116.854) * (-1114.996) (-1118.698) (-1117.498) [-1118.516] -- 0:00:17
Average standard deviation of split frequencies: 0.007504
710500 -- (-1118.179) (-1115.752) [-1118.018] (-1121.080) * (-1117.083) (-1115.938) [-1116.255] (-1118.374) -- 0:00:17
711000 -- [-1116.709] (-1115.778) (-1117.634) (-1114.808) * [-1115.114] (-1118.346) (-1119.253) (-1117.298) -- 0:00:17
711500 -- (-1116.344) (-1115.350) (-1115.507) [-1116.502] * (-1116.514) (-1116.767) [-1118.487] (-1122.000) -- 0:00:17
712000 -- (-1115.822) (-1115.402) [-1118.922] (-1115.105) * (-1118.869) (-1119.475) [-1116.018] (-1116.957) -- 0:00:17
712500 -- (-1117.349) (-1117.220) [-1115.587] (-1117.584) * [-1117.361] (-1117.110) (-1116.046) (-1116.763) -- 0:00:17
713000 -- (-1119.797) (-1117.839) [-1118.002] (-1117.276) * [-1118.775] (-1116.564) (-1119.599) (-1119.575) -- 0:00:17
713500 -- (-1124.768) (-1117.539) [-1116.483] (-1116.378) * (-1123.039) (-1118.647) [-1118.894] (-1116.053) -- 0:00:17
714000 -- (-1117.379) (-1116.207) [-1116.440] (-1118.957) * (-1119.127) (-1118.625) [-1116.012] (-1116.737) -- 0:00:17
714500 -- [-1116.329] (-1117.609) (-1116.401) (-1117.310) * (-1118.063) [-1117.086] (-1116.636) (-1115.564) -- 0:00:17
715000 -- (-1117.791) (-1117.765) (-1115.237) [-1121.690] * [-1115.899] (-1124.662) (-1115.683) (-1116.509) -- 0:00:17
Average standard deviation of split frequencies: 0.007366
715500 -- (-1116.999) [-1116.640] (-1115.059) (-1116.338) * (-1118.225) (-1118.881) (-1117.511) [-1117.537] -- 0:00:17
716000 -- [-1117.540] (-1117.500) (-1114.953) (-1118.601) * [-1116.678] (-1119.165) (-1118.685) (-1115.871) -- 0:00:17
716500 -- (-1121.715) (-1119.524) (-1118.013) [-1118.253] * [-1116.269] (-1121.722) (-1118.590) (-1117.785) -- 0:00:17
717000 -- [-1122.961] (-1117.340) (-1117.803) (-1117.408) * [-1118.294] (-1120.103) (-1117.101) (-1115.728) -- 0:00:17
717500 -- (-1115.775) [-1118.561] (-1122.458) (-1117.441) * (-1119.638) [-1116.413] (-1116.479) (-1115.901) -- 0:00:17
718000 -- [-1117.729] (-1116.769) (-1117.049) (-1117.140) * [-1115.347] (-1117.207) (-1115.906) (-1117.778) -- 0:00:17
718500 -- [-1118.222] (-1117.787) (-1116.195) (-1116.427) * (-1120.233) [-1116.606] (-1116.433) (-1116.332) -- 0:00:17
719000 -- [-1118.844] (-1115.855) (-1118.687) (-1117.161) * (-1115.408) (-1118.772) [-1116.224] (-1123.677) -- 0:00:17
719500 -- (-1115.405) (-1115.453) (-1119.921) [-1116.410] * (-1115.498) [-1115.573] (-1116.153) (-1121.073) -- 0:00:17
720000 -- (-1115.952) (-1119.425) (-1122.805) [-1116.002] * (-1117.929) (-1119.186) [-1116.507] (-1115.444) -- 0:00:17
Average standard deviation of split frequencies: 0.007972
720500 -- (-1118.393) [-1120.305] (-1119.030) (-1119.107) * [-1115.193] (-1116.245) (-1119.054) (-1117.492) -- 0:00:17
721000 -- (-1119.299) (-1116.692) [-1118.818] (-1116.408) * (-1118.748) (-1117.270) [-1121.532] (-1116.557) -- 0:00:17
721500 -- [-1118.799] (-1115.808) (-1117.982) (-1115.451) * (-1129.713) (-1116.183) (-1117.701) [-1115.188] -- 0:00:17
722000 -- (-1116.970) [-1115.772] (-1117.859) (-1115.719) * (-1123.763) (-1115.330) (-1118.434) [-1115.588] -- 0:00:17
722500 -- (-1119.802) [-1116.988] (-1120.870) (-1117.289) * (-1118.751) (-1118.919) (-1117.590) [-1115.220] -- 0:00:17
723000 -- (-1116.597) (-1117.310) [-1120.396] (-1116.112) * (-1117.579) (-1118.834) [-1115.477] (-1116.058) -- 0:00:17
723500 -- [-1118.577] (-1117.835) (-1116.271) (-1117.565) * (-1114.951) (-1117.734) (-1117.789) [-1117.625] -- 0:00:17
724000 -- (-1118.470) (-1117.516) (-1116.426) [-1117.283] * (-1115.666) (-1116.955) (-1117.789) [-1115.909] -- 0:00:17
724500 -- [-1118.504] (-1117.848) (-1121.805) (-1119.196) * (-1117.385) [-1116.003] (-1115.840) (-1115.937) -- 0:00:17
725000 -- (-1118.487) (-1117.759) (-1118.735) [-1116.924] * (-1117.257) [-1118.839] (-1115.363) (-1119.579) -- 0:00:17
Average standard deviation of split frequencies: 0.007711
725500 -- (-1120.332) (-1121.025) (-1120.127) [-1117.128] * (-1116.323) (-1116.265) (-1117.991) [-1116.521] -- 0:00:17
726000 -- (-1116.684) (-1118.868) (-1117.639) [-1116.725] * (-1116.598) [-1117.662] (-1115.923) (-1118.773) -- 0:00:16
726500 -- (-1116.685) (-1116.459) [-1117.473] (-1120.054) * (-1118.507) [-1118.818] (-1116.236) (-1115.944) -- 0:00:16
727000 -- [-1119.142] (-1115.376) (-1116.012) (-1116.227) * (-1117.208) [-1115.424] (-1116.822) (-1117.993) -- 0:00:16
727500 -- (-1118.403) (-1118.191) (-1115.413) [-1117.080] * (-1117.990) (-1116.499) (-1115.446) [-1115.450] -- 0:00:16
728000 -- (-1119.526) [-1119.783] (-1118.800) (-1118.417) * [-1115.246] (-1117.083) (-1114.893) (-1117.907) -- 0:00:16
728500 -- [-1115.128] (-1116.642) (-1116.879) (-1120.282) * (-1115.680) (-1118.405) [-1114.869] (-1121.746) -- 0:00:16
729000 -- (-1118.787) [-1115.684] (-1115.747) (-1117.826) * (-1116.066) [-1116.754] (-1115.029) (-1119.815) -- 0:00:16
729500 -- (-1117.645) (-1119.439) (-1117.768) [-1118.943] * (-1116.986) [-1116.694] (-1115.348) (-1117.835) -- 0:00:16
730000 -- [-1116.147] (-1117.443) (-1116.950) (-1118.208) * (-1116.623) (-1118.547) [-1115.333] (-1118.257) -- 0:00:16
Average standard deviation of split frequencies: 0.007621
730500 -- [-1116.744] (-1117.201) (-1115.230) (-1118.759) * [-1118.692] (-1115.407) (-1116.378) (-1115.559) -- 0:00:16
731000 -- [-1116.483] (-1117.668) (-1115.229) (-1115.170) * (-1125.496) (-1115.937) (-1115.739) [-1116.829] -- 0:00:16
731500 -- (-1115.717) (-1116.942) [-1115.762] (-1116.916) * [-1115.538] (-1116.547) (-1116.622) (-1116.867) -- 0:00:16
732000 -- (-1115.592) [-1118.647] (-1116.098) (-1118.450) * (-1117.448) (-1119.897) [-1118.049] (-1115.713) -- 0:00:16
732500 -- (-1116.398) (-1116.879) [-1117.805] (-1117.642) * (-1116.023) (-1119.407) [-1117.572] (-1117.795) -- 0:00:16
733000 -- (-1116.908) (-1116.591) (-1117.143) [-1123.071] * (-1118.819) [-1119.518] (-1117.692) (-1121.099) -- 0:00:16
733500 -- (-1118.916) (-1116.490) (-1115.436) [-1118.296] * [-1116.763] (-1118.377) (-1118.205) (-1118.965) -- 0:00:16
734000 -- (-1119.742) (-1117.206) (-1117.299) [-1114.978] * [-1121.258] (-1117.111) (-1117.991) (-1118.378) -- 0:00:16
734500 -- (-1118.129) (-1119.246) [-1116.724] (-1117.511) * (-1115.827) (-1116.049) [-1116.516] (-1117.352) -- 0:00:16
735000 -- (-1115.812) (-1118.622) [-1116.138] (-1120.477) * (-1116.289) (-1118.159) (-1117.040) [-1116.644] -- 0:00:16
Average standard deviation of split frequencies: 0.007846
735500 -- (-1116.506) (-1120.315) (-1116.414) [-1115.137] * (-1117.854) [-1116.343] (-1115.878) (-1117.402) -- 0:00:16
736000 -- [-1117.401] (-1117.995) (-1120.883) (-1120.649) * [-1116.747] (-1116.229) (-1115.978) (-1115.300) -- 0:00:16
736500 -- (-1118.601) (-1115.659) [-1123.386] (-1116.503) * [-1116.379] (-1117.408) (-1118.325) (-1116.090) -- 0:00:16
737000 -- (-1116.970) (-1116.049) [-1115.909] (-1117.698) * [-1118.065] (-1117.529) (-1116.584) (-1117.223) -- 0:00:16
737500 -- [-1120.019] (-1118.928) (-1117.104) (-1118.679) * (-1118.493) [-1117.635] (-1116.920) (-1119.573) -- 0:00:16
738000 -- [-1116.876] (-1116.342) (-1119.340) (-1118.313) * (-1115.070) (-1116.756) (-1116.729) [-1117.188] -- 0:00:16
738500 -- (-1118.538) (-1120.114) (-1116.107) [-1116.580] * [-1115.138] (-1117.089) (-1120.543) (-1115.889) -- 0:00:16
739000 -- (-1117.642) (-1117.489) [-1117.728] (-1117.725) * (-1115.156) (-1120.796) [-1116.080] (-1116.163) -- 0:00:16
739500 -- (-1116.496) (-1116.058) (-1117.422) [-1118.390] * [-1115.563] (-1116.140) (-1120.943) (-1120.726) -- 0:00:16
740000 -- (-1117.888) (-1117.797) (-1118.304) [-1117.062] * (-1117.271) [-1116.118] (-1119.165) (-1119.488) -- 0:00:16
Average standard deviation of split frequencies: 0.007680
740500 -- [-1116.437] (-1114.957) (-1120.325) (-1120.511) * (-1119.489) (-1115.544) [-1117.072] (-1114.996) -- 0:00:16
741000 -- (-1117.817) (-1116.746) [-1115.617] (-1118.912) * (-1116.608) (-1116.225) [-1116.277] (-1120.563) -- 0:00:16
741500 -- (-1120.069) [-1116.689] (-1115.717) (-1116.155) * (-1118.835) (-1118.312) (-1120.776) [-1119.103] -- 0:00:16
742000 -- (-1117.394) (-1120.407) [-1117.458] (-1120.745) * (-1119.518) (-1117.489) [-1118.073] (-1116.089) -- 0:00:15
742500 -- (-1117.099) (-1116.641) [-1117.465] (-1119.209) * (-1116.883) (-1119.224) (-1116.501) [-1116.554] -- 0:00:15
743000 -- (-1117.677) [-1118.011] (-1117.224) (-1116.183) * (-1121.475) (-1115.622) [-1117.916] (-1117.837) -- 0:00:15
743500 -- [-1115.647] (-1117.461) (-1119.332) (-1118.727) * (-1120.471) (-1116.440) (-1119.364) [-1118.852] -- 0:00:15
744000 -- (-1117.754) [-1118.457] (-1117.922) (-1120.908) * (-1119.548) (-1115.571) (-1116.891) [-1116.050] -- 0:00:15
744500 -- (-1116.514) (-1120.111) [-1117.007] (-1116.608) * [-1119.312] (-1117.714) (-1118.186) (-1115.326) -- 0:00:15
745000 -- (-1115.821) (-1119.863) [-1117.016] (-1117.530) * (-1117.299) (-1118.861) [-1118.477] (-1115.763) -- 0:00:15
Average standard deviation of split frequencies: 0.007820
745500 -- (-1121.784) (-1119.801) [-1117.067] (-1117.301) * (-1116.690) [-1114.998] (-1118.551) (-1115.643) -- 0:00:15
746000 -- (-1119.054) (-1124.693) [-1115.398] (-1119.337) * [-1117.339] (-1115.634) (-1118.851) (-1115.800) -- 0:00:15
746500 -- (-1119.757) (-1121.020) [-1115.618] (-1119.500) * (-1118.166) (-1121.447) (-1117.741) [-1122.628] -- 0:00:15
747000 -- (-1116.426) (-1117.758) [-1116.038] (-1116.858) * [-1118.993] (-1116.347) (-1118.358) (-1118.627) -- 0:00:15
747500 -- (-1117.549) (-1116.544) [-1115.459] (-1120.239) * [-1118.430] (-1115.998) (-1119.783) (-1118.878) -- 0:00:15
748000 -- (-1116.458) [-1116.350] (-1115.690) (-1121.681) * (-1117.302) [-1118.335] (-1118.085) (-1118.841) -- 0:00:15
748500 -- (-1118.907) [-1117.129] (-1115.357) (-1117.239) * (-1118.900) (-1118.847) [-1119.042] (-1118.221) -- 0:00:15
749000 -- (-1119.389) [-1116.214] (-1115.545) (-1119.579) * [-1115.914] (-1117.736) (-1115.688) (-1118.400) -- 0:00:15
749500 -- (-1117.983) [-1116.752] (-1115.676) (-1115.001) * (-1116.625) (-1116.642) [-1118.488] (-1116.078) -- 0:00:15
750000 -- [-1115.877] (-1116.078) (-1121.719) (-1118.569) * [-1116.331] (-1115.812) (-1115.103) (-1116.948) -- 0:00:15
Average standard deviation of split frequencies: 0.007771
750500 -- (-1115.792) (-1116.681) [-1116.745] (-1117.165) * (-1117.342) (-1116.333) [-1116.265] (-1117.378) -- 0:00:15
751000 -- [-1118.319] (-1117.907) (-1119.277) (-1116.792) * (-1116.537) [-1116.520] (-1117.729) (-1116.109) -- 0:00:15
751500 -- (-1121.789) [-1118.386] (-1116.868) (-1118.529) * (-1120.402) [-1118.043] (-1118.515) (-1117.586) -- 0:00:15
752000 -- (-1117.895) (-1118.038) [-1119.340] (-1117.937) * (-1116.267) (-1116.613) [-1118.201] (-1118.809) -- 0:00:15
752500 -- [-1117.829] (-1116.906) (-1116.367) (-1116.878) * (-1117.446) [-1116.438] (-1116.277) (-1115.775) -- 0:00:15
753000 -- [-1118.046] (-1117.051) (-1118.425) (-1117.324) * (-1118.890) (-1121.636) [-1115.323] (-1119.378) -- 0:00:15
753500 -- (-1117.626) [-1116.438] (-1116.635) (-1116.734) * (-1117.015) (-1119.095) (-1117.156) [-1116.106] -- 0:00:15
754000 -- (-1115.453) (-1116.330) (-1116.194) [-1117.644] * (-1116.118) (-1118.886) [-1116.462] (-1116.722) -- 0:00:15
754500 -- (-1116.728) (-1116.749) [-1117.041] (-1116.385) * (-1118.562) [-1119.129] (-1117.079) (-1117.871) -- 0:00:15
755000 -- (-1117.117) (-1116.894) [-1119.021] (-1115.368) * [-1117.340] (-1115.673) (-1119.040) (-1120.057) -- 0:00:15
Average standard deviation of split frequencies: 0.007316
755500 -- [-1115.950] (-1116.548) (-1121.117) (-1117.691) * (-1119.557) (-1118.955) (-1120.026) [-1116.693] -- 0:00:15
756000 -- (-1121.199) (-1117.658) [-1119.869] (-1117.921) * (-1119.070) [-1118.101] (-1116.223) (-1115.509) -- 0:00:15
756500 -- (-1119.045) (-1116.322) (-1117.053) [-1116.379] * (-1118.202) (-1117.315) (-1115.177) [-1116.123] -- 0:00:15
757000 -- [-1118.952] (-1115.820) (-1115.999) (-1117.348) * [-1116.300] (-1118.349) (-1115.335) (-1117.143) -- 0:00:15
757500 -- [-1115.994] (-1118.441) (-1115.307) (-1118.018) * (-1115.255) (-1116.378) (-1114.969) [-1115.742] -- 0:00:15
758000 -- (-1117.092) (-1118.853) [-1117.088] (-1117.315) * [-1117.443] (-1117.970) (-1115.079) (-1115.641) -- 0:00:15
758500 -- (-1117.793) (-1119.756) (-1117.096) [-1115.400] * (-1119.848) (-1116.900) (-1116.352) [-1118.624] -- 0:00:14
759000 -- (-1116.680) (-1119.877) (-1116.483) [-1115.320] * [-1119.575] (-1116.310) (-1117.168) (-1114.826) -- 0:00:14
759500 -- (-1115.893) [-1117.592] (-1115.342) (-1116.621) * [-1116.251] (-1116.615) (-1119.272) (-1120.770) -- 0:00:14
760000 -- (-1115.829) (-1115.076) [-1115.574] (-1115.748) * [-1117.271] (-1116.297) (-1116.155) (-1117.712) -- 0:00:14
Average standard deviation of split frequencies: 0.007809
760500 -- (-1115.965) (-1117.084) [-1115.892] (-1116.799) * (-1118.785) [-1115.669] (-1115.207) (-1115.592) -- 0:00:14
761000 -- (-1117.964) [-1116.653] (-1117.073) (-1120.927) * (-1116.288) (-1119.173) [-1115.897] (-1120.018) -- 0:00:14
761500 -- (-1118.124) (-1120.052) (-1118.925) [-1122.412] * (-1115.956) (-1115.188) (-1117.031) [-1118.504] -- 0:00:14
762000 -- (-1116.867) (-1115.467) [-1118.584] (-1119.586) * (-1117.403) (-1115.972) (-1116.170) [-1116.823] -- 0:00:14
762500 -- (-1116.364) (-1119.455) [-1116.959] (-1116.617) * (-1119.903) [-1116.921] (-1117.264) (-1115.769) -- 0:00:14
763000 -- (-1119.409) [-1116.027] (-1116.544) (-1117.617) * (-1120.703) (-1115.879) (-1118.230) [-1115.705] -- 0:00:14
763500 -- (-1116.011) (-1117.743) (-1118.160) [-1116.440] * (-1118.677) (-1124.815) (-1117.836) [-1119.606] -- 0:00:14
764000 -- (-1118.827) [-1116.438] (-1115.636) (-1116.106) * (-1116.964) (-1116.222) [-1118.859] (-1116.393) -- 0:00:14
764500 -- (-1121.427) (-1116.023) (-1115.446) [-1115.677] * (-1118.406) (-1119.109) (-1116.516) [-1117.841] -- 0:00:14
765000 -- (-1117.804) (-1115.344) (-1116.466) [-1116.309] * (-1116.648) (-1116.242) (-1125.019) [-1117.342] -- 0:00:14
Average standard deviation of split frequencies: 0.007846
765500 -- (-1115.590) (-1117.438) (-1116.091) [-1115.878] * (-1118.742) (-1119.327) [-1115.929] (-1118.762) -- 0:00:14
766000 -- (-1117.918) (-1121.453) [-1116.916] (-1117.417) * [-1118.714] (-1119.116) (-1115.690) (-1117.139) -- 0:00:14
766500 -- (-1118.120) (-1116.258) [-1115.500] (-1120.553) * (-1119.350) (-1119.022) (-1116.760) [-1118.096] -- 0:00:14
767000 -- [-1119.633] (-1117.406) (-1116.742) (-1118.103) * (-1119.053) (-1117.454) [-1115.380] (-1120.138) -- 0:00:14
767500 -- (-1115.741) (-1119.917) (-1121.396) [-1121.180] * (-1117.811) (-1116.147) (-1118.273) [-1118.324] -- 0:00:14
768000 -- (-1115.235) (-1118.366) (-1116.946) [-1118.402] * (-1118.338) [-1116.326] (-1117.442) (-1119.364) -- 0:00:14
768500 -- (-1116.918) (-1118.799) [-1118.772] (-1115.393) * (-1117.282) (-1116.427) [-1115.701] (-1116.557) -- 0:00:14
769000 -- (-1123.552) (-1116.430) [-1116.635] (-1116.349) * (-1120.447) [-1118.870] (-1116.655) (-1117.598) -- 0:00:14
769500 -- (-1122.505) (-1115.577) (-1115.452) [-1115.621] * (-1118.991) (-1121.247) [-1115.876] (-1116.618) -- 0:00:14
770000 -- [-1116.881] (-1115.749) (-1115.555) (-1118.951) * [-1118.022] (-1117.783) (-1117.326) (-1116.198) -- 0:00:14
Average standard deviation of split frequencies: 0.007837
770500 -- (-1115.129) (-1117.544) [-1117.377] (-1116.872) * (-1116.817) (-1117.598) (-1123.392) [-1118.432] -- 0:00:14
771000 -- (-1115.728) [-1117.037] (-1116.521) (-1116.948) * (-1116.860) (-1116.904) (-1117.560) [-1115.690] -- 0:00:14
771500 -- [-1115.834] (-1118.902) (-1119.691) (-1117.585) * (-1114.967) (-1120.115) (-1119.950) [-1117.810] -- 0:00:14
772000 -- (-1115.655) (-1115.659) (-1118.409) [-1118.461] * (-1116.647) (-1115.130) (-1116.819) [-1116.607] -- 0:00:14
772500 -- (-1117.156) (-1117.116) (-1120.276) [-1117.196] * (-1119.230) (-1115.590) [-1116.523] (-1116.307) -- 0:00:14
773000 -- (-1119.336) [-1115.652] (-1118.917) (-1117.125) * [-1118.137] (-1116.501) (-1116.695) (-1116.363) -- 0:00:14
773500 -- [-1115.580] (-1117.021) (-1117.429) (-1117.531) * (-1115.255) (-1117.007) [-1118.114] (-1117.888) -- 0:00:14
774000 -- (-1115.728) (-1118.936) (-1119.556) [-1117.437] * [-1115.933] (-1119.736) (-1118.559) (-1118.019) -- 0:00:14
774500 -- (-1115.262) [-1118.276] (-1119.021) (-1118.293) * (-1118.107) [-1120.860] (-1121.828) (-1117.594) -- 0:00:13
775000 -- (-1116.727) (-1116.869) [-1115.864] (-1118.348) * (-1116.044) (-1124.175) (-1120.083) [-1116.536] -- 0:00:13
Average standard deviation of split frequencies: 0.008087
775500 -- (-1117.705) (-1120.917) (-1116.480) [-1116.329] * (-1116.602) [-1122.332] (-1118.501) (-1117.922) -- 0:00:13
776000 -- (-1116.801) (-1116.356) [-1117.320] (-1117.085) * (-1118.134) (-1117.122) (-1120.186) [-1116.914] -- 0:00:13
776500 -- (-1119.842) (-1116.769) [-1116.757] (-1116.009) * (-1118.716) (-1115.954) (-1124.676) [-1117.570] -- 0:00:13
777000 -- (-1117.755) (-1116.981) [-1116.805] (-1120.230) * [-1120.002] (-1118.000) (-1120.628) (-1119.196) -- 0:00:13
777500 -- (-1117.724) (-1118.358) (-1118.209) [-1117.084] * (-1117.142) (-1114.982) (-1118.489) [-1115.105] -- 0:00:13
778000 -- (-1116.673) (-1116.948) [-1115.605] (-1118.453) * (-1117.760) (-1117.742) (-1120.824) [-1116.323] -- 0:00:13
778500 -- (-1115.636) (-1116.105) (-1119.079) [-1121.766] * [-1115.565] (-1116.103) (-1118.477) (-1116.251) -- 0:00:13
779000 -- (-1115.892) (-1115.400) [-1115.528] (-1122.171) * (-1116.168) [-1121.313] (-1123.432) (-1117.773) -- 0:00:13
779500 -- (-1116.261) [-1121.229] (-1121.049) (-1123.378) * (-1115.995) (-1117.610) (-1119.232) [-1116.494] -- 0:00:13
780000 -- (-1116.531) (-1119.443) (-1119.984) [-1119.193] * (-1115.945) (-1117.919) [-1116.184] (-1116.259) -- 0:00:13
Average standard deviation of split frequencies: 0.008718
780500 -- (-1118.124) (-1117.856) (-1117.668) [-1118.006] * (-1116.937) (-1119.053) [-1116.791] (-1116.274) -- 0:00:13
781000 -- (-1116.936) (-1117.865) [-1119.556] (-1117.195) * (-1115.484) [-1116.175] (-1116.487) (-1119.038) -- 0:00:13
781500 -- [-1116.642] (-1116.559) (-1117.957) (-1115.273) * (-1118.926) (-1116.244) [-1116.147] (-1117.867) -- 0:00:13
782000 -- (-1115.626) (-1117.375) (-1116.658) [-1116.067] * (-1117.951) (-1115.691) (-1116.496) [-1117.407] -- 0:00:13
782500 -- (-1115.280) [-1116.499] (-1116.008) (-1123.053) * [-1117.878] (-1118.381) (-1116.455) (-1115.997) -- 0:00:13
783000 -- [-1115.185] (-1117.087) (-1117.005) (-1118.629) * [-1115.602] (-1118.175) (-1116.281) (-1116.054) -- 0:00:13
783500 -- [-1117.483] (-1115.391) (-1116.863) (-1117.668) * (-1118.520) (-1118.847) [-1118.667] (-1116.023) -- 0:00:13
784000 -- (-1118.618) (-1122.161) (-1117.900) [-1115.705] * (-1115.271) (-1117.860) [-1118.867] (-1119.577) -- 0:00:13
784500 -- [-1118.739] (-1118.167) (-1123.662) (-1118.942) * (-1115.242) (-1116.221) [-1116.711] (-1118.676) -- 0:00:13
785000 -- [-1118.406] (-1124.199) (-1120.533) (-1116.809) * (-1116.444) (-1117.427) [-1118.859] (-1116.827) -- 0:00:13
Average standard deviation of split frequencies: 0.008959
785500 -- [-1115.585] (-1118.793) (-1116.661) (-1117.238) * (-1115.341) (-1116.395) (-1116.361) [-1117.757] -- 0:00:13
786000 -- [-1118.535] (-1117.724) (-1115.594) (-1116.486) * (-1114.934) [-1117.798] (-1117.335) (-1116.891) -- 0:00:13
786500 -- (-1117.615) (-1118.146) [-1116.471] (-1116.475) * (-1114.955) (-1116.687) [-1116.870] (-1117.263) -- 0:00:13
787000 -- (-1115.509) [-1118.391] (-1119.131) (-1116.780) * (-1120.102) (-1118.216) (-1117.342) [-1115.067] -- 0:00:13
787500 -- (-1115.510) (-1118.953) (-1119.535) [-1116.298] * (-1119.363) (-1118.644) [-1118.059] (-1115.802) -- 0:00:13
788000 -- [-1116.081] (-1117.041) (-1116.208) (-1117.040) * (-1118.203) (-1118.516) (-1115.429) [-1114.956] -- 0:00:13
788500 -- (-1116.000) [-1119.658] (-1116.208) (-1116.043) * (-1117.250) (-1116.273) (-1117.638) [-1115.477] -- 0:00:13
789000 -- (-1117.437) [-1116.380] (-1115.535) (-1116.482) * (-1118.926) (-1115.425) [-1117.273] (-1116.129) -- 0:00:13
789500 -- (-1115.781) (-1118.737) [-1115.534] (-1116.243) * [-1117.455] (-1115.533) (-1116.563) (-1119.690) -- 0:00:13
790000 -- (-1118.313) (-1120.842) (-1116.343) [-1116.091] * (-1120.226) (-1116.948) (-1119.576) [-1118.851] -- 0:00:13
Average standard deviation of split frequencies: 0.008983
790500 -- (-1115.853) (-1119.847) [-1116.692] (-1117.732) * [-1118.472] (-1115.209) (-1117.164) (-1119.613) -- 0:00:12
791000 -- (-1115.262) (-1115.649) (-1118.150) [-1121.029] * (-1116.603) (-1116.742) [-1115.167] (-1119.279) -- 0:00:12
791500 -- (-1116.320) [-1115.639] (-1115.472) (-1115.722) * [-1116.796] (-1120.643) (-1115.170) (-1118.803) -- 0:00:12
792000 -- (-1116.875) [-1118.497] (-1115.541) (-1115.928) * (-1117.034) [-1120.219] (-1115.683) (-1117.610) -- 0:00:12
792500 -- [-1116.912] (-1119.628) (-1115.937) (-1118.759) * [-1116.980] (-1117.875) (-1116.668) (-1116.008) -- 0:00:12
793000 -- (-1116.189) [-1117.069] (-1116.861) (-1117.674) * [-1115.466] (-1118.022) (-1118.225) (-1116.176) -- 0:00:12
793500 -- (-1116.014) (-1119.516) [-1117.987] (-1117.781) * (-1116.932) (-1116.774) (-1120.692) [-1115.996] -- 0:00:12
794000 -- (-1116.822) (-1116.844) [-1117.062] (-1117.148) * (-1118.869) (-1117.494) [-1118.124] (-1117.866) -- 0:00:12
794500 -- [-1117.662] (-1117.411) (-1115.094) (-1115.934) * (-1115.593) [-1117.937] (-1118.167) (-1115.448) -- 0:00:12
795000 -- (-1118.247) [-1118.911] (-1117.758) (-1116.968) * (-1118.084) (-1117.221) [-1116.410] (-1116.187) -- 0:00:12
Average standard deviation of split frequencies: 0.008528
795500 -- [-1119.711] (-1116.864) (-1116.702) (-1116.145) * (-1117.293) (-1115.456) [-1118.298] (-1122.279) -- 0:00:12
796000 -- (-1118.462) (-1117.721) (-1116.630) [-1117.557] * (-1118.253) [-1117.902] (-1117.566) (-1117.496) -- 0:00:12
796500 -- [-1118.815] (-1117.473) (-1118.609) (-1119.455) * (-1115.480) (-1116.325) (-1116.950) [-1117.357] -- 0:00:12
797000 -- (-1117.985) [-1115.467] (-1116.580) (-1117.466) * [-1116.046] (-1116.080) (-1121.405) (-1115.397) -- 0:00:12
797500 -- [-1119.191] (-1116.840) (-1116.314) (-1117.217) * (-1118.897) (-1115.745) [-1118.199] (-1116.605) -- 0:00:12
798000 -- (-1116.409) [-1116.614] (-1116.731) (-1115.301) * (-1116.587) [-1118.737] (-1116.589) (-1119.546) -- 0:00:12
798500 -- (-1117.748) (-1116.506) (-1119.089) [-1115.394] * (-1117.707) (-1118.277) [-1119.319] (-1119.047) -- 0:00:12
799000 -- (-1116.438) (-1116.425) [-1117.693] (-1115.730) * (-1117.845) (-1117.744) [-1119.633] (-1118.754) -- 0:00:12
799500 -- [-1115.700] (-1115.651) (-1117.200) (-1119.218) * (-1119.519) [-1119.599] (-1117.894) (-1122.449) -- 0:00:12
800000 -- [-1116.024] (-1118.494) (-1115.581) (-1119.835) * (-1118.722) (-1117.199) [-1118.269] (-1117.614) -- 0:00:12
Average standard deviation of split frequencies: 0.008360
800500 -- (-1124.148) [-1116.129] (-1118.402) (-1117.671) * (-1119.878) [-1117.408] (-1115.726) (-1116.746) -- 0:00:12
801000 -- (-1116.681) [-1116.656] (-1119.733) (-1117.004) * [-1117.149] (-1118.697) (-1115.655) (-1117.510) -- 0:00:12
801500 -- [-1118.463] (-1117.595) (-1117.993) (-1115.364) * (-1116.374) (-1115.969) (-1116.511) [-1115.373] -- 0:00:12
802000 -- [-1121.379] (-1116.602) (-1118.717) (-1115.994) * (-1117.901) [-1116.061] (-1116.799) (-1115.371) -- 0:00:12
802500 -- (-1122.122) [-1116.891] (-1117.712) (-1118.266) * [-1116.469] (-1116.874) (-1117.521) (-1117.037) -- 0:00:12
803000 -- (-1117.653) (-1116.726) (-1120.182) [-1119.846] * (-1119.069) (-1116.043) [-1117.095] (-1117.059) -- 0:00:12
803500 -- (-1115.238) [-1117.138] (-1115.639) (-1116.772) * (-1117.870) [-1116.301] (-1117.480) (-1119.360) -- 0:00:12
804000 -- (-1118.375) (-1118.428) (-1115.000) [-1117.271] * (-1117.464) (-1116.258) (-1119.902) [-1118.579] -- 0:00:12
804500 -- (-1117.027) [-1117.261] (-1115.554) (-1118.999) * (-1121.611) [-1115.252] (-1115.622) (-1117.184) -- 0:00:12
805000 -- [-1116.425] (-1119.170) (-1118.948) (-1122.962) * (-1120.769) [-1116.536] (-1117.530) (-1115.060) -- 0:00:12
Average standard deviation of split frequencies: 0.008500
805500 -- [-1116.401] (-1119.322) (-1122.707) (-1125.716) * (-1115.840) (-1117.247) (-1116.209) [-1117.297] -- 0:00:12
806000 -- (-1119.214) (-1119.079) [-1117.083] (-1115.846) * (-1116.670) (-1115.939) [-1119.413] (-1118.029) -- 0:00:12
806500 -- (-1115.238) (-1119.273) (-1116.697) [-1117.556] * (-1118.638) (-1117.725) (-1119.673) [-1116.211] -- 0:00:11
807000 -- (-1116.792) (-1116.680) [-1117.939] (-1118.154) * (-1116.638) (-1121.505) (-1119.070) [-1117.896] -- 0:00:11
807500 -- (-1116.692) (-1120.750) (-1120.856) [-1122.191] * (-1119.177) (-1123.102) [-1115.382] (-1115.141) -- 0:00:11
808000 -- (-1116.197) (-1120.594) [-1118.234] (-1124.954) * (-1116.874) [-1117.886] (-1114.961) (-1121.074) -- 0:00:11
808500 -- [-1118.798] (-1126.807) (-1115.219) (-1117.636) * (-1115.822) (-1117.456) (-1115.513) [-1117.539] -- 0:00:11
809000 -- (-1116.843) (-1117.716) (-1118.473) [-1118.848] * (-1117.316) (-1117.294) (-1115.566) [-1123.246] -- 0:00:11
809500 -- [-1118.249] (-1115.876) (-1116.302) (-1120.713) * (-1119.731) (-1118.805) (-1117.563) [-1117.537] -- 0:00:11
810000 -- (-1120.348) [-1121.452] (-1118.936) (-1118.724) * (-1120.687) (-1120.917) (-1115.775) [-1116.512] -- 0:00:11
Average standard deviation of split frequencies: 0.008723
810500 -- [-1115.828] (-1123.979) (-1119.843) (-1116.790) * (-1118.349) (-1125.866) [-1119.234] (-1120.203) -- 0:00:11
811000 -- [-1116.598] (-1116.924) (-1115.384) (-1115.766) * (-1117.654) (-1119.930) (-1118.774) [-1117.082] -- 0:00:11
811500 -- [-1117.322] (-1118.671) (-1116.622) (-1116.109) * (-1119.216) [-1120.623] (-1117.229) (-1120.075) -- 0:00:11
812000 -- (-1116.474) [-1116.764] (-1122.573) (-1118.751) * (-1119.169) (-1117.055) [-1116.008] (-1120.090) -- 0:00:11
812500 -- (-1120.297) (-1118.121) [-1118.563] (-1118.220) * (-1118.909) (-1117.349) (-1119.183) [-1117.460] -- 0:00:11
813000 -- (-1119.468) [-1119.529] (-1115.771) (-1118.663) * (-1117.894) [-1118.460] (-1121.446) (-1117.143) -- 0:00:11
813500 -- (-1117.342) [-1116.383] (-1115.702) (-1116.820) * (-1118.018) (-1119.778) (-1117.884) [-1120.117] -- 0:00:11
814000 -- (-1118.054) [-1116.909] (-1117.253) (-1118.319) * (-1118.719) [-1116.224] (-1120.719) (-1117.366) -- 0:00:11
814500 -- (-1119.037) [-1115.523] (-1117.429) (-1119.712) * (-1117.150) (-1115.547) [-1118.822] (-1116.914) -- 0:00:11
815000 -- (-1122.058) [-1117.132] (-1119.423) (-1121.492) * (-1119.064) (-1118.968) [-1116.838] (-1117.238) -- 0:00:11
Average standard deviation of split frequencies: 0.008774
815500 -- (-1119.631) [-1116.277] (-1122.125) (-1124.668) * (-1117.569) (-1120.394) [-1116.140] (-1117.090) -- 0:00:11
816000 -- (-1117.758) [-1116.043] (-1116.169) (-1121.855) * (-1120.284) [-1119.457] (-1118.606) (-1116.867) -- 0:00:11
816500 -- (-1116.067) [-1115.629] (-1115.760) (-1118.196) * (-1118.134) (-1116.025) [-1118.484] (-1117.218) -- 0:00:11
817000 -- (-1115.708) (-1115.853) (-1115.998) [-1117.623] * (-1119.110) [-1115.926] (-1115.098) (-1116.494) -- 0:00:11
817500 -- (-1118.684) (-1116.020) [-1115.304] (-1117.825) * (-1118.744) (-1122.638) [-1117.819] (-1116.441) -- 0:00:11
818000 -- (-1121.292) [-1118.565] (-1117.000) (-1115.390) * [-1117.288] (-1120.529) (-1118.635) (-1117.036) -- 0:00:11
818500 -- (-1117.199) (-1116.937) [-1117.311] (-1121.219) * [-1115.739] (-1115.049) (-1118.831) (-1116.133) -- 0:00:11
819000 -- (-1116.311) [-1116.429] (-1118.130) (-1121.132) * (-1118.730) [-1115.300] (-1122.315) (-1114.900) -- 0:00:11
819500 -- (-1122.059) (-1118.230) [-1116.791] (-1116.465) * (-1116.370) (-1116.127) (-1117.049) [-1115.617] -- 0:00:11
820000 -- (-1118.531) (-1120.179) (-1117.378) [-1118.681] * (-1116.091) (-1115.975) (-1118.361) [-1115.604] -- 0:00:11
Average standard deviation of split frequencies: 0.008846
820500 -- (-1117.097) (-1120.810) [-1115.691] (-1116.786) * [-1116.294] (-1117.177) (-1117.832) (-1116.082) -- 0:00:11
821000 -- (-1119.133) [-1116.765] (-1117.813) (-1121.314) * [-1120.803] (-1118.807) (-1115.451) (-1116.969) -- 0:00:11
821500 -- (-1116.467) (-1120.254) (-1115.297) [-1120.262] * [-1116.815] (-1118.767) (-1122.305) (-1119.579) -- 0:00:11
822000 -- [-1116.775] (-1118.911) (-1117.968) (-1117.771) * (-1117.330) (-1119.263) [-1117.659] (-1116.095) -- 0:00:11
822500 -- (-1116.550) (-1123.553) [-1120.738] (-1121.718) * (-1118.237) (-1121.070) [-1114.773] (-1115.529) -- 0:00:11
823000 -- (-1115.752) (-1115.387) [-1115.790] (-1119.458) * (-1120.159) (-1120.922) [-1117.698] (-1117.576) -- 0:00:10
823500 -- [-1117.654] (-1115.536) (-1118.362) (-1119.293) * (-1121.212) (-1119.054) [-1118.341] (-1115.723) -- 0:00:10
824000 -- [-1118.004] (-1116.810) (-1119.655) (-1120.682) * (-1118.477) [-1116.931] (-1116.976) (-1117.626) -- 0:00:10
824500 -- (-1116.038) (-1116.931) [-1117.291] (-1119.524) * (-1117.387) [-1116.385] (-1116.032) (-1116.631) -- 0:00:10
825000 -- (-1117.286) (-1118.988) (-1120.507) [-1116.683] * (-1116.465) [-1117.851] (-1116.915) (-1114.867) -- 0:00:10
Average standard deviation of split frequencies: 0.008865
825500 -- (-1117.127) (-1117.782) (-1118.497) [-1116.018] * (-1116.034) (-1115.621) (-1116.988) [-1115.300] -- 0:00:10
826000 -- [-1119.146] (-1116.838) (-1116.710) (-1116.190) * (-1115.932) (-1116.502) (-1118.392) [-1116.539] -- 0:00:10
826500 -- (-1117.599) [-1115.965] (-1117.747) (-1119.517) * [-1122.632] (-1116.523) (-1116.916) (-1118.317) -- 0:00:10
827000 -- (-1119.053) (-1119.537) (-1118.895) [-1118.014] * (-1120.011) (-1118.706) (-1118.173) [-1120.917] -- 0:00:10
827500 -- (-1119.693) (-1117.328) [-1116.767] (-1117.897) * (-1117.242) [-1116.630] (-1119.854) (-1116.804) -- 0:00:10
828000 -- (-1119.415) [-1116.503] (-1116.532) (-1115.611) * (-1121.869) (-1117.022) (-1116.573) [-1116.542] -- 0:00:10
828500 -- (-1120.707) [-1116.715] (-1117.119) (-1116.942) * (-1116.284) (-1117.706) [-1116.663] (-1117.446) -- 0:00:10
829000 -- (-1120.264) (-1116.874) [-1116.095] (-1117.506) * [-1117.408] (-1115.719) (-1116.774) (-1116.031) -- 0:00:10
829500 -- (-1119.411) [-1115.644] (-1118.758) (-1117.571) * (-1118.075) [-1115.488] (-1116.814) (-1120.351) -- 0:00:10
830000 -- [-1121.501] (-1116.095) (-1116.329) (-1119.696) * (-1119.133) (-1117.409) [-1117.516] (-1121.951) -- 0:00:10
Average standard deviation of split frequencies: 0.008588
830500 -- (-1119.759) [-1117.805] (-1117.519) (-1115.790) * (-1125.300) (-1118.776) (-1117.043) [-1116.452] -- 0:00:10
831000 -- [-1119.183] (-1117.790) (-1117.654) (-1115.456) * (-1120.183) (-1117.801) (-1117.877) [-1117.024] -- 0:00:10
831500 -- [-1116.074] (-1118.147) (-1118.186) (-1115.316) * (-1120.586) (-1121.507) (-1119.071) [-1118.186] -- 0:00:10
832000 -- (-1115.501) [-1117.843] (-1119.274) (-1118.078) * (-1124.885) (-1116.558) (-1118.352) [-1118.813] -- 0:00:10
832500 -- (-1115.741) [-1115.528] (-1117.216) (-1115.810) * (-1121.600) [-1116.457] (-1115.929) (-1115.710) -- 0:00:10
833000 -- (-1116.054) (-1116.144) (-1117.216) [-1115.327] * (-1116.483) (-1119.458) (-1115.980) [-1114.947] -- 0:00:10
833500 -- (-1127.043) (-1117.912) (-1119.173) [-1117.290] * (-1123.795) [-1118.424] (-1117.824) (-1116.490) -- 0:00:10
834000 -- (-1122.006) (-1117.599) (-1117.401) [-1118.425] * (-1119.796) (-1117.310) [-1117.469] (-1115.601) -- 0:00:10
834500 -- (-1119.498) [-1118.636] (-1117.651) (-1116.936) * (-1119.752) (-1119.129) [-1119.776] (-1123.741) -- 0:00:10
835000 -- (-1117.175) [-1123.259] (-1117.055) (-1117.610) * (-1120.892) (-1119.624) [-1117.384] (-1119.993) -- 0:00:10
Average standard deviation of split frequencies: 0.008045
835500 -- (-1116.943) [-1116.412] (-1116.124) (-1117.685) * (-1118.989) (-1116.746) [-1116.208] (-1117.586) -- 0:00:10
836000 -- [-1115.093] (-1116.011) (-1116.997) (-1117.883) * [-1117.922] (-1119.106) (-1116.410) (-1119.440) -- 0:00:10
836500 -- [-1115.089] (-1115.913) (-1118.076) (-1119.061) * (-1120.776) (-1118.061) (-1117.456) [-1120.170] -- 0:00:10
837000 -- [-1115.450] (-1118.351) (-1118.341) (-1119.571) * (-1118.662) (-1119.287) [-1116.080] (-1117.762) -- 0:00:10
837500 -- [-1117.198] (-1117.176) (-1117.675) (-1116.577) * (-1115.975) (-1119.124) [-1116.031] (-1116.112) -- 0:00:10
838000 -- [-1115.335] (-1116.121) (-1116.090) (-1118.221) * (-1115.429) (-1117.359) [-1116.973] (-1119.874) -- 0:00:10
838500 -- (-1118.817) [-1116.400] (-1122.572) (-1117.135) * (-1115.566) (-1120.784) (-1116.750) [-1116.741] -- 0:00:10
839000 -- [-1118.223] (-1116.474) (-1117.003) (-1121.062) * [-1116.056] (-1118.537) (-1116.829) (-1120.772) -- 0:00:09
839500 -- (-1117.252) (-1115.783) (-1121.165) [-1115.478] * [-1117.628] (-1119.446) (-1115.673) (-1118.894) -- 0:00:09
840000 -- [-1115.724] (-1117.965) (-1117.753) (-1116.710) * [-1116.813] (-1117.141) (-1119.143) (-1115.726) -- 0:00:09
Average standard deviation of split frequencies: 0.008224
840500 -- [-1116.353] (-1118.951) (-1118.458) (-1120.242) * (-1116.763) (-1118.887) [-1118.951] (-1115.526) -- 0:00:09
841000 -- (-1121.264) [-1117.368] (-1115.711) (-1117.142) * (-1117.897) (-1116.616) (-1119.048) [-1118.171] -- 0:00:09
841500 -- (-1119.188) [-1115.610] (-1117.686) (-1119.076) * (-1117.925) (-1115.537) [-1115.319] (-1115.529) -- 0:00:09
842000 -- (-1115.467) (-1117.897) [-1116.948] (-1116.781) * (-1117.537) (-1115.870) [-1116.767] (-1115.868) -- 0:00:09
842500 -- (-1116.255) (-1117.282) [-1117.282] (-1118.955) * (-1117.102) (-1115.498) (-1117.462) [-1114.999] -- 0:00:09
843000 -- [-1116.055] (-1119.397) (-1117.967) (-1115.617) * (-1115.619) (-1115.574) [-1116.651] (-1117.418) -- 0:00:09
843500 -- (-1116.347) (-1119.221) [-1116.795] (-1115.650) * [-1116.410] (-1116.231) (-1115.501) (-1118.529) -- 0:00:09
844000 -- (-1116.996) [-1116.901] (-1116.601) (-1118.052) * [-1115.770] (-1115.292) (-1115.651) (-1117.383) -- 0:00:09
844500 -- (-1116.431) (-1116.679) (-1116.198) [-1115.878] * [-1115.721] (-1115.257) (-1117.720) (-1119.759) -- 0:00:09
845000 -- (-1115.561) [-1119.121] (-1116.603) (-1117.657) * (-1115.050) [-1119.082] (-1115.464) (-1117.039) -- 0:00:09
Average standard deviation of split frequencies: 0.008470
845500 -- (-1118.935) [-1121.964] (-1119.070) (-1120.884) * (-1119.346) (-1118.035) [-1116.705] (-1116.687) -- 0:00:09
846000 -- [-1119.223] (-1117.093) (-1118.197) (-1115.548) * (-1116.624) (-1119.272) (-1117.530) [-1116.241] -- 0:00:09
846500 -- (-1121.821) (-1116.663) [-1119.283] (-1116.070) * (-1116.574) (-1118.679) (-1117.434) [-1115.737] -- 0:00:09
847000 -- [-1117.151] (-1116.388) (-1116.587) (-1116.024) * (-1119.461) [-1117.528] (-1115.758) (-1115.915) -- 0:00:09
847500 -- [-1117.597] (-1117.439) (-1120.807) (-1117.357) * (-1118.181) [-1115.978] (-1118.650) (-1116.819) -- 0:00:09
848000 -- [-1118.990] (-1117.575) (-1117.211) (-1117.881) * (-1117.531) [-1116.566] (-1119.116) (-1116.483) -- 0:00:09
848500 -- (-1118.126) [-1117.972] (-1115.878) (-1116.402) * (-1118.827) (-1117.123) [-1115.985] (-1116.707) -- 0:00:09
849000 -- (-1121.904) (-1117.631) [-1117.064] (-1116.151) * (-1117.965) [-1117.417] (-1117.338) (-1118.460) -- 0:00:09
849500 -- (-1122.081) (-1118.778) (-1116.978) [-1117.127] * [-1116.469] (-1115.674) (-1119.102) (-1119.921) -- 0:00:09
850000 -- [-1124.006] (-1116.272) (-1115.535) (-1118.016) * (-1117.747) (-1116.470) [-1118.678] (-1118.405) -- 0:00:09
Average standard deviation of split frequencies: 0.008349
850500 -- (-1116.940) (-1117.966) (-1123.366) [-1116.678] * (-1120.741) [-1117.836] (-1115.170) (-1116.184) -- 0:00:09
851000 -- (-1115.818) [-1118.743] (-1118.838) (-1118.324) * [-1118.557] (-1120.126) (-1115.923) (-1119.239) -- 0:00:09
851500 -- (-1115.693) (-1118.227) [-1115.276] (-1116.664) * (-1117.377) [-1116.772] (-1115.934) (-1116.308) -- 0:00:09
852000 -- [-1115.062] (-1116.119) (-1115.754) (-1117.970) * (-1116.041) (-1115.773) (-1117.015) [-1117.950] -- 0:00:09
852500 -- (-1115.601) (-1117.213) [-1115.661] (-1118.795) * (-1116.855) [-1117.629] (-1122.355) (-1117.595) -- 0:00:09
853000 -- (-1119.080) [-1116.812] (-1115.520) (-1117.361) * (-1118.095) [-1117.427] (-1116.001) (-1116.581) -- 0:00:09
853500 -- (-1118.969) (-1116.580) [-1115.640] (-1120.137) * (-1116.814) [-1118.938] (-1117.185) (-1117.191) -- 0:00:09
854000 -- (-1117.631) [-1115.365] (-1116.127) (-1116.663) * (-1116.823) (-1119.248) [-1115.839] (-1116.294) -- 0:00:09
854500 -- (-1115.888) [-1116.502] (-1116.243) (-1117.384) * (-1115.833) (-1119.893) [-1115.838] (-1116.426) -- 0:00:09
855000 -- (-1116.264) (-1120.938) [-1116.578] (-1119.329) * (-1117.682) (-1116.199) [-1115.790] (-1119.799) -- 0:00:08
Average standard deviation of split frequencies: 0.008371
855500 -- [-1118.624] (-1116.716) (-1115.870) (-1119.221) * [-1117.560] (-1116.795) (-1117.065) (-1116.178) -- 0:00:08
856000 -- (-1115.833) (-1118.103) (-1119.258) [-1119.976] * (-1116.537) (-1115.385) (-1116.734) [-1115.952] -- 0:00:08
856500 -- (-1117.895) (-1116.517) [-1117.153] (-1119.692) * (-1119.404) [-1117.500] (-1115.616) (-1116.164) -- 0:00:08
857000 -- (-1116.809) (-1116.617) [-1116.883] (-1118.234) * [-1117.877] (-1117.235) (-1118.725) (-1116.654) -- 0:00:08
857500 -- (-1118.084) (-1119.093) [-1116.197] (-1122.207) * (-1117.857) (-1116.052) [-1121.273] (-1117.678) -- 0:00:08
858000 -- (-1119.441) (-1121.544) (-1115.507) [-1117.182] * (-1116.872) (-1117.383) [-1116.933] (-1118.810) -- 0:00:08
858500 -- (-1125.809) (-1124.737) [-1116.619] (-1118.577) * (-1122.805) [-1115.070] (-1116.009) (-1115.876) -- 0:00:08
859000 -- (-1116.585) (-1118.405) (-1117.769) [-1123.891] * (-1116.442) (-1115.261) [-1122.311] (-1116.782) -- 0:00:08
859500 -- (-1115.741) (-1117.129) (-1116.918) [-1117.372] * (-1115.843) [-1116.043] (-1115.228) (-1115.112) -- 0:00:08
860000 -- (-1117.920) [-1118.847] (-1116.761) (-1118.459) * [-1116.018] (-1115.676) (-1115.816) (-1114.734) -- 0:00:08
Average standard deviation of split frequencies: 0.008435
860500 -- (-1115.920) (-1120.936) [-1117.930] (-1116.156) * (-1117.765) (-1116.053) (-1117.150) [-1122.419] -- 0:00:08
861000 -- [-1115.494] (-1120.676) (-1120.216) (-1115.360) * [-1115.766] (-1118.759) (-1115.795) (-1115.704) -- 0:00:08
861500 -- (-1115.931) (-1121.591) (-1118.603) [-1116.652] * [-1118.522] (-1116.590) (-1115.257) (-1120.451) -- 0:00:08
862000 -- (-1115.558) (-1117.433) [-1116.992] (-1119.755) * [-1120.798] (-1118.938) (-1116.084) (-1117.259) -- 0:00:08
862500 -- (-1121.931) [-1121.317] (-1116.333) (-1115.910) * (-1118.931) (-1120.946) (-1115.896) [-1117.125] -- 0:00:08
863000 -- (-1118.771) (-1117.600) [-1116.044] (-1116.183) * (-1118.795) (-1120.994) [-1118.115] (-1120.396) -- 0:00:08
863500 -- [-1118.375] (-1116.681) (-1122.416) (-1117.919) * (-1118.530) (-1119.267) (-1117.921) [-1119.449] -- 0:00:08
864000 -- (-1118.809) (-1116.382) (-1116.460) [-1117.561] * (-1121.160) [-1116.430] (-1120.204) (-1118.569) -- 0:00:08
864500 -- (-1116.403) [-1116.623] (-1116.509) (-1117.392) * (-1116.517) (-1116.672) [-1116.135] (-1120.730) -- 0:00:08
865000 -- [-1119.653] (-1118.518) (-1116.464) (-1121.442) * (-1116.223) (-1115.364) (-1116.393) [-1118.623] -- 0:00:08
Average standard deviation of split frequencies: 0.008818
865500 -- (-1117.450) [-1116.652] (-1116.334) (-1119.321) * [-1118.368] (-1119.511) (-1116.553) (-1116.949) -- 0:00:08
866000 -- (-1117.030) (-1116.955) [-1115.939] (-1118.184) * (-1118.980) (-1116.993) (-1116.486) [-1116.449] -- 0:00:08
866500 -- (-1115.175) (-1115.866) (-1116.140) [-1116.507] * (-1116.902) (-1116.279) (-1115.953) [-1118.079] -- 0:00:08
867000 -- [-1116.880] (-1117.950) (-1118.459) (-1123.574) * (-1115.697) (-1119.057) (-1117.776) [-1118.651] -- 0:00:08
867500 -- (-1117.209) [-1115.165] (-1117.212) (-1118.098) * [-1115.487] (-1120.565) (-1119.078) (-1116.846) -- 0:00:08
868000 -- (-1116.716) [-1119.200] (-1117.377) (-1117.312) * (-1116.221) (-1117.872) [-1116.297] (-1118.570) -- 0:00:08
868500 -- (-1116.132) [-1116.260] (-1118.143) (-1115.484) * [-1118.485] (-1115.358) (-1117.850) (-1117.725) -- 0:00:08
869000 -- [-1121.384] (-1119.075) (-1121.738) (-1116.047) * (-1117.242) [-1116.753] (-1114.898) (-1116.744) -- 0:00:08
869500 -- (-1118.111) [-1116.891] (-1116.121) (-1118.498) * (-1115.903) [-1117.024] (-1116.409) (-1117.139) -- 0:00:08
870000 -- [-1115.315] (-1117.992) (-1115.691) (-1119.995) * [-1116.286] (-1115.729) (-1117.284) (-1116.867) -- 0:00:08
Average standard deviation of split frequencies: 0.008591
870500 -- [-1115.598] (-1116.456) (-1120.601) (-1121.306) * (-1121.172) (-1116.733) [-1119.339] (-1115.554) -- 0:00:08
871000 -- (-1116.204) [-1115.535] (-1115.491) (-1116.873) * [-1119.765] (-1116.394) (-1116.718) (-1116.189) -- 0:00:07
871500 -- [-1116.141] (-1117.507) (-1118.345) (-1117.914) * (-1122.295) (-1119.489) (-1117.900) [-1116.648] -- 0:00:07
872000 -- (-1117.698) (-1116.932) (-1119.465) [-1123.956] * (-1117.606) (-1119.309) (-1117.190) [-1117.898] -- 0:00:07
872500 -- (-1116.219) (-1118.682) (-1117.031) [-1118.804] * (-1116.939) [-1119.088] (-1117.395) (-1125.025) -- 0:00:07
873000 -- (-1115.035) [-1116.615] (-1117.952) (-1116.614) * (-1118.884) (-1119.606) [-1118.087] (-1117.171) -- 0:00:07
873500 -- (-1115.443) (-1115.379) (-1118.038) [-1115.775] * (-1119.491) (-1120.849) (-1118.260) [-1118.498] -- 0:00:07
874000 -- (-1117.634) (-1116.865) [-1115.152] (-1116.371) * (-1117.202) [-1118.203] (-1125.365) (-1118.325) -- 0:00:07
874500 -- (-1118.122) (-1116.914) [-1115.396] (-1118.900) * (-1121.477) [-1119.430] (-1126.822) (-1119.791) -- 0:00:07
875000 -- (-1118.430) [-1117.294] (-1117.438) (-1117.692) * (-1115.217) [-1117.109] (-1118.409) (-1116.988) -- 0:00:07
Average standard deviation of split frequencies: 0.008251
875500 -- (-1119.405) (-1116.065) (-1116.401) [-1116.680] * [-1116.958] (-1118.252) (-1121.299) (-1117.959) -- 0:00:07
876000 -- (-1117.283) (-1116.747) [-1116.822] (-1119.406) * (-1117.902) (-1121.845) (-1115.592) [-1116.140] -- 0:00:07
876500 -- [-1119.079] (-1117.702) (-1118.488) (-1121.650) * [-1118.016] (-1115.647) (-1116.710) (-1116.362) -- 0:00:07
877000 -- [-1119.186] (-1115.820) (-1116.999) (-1119.372) * [-1117.991] (-1115.693) (-1116.292) (-1117.480) -- 0:00:07
877500 -- (-1118.225) (-1116.565) (-1116.704) [-1119.929] * (-1118.839) (-1115.285) [-1115.181] (-1115.626) -- 0:00:07
878000 -- (-1116.007) (-1117.051) [-1116.374] (-1115.968) * (-1117.550) [-1115.371] (-1116.796) (-1116.870) -- 0:00:07
878500 -- (-1116.643) (-1118.760) [-1118.851] (-1117.026) * (-1119.150) [-1118.529] (-1118.902) (-1119.557) -- 0:00:07
879000 -- (-1117.396) (-1119.861) (-1118.206) [-1117.585] * (-1116.906) (-1116.068) [-1115.504] (-1121.134) -- 0:00:07
879500 -- (-1119.240) (-1120.067) [-1118.866] (-1117.493) * (-1119.420) (-1115.994) (-1115.572) [-1118.711] -- 0:00:07
880000 -- [-1116.512] (-1118.454) (-1118.916) (-1115.284) * (-1117.178) [-1118.282] (-1117.995) (-1116.372) -- 0:00:07
Average standard deviation of split frequencies: 0.008565
880500 -- (-1119.740) (-1117.409) [-1115.892] (-1115.967) * [-1117.562] (-1117.695) (-1118.743) (-1120.067) -- 0:00:07
881000 -- (-1119.672) (-1117.078) (-1115.613) [-1115.108] * (-1117.937) (-1117.611) (-1118.785) [-1118.603] -- 0:00:07
881500 -- (-1119.248) [-1117.985] (-1116.813) (-1117.125) * (-1119.582) (-1118.099) [-1120.033] (-1118.405) -- 0:00:07
882000 -- (-1115.738) (-1116.031) [-1116.764] (-1117.146) * (-1115.918) (-1115.798) [-1115.946] (-1124.416) -- 0:00:07
882500 -- [-1118.051] (-1123.024) (-1117.309) (-1118.659) * (-1117.923) (-1116.656) (-1116.401) [-1115.757] -- 0:00:07
883000 -- [-1116.599] (-1118.257) (-1120.172) (-1116.126) * (-1116.090) (-1116.328) (-1119.781) [-1115.222] -- 0:00:07
883500 -- (-1116.762) (-1123.685) (-1121.404) [-1116.636] * (-1115.920) (-1115.583) (-1121.490) [-1116.093] -- 0:00:07
884000 -- (-1115.772) (-1118.203) [-1115.987] (-1120.313) * (-1123.545) (-1121.364) (-1118.889) [-1117.640] -- 0:00:07
884500 -- (-1116.643) (-1120.696) [-1115.405] (-1117.268) * (-1115.530) [-1115.634] (-1115.708) (-1117.016) -- 0:00:07
885000 -- (-1118.836) (-1120.172) (-1115.028) [-1116.159] * (-1116.331) [-1116.999] (-1121.919) (-1116.052) -- 0:00:07
Average standard deviation of split frequencies: 0.008442
885500 -- [-1118.333] (-1117.405) (-1117.400) (-1116.656) * (-1122.331) (-1116.026) [-1116.715] (-1116.073) -- 0:00:07
886000 -- [-1115.594] (-1116.280) (-1116.492) (-1115.798) * (-1121.955) (-1115.454) (-1115.528) [-1117.063] -- 0:00:07
886500 -- (-1117.675) [-1118.289] (-1116.271) (-1119.015) * (-1119.558) [-1115.576] (-1115.679) (-1118.453) -- 0:00:07
887000 -- [-1116.559] (-1120.926) (-1119.003) (-1118.220) * (-1116.479) (-1115.441) (-1117.665) [-1117.424] -- 0:00:07
887500 -- (-1118.707) (-1115.928) (-1116.118) [-1115.255] * (-1117.687) [-1114.954] (-1116.435) (-1119.553) -- 0:00:06
888000 -- (-1115.898) [-1115.619] (-1117.191) (-1117.931) * (-1119.341) (-1115.199) [-1116.451] (-1120.022) -- 0:00:06
888500 -- (-1119.129) (-1117.648) (-1117.025) [-1119.650] * (-1116.305) [-1115.636] (-1117.028) (-1122.359) -- 0:00:06
889000 -- [-1117.262] (-1121.684) (-1117.146) (-1117.941) * (-1115.381) (-1117.106) [-1121.597] (-1120.848) -- 0:00:06
889500 -- [-1117.030] (-1120.032) (-1118.498) (-1115.787) * (-1119.145) [-1118.573] (-1115.362) (-1119.572) -- 0:00:06
890000 -- (-1118.240) [-1118.102] (-1116.461) (-1117.284) * (-1116.815) (-1115.624) [-1116.240] (-1117.886) -- 0:00:06
Average standard deviation of split frequencies: 0.008257
890500 -- (-1120.412) [-1115.760] (-1117.655) (-1116.746) * (-1117.064) (-1118.927) [-1119.947] (-1121.106) -- 0:00:06
891000 -- (-1115.215) [-1115.680] (-1116.386) (-1116.684) * (-1122.672) (-1116.603) (-1117.521) [-1117.893] -- 0:00:06
891500 -- (-1119.669) [-1116.115] (-1116.769) (-1120.320) * (-1117.316) [-1117.189] (-1117.789) (-1117.660) -- 0:00:06
892000 -- (-1115.620) [-1117.256] (-1116.345) (-1120.568) * (-1116.593) (-1115.311) [-1115.934] (-1115.892) -- 0:00:06
892500 -- [-1118.072] (-1120.388) (-1115.952) (-1116.914) * (-1117.407) [-1115.441] (-1116.276) (-1118.526) -- 0:00:06
893000 -- [-1118.656] (-1117.969) (-1118.510) (-1119.208) * (-1122.647) [-1115.571] (-1115.260) (-1117.471) -- 0:00:06
893500 -- (-1120.277) (-1115.875) (-1118.889) [-1115.990] * (-1117.217) [-1116.037] (-1117.682) (-1116.277) -- 0:00:06
894000 -- [-1117.081] (-1116.799) (-1119.274) (-1115.992) * [-1116.452] (-1117.254) (-1116.147) (-1120.245) -- 0:00:06
894500 -- (-1117.358) (-1115.799) (-1119.427) [-1116.520] * (-1119.712) (-1117.089) [-1116.832] (-1118.301) -- 0:00:06
895000 -- (-1118.428) (-1117.146) [-1116.338] (-1117.844) * (-1123.912) (-1120.906) [-1118.820] (-1117.679) -- 0:00:06
Average standard deviation of split frequencies: 0.007997
895500 -- (-1116.106) (-1115.921) [-1119.201] (-1115.252) * (-1120.469) [-1117.220] (-1116.912) (-1119.208) -- 0:00:06
896000 -- (-1117.887) (-1115.708) (-1120.356) [-1115.801] * (-1118.725) (-1119.390) (-1116.919) [-1116.038] -- 0:00:06
896500 -- (-1118.262) (-1116.761) [-1115.829] (-1118.609) * (-1120.010) (-1116.172) [-1116.246] (-1118.417) -- 0:00:06
897000 -- (-1117.233) (-1116.904) (-1117.180) [-1115.864] * (-1118.993) [-1115.980] (-1119.489) (-1117.430) -- 0:00:06
897500 -- (-1116.732) (-1120.687) (-1119.432) [-1116.423] * (-1119.027) (-1116.086) (-1119.084) [-1119.867] -- 0:00:06
898000 -- [-1117.308] (-1116.531) (-1120.235) (-1116.663) * (-1119.876) [-1117.606] (-1115.519) (-1117.878) -- 0:00:06
898500 -- (-1116.199) (-1116.510) (-1116.781) [-1118.908] * (-1118.963) [-1120.292] (-1118.995) (-1119.312) -- 0:00:06
899000 -- (-1119.088) (-1119.711) [-1119.710] (-1117.271) * (-1115.626) (-1115.207) (-1116.580) [-1115.857] -- 0:00:06
899500 -- (-1117.149) (-1117.280) [-1118.994] (-1117.412) * [-1116.090] (-1115.458) (-1116.830) (-1117.314) -- 0:00:06
900000 -- (-1119.260) (-1117.242) [-1123.654] (-1119.349) * (-1122.181) [-1115.908] (-1117.706) (-1117.904) -- 0:00:06
Average standard deviation of split frequencies: 0.008060
900500 -- (-1116.688) (-1117.728) [-1117.552] (-1117.478) * (-1120.350) [-1115.908] (-1120.089) (-1118.327) -- 0:00:06
901000 -- (-1116.739) (-1122.973) (-1116.907) [-1115.949] * (-1119.937) (-1117.332) (-1121.956) [-1117.251] -- 0:00:06
901500 -- (-1116.199) (-1117.765) [-1118.762] (-1117.485) * (-1115.944) (-1116.738) [-1116.842] (-1116.171) -- 0:00:06
902000 -- (-1116.670) (-1120.033) (-1118.922) [-1119.175] * (-1116.365) (-1116.244) [-1115.943] (-1117.406) -- 0:00:06
902500 -- (-1118.267) [-1117.408] (-1120.399) (-1116.970) * (-1119.683) (-1116.514) (-1115.395) [-1117.061] -- 0:00:06
903000 -- (-1120.458) [-1116.880] (-1118.207) (-1124.388) * [-1117.905] (-1116.364) (-1115.788) (-1116.993) -- 0:00:06
903500 -- (-1118.201) (-1117.903) (-1116.607) [-1120.563] * (-1117.897) (-1115.265) (-1116.845) [-1117.984] -- 0:00:05
904000 -- [-1118.386] (-1115.249) (-1117.775) (-1118.880) * (-1122.770) [-1115.265] (-1115.526) (-1117.548) -- 0:00:05
904500 -- [-1116.170] (-1117.346) (-1118.691) (-1119.753) * (-1116.834) [-1114.992] (-1115.861) (-1118.456) -- 0:00:05
905000 -- (-1117.256) [-1118.105] (-1117.803) (-1121.911) * (-1117.330) (-1119.615) [-1115.910] (-1118.975) -- 0:00:05
Average standard deviation of split frequencies: 0.008290
905500 -- (-1119.674) (-1118.987) [-1116.079] (-1123.002) * (-1115.680) [-1115.924] (-1116.596) (-1120.325) -- 0:00:05
906000 -- (-1117.603) [-1117.676] (-1116.868) (-1117.868) * (-1116.833) (-1121.481) (-1116.854) [-1116.707] -- 0:00:05
906500 -- (-1117.781) [-1116.986] (-1115.394) (-1116.402) * [-1116.497] (-1118.927) (-1120.226) (-1116.577) -- 0:00:05
907000 -- (-1116.282) [-1116.932] (-1116.364) (-1117.128) * (-1119.093) [-1117.809] (-1117.571) (-1117.648) -- 0:00:05
907500 -- [-1115.269] (-1117.290) (-1118.825) (-1117.437) * (-1115.240) (-1116.814) (-1115.570) [-1117.589] -- 0:00:05
908000 -- (-1117.249) (-1117.290) (-1117.463) [-1116.405] * (-1115.083) (-1119.229) [-1117.522] (-1117.319) -- 0:00:05
908500 -- (-1119.171) (-1116.886) [-1117.144] (-1116.882) * (-1115.735) [-1117.126] (-1120.877) (-1118.100) -- 0:00:05
909000 -- (-1115.484) (-1118.656) [-1117.152] (-1118.401) * (-1116.807) [-1116.877] (-1117.301) (-1119.392) -- 0:00:05
909500 -- [-1115.389] (-1116.843) (-1115.379) (-1119.855) * (-1116.037) (-1119.679) [-1116.564] (-1116.402) -- 0:00:05
910000 -- (-1116.472) (-1116.491) [-1115.914] (-1118.008) * (-1116.194) (-1116.654) (-1119.317) [-1117.111] -- 0:00:05
Average standard deviation of split frequencies: 0.007868
910500 -- (-1117.144) [-1117.971] (-1120.727) (-1122.420) * (-1116.979) (-1116.394) (-1116.472) [-1116.007] -- 0:00:05
911000 -- (-1116.698) (-1116.346) [-1117.331] (-1117.616) * (-1116.223) [-1120.092] (-1115.408) (-1116.692) -- 0:00:05
911500 -- (-1116.728) [-1116.650] (-1123.305) (-1116.730) * [-1116.535] (-1118.061) (-1115.010) (-1118.066) -- 0:00:05
912000 -- (-1117.449) (-1115.744) [-1117.596] (-1117.918) * (-1119.481) [-1117.717] (-1117.722) (-1118.847) -- 0:00:05
912500 -- (-1118.799) (-1117.346) [-1116.515] (-1120.793) * [-1119.088] (-1118.175) (-1119.823) (-1121.241) -- 0:00:05
913000 -- [-1119.786] (-1117.000) (-1116.861) (-1120.228) * (-1117.027) [-1118.509] (-1124.646) (-1119.654) -- 0:00:05
913500 -- (-1117.504) (-1117.484) [-1116.962] (-1118.208) * [-1116.255] (-1119.068) (-1115.398) (-1117.556) -- 0:00:05
914000 -- (-1116.230) (-1115.549) (-1117.749) [-1116.451] * (-1119.472) [-1118.859] (-1120.243) (-1115.878) -- 0:00:05
914500 -- (-1115.597) [-1115.829] (-1117.412) (-1116.453) * (-1118.635) [-1119.489] (-1119.449) (-1116.277) -- 0:00:05
915000 -- [-1115.610] (-1115.778) (-1118.354) (-1117.956) * (-1117.209) [-1118.112] (-1116.476) (-1117.125) -- 0:00:05
Average standard deviation of split frequencies: 0.007514
915500 -- (-1118.296) (-1116.258) (-1119.512) [-1116.693] * (-1119.190) [-1118.002] (-1115.465) (-1119.305) -- 0:00:05
916000 -- [-1117.190] (-1116.047) (-1116.925) (-1115.818) * (-1117.082) (-1117.921) [-1116.080] (-1118.511) -- 0:00:05
916500 -- (-1117.259) (-1115.621) (-1120.652) [-1116.719] * (-1117.073) (-1116.132) (-1117.144) [-1117.008] -- 0:00:05
917000 -- (-1116.041) (-1115.350) (-1120.684) [-1115.430] * (-1115.775) [-1116.154] (-1116.912) (-1116.050) -- 0:00:05
917500 -- (-1116.784) [-1118.095] (-1120.984) (-1116.752) * (-1116.293) [-1115.962] (-1117.859) (-1115.797) -- 0:00:05
918000 -- (-1119.382) (-1118.007) (-1117.209) [-1117.078] * (-1118.784) (-1115.798) (-1115.588) [-1116.899] -- 0:00:05
918500 -- [-1117.824] (-1115.886) (-1121.083) (-1116.279) * [-1117.363] (-1119.332) (-1115.600) (-1119.566) -- 0:00:05
919000 -- (-1116.614) (-1117.049) [-1116.524] (-1115.892) * [-1115.552] (-1122.527) (-1117.252) (-1117.082) -- 0:00:05
919500 -- (-1117.272) (-1118.234) [-1115.136] (-1117.945) * (-1116.713) (-1117.200) [-1117.328] (-1116.251) -- 0:00:04
920000 -- [-1116.287] (-1119.014) (-1122.313) (-1118.534) * (-1118.893) [-1117.808] (-1116.528) (-1117.514) -- 0:00:04
Average standard deviation of split frequencies: 0.007032
920500 -- [-1119.509] (-1118.275) (-1118.538) (-1116.538) * (-1115.893) [-1117.278] (-1117.667) (-1115.298) -- 0:00:04
921000 -- [-1118.154] (-1116.816) (-1120.602) (-1117.593) * (-1115.485) (-1115.807) [-1117.986] (-1115.147) -- 0:00:04
921500 -- [-1117.219] (-1117.006) (-1120.214) (-1118.240) * (-1115.720) (-1115.825) (-1116.992) [-1120.175] -- 0:00:04
922000 -- (-1115.488) [-1116.299] (-1116.647) (-1115.715) * [-1116.290] (-1115.917) (-1117.314) (-1117.409) -- 0:00:04
922500 -- [-1115.532] (-1116.299) (-1116.603) (-1117.085) * [-1117.941] (-1121.067) (-1116.976) (-1120.302) -- 0:00:04
923000 -- (-1116.172) [-1116.224] (-1118.616) (-1115.507) * [-1120.400] (-1117.920) (-1115.270) (-1118.317) -- 0:00:04
923500 -- (-1115.810) (-1118.068) (-1117.497) [-1115.286] * (-1116.663) [-1115.763] (-1116.039) (-1117.554) -- 0:00:04
924000 -- (-1117.361) (-1117.966) [-1115.034] (-1116.905) * (-1118.799) (-1114.861) (-1115.315) [-1118.145] -- 0:00:04
924500 -- (-1118.568) (-1115.837) [-1115.367] (-1116.652) * (-1118.651) (-1116.135) (-1115.283) [-1115.282] -- 0:00:04
925000 -- (-1118.961) [-1116.751] (-1116.257) (-1117.846) * [-1117.524] (-1115.688) (-1115.354) (-1118.995) -- 0:00:04
Average standard deviation of split frequencies: 0.006856
925500 -- [-1119.654] (-1116.547) (-1116.731) (-1116.896) * [-1116.843] (-1115.731) (-1116.012) (-1115.801) -- 0:00:04
926000 -- (-1115.229) [-1116.933] (-1117.084) (-1116.764) * (-1117.613) (-1117.892) (-1118.121) [-1116.752] -- 0:00:04
926500 -- (-1114.993) [-1116.753] (-1119.420) (-1117.878) * (-1118.467) [-1120.950] (-1122.224) (-1116.848) -- 0:00:04
927000 -- [-1116.915] (-1117.365) (-1117.708) (-1115.666) * (-1116.825) (-1121.817) (-1122.686) [-1116.746] -- 0:00:04
927500 -- (-1116.466) [-1117.484] (-1117.641) (-1116.857) * (-1118.330) [-1117.482] (-1116.006) (-1117.072) -- 0:00:04
928000 -- (-1117.643) [-1115.456] (-1117.770) (-1115.424) * (-1119.658) (-1119.069) (-1115.895) [-1118.776] -- 0:00:04
928500 -- [-1116.633] (-1116.314) (-1119.133) (-1116.321) * (-1118.739) (-1118.842) [-1117.141] (-1119.281) -- 0:00:04
929000 -- (-1115.864) [-1115.203] (-1116.921) (-1118.048) * (-1117.783) (-1124.062) [-1116.231] (-1125.052) -- 0:00:04
929500 -- (-1117.852) (-1115.924) [-1118.064] (-1116.966) * (-1118.354) (-1116.167) [-1117.146] (-1118.285) -- 0:00:04
930000 -- (-1120.174) (-1115.289) (-1115.360) [-1116.411] * (-1119.440) [-1116.814] (-1115.187) (-1117.744) -- 0:00:04
Average standard deviation of split frequencies: 0.006619
930500 -- [-1117.796] (-1116.052) (-1116.066) (-1117.484) * (-1124.047) (-1116.496) (-1114.949) [-1123.020] -- 0:00:04
931000 -- (-1116.809) (-1117.316) [-1115.990] (-1117.573) * (-1121.575) (-1117.677) (-1115.333) [-1117.106] -- 0:00:04
931500 -- [-1115.973] (-1117.003) (-1116.098) (-1119.605) * (-1118.007) (-1117.624) [-1115.899] (-1117.304) -- 0:00:04
932000 -- (-1116.754) (-1120.661) (-1116.514) [-1118.218] * (-1117.143) (-1118.319) (-1121.192) [-1115.494] -- 0:00:04
932500 -- [-1114.825] (-1119.647) (-1116.293) (-1119.265) * (-1120.166) (-1119.637) [-1115.701] (-1115.633) -- 0:00:04
933000 -- (-1117.696) (-1121.486) [-1118.126] (-1120.140) * (-1117.605) (-1118.980) (-1116.549) [-1115.984] -- 0:00:04
933500 -- (-1116.483) (-1121.048) (-1117.027) [-1123.727] * [-1115.454] (-1116.255) (-1116.886) (-1116.766) -- 0:00:04
934000 -- (-1115.432) [-1119.981] (-1115.946) (-1120.283) * (-1116.001) (-1118.383) (-1117.377) [-1117.271] -- 0:00:04
934500 -- (-1115.619) (-1120.502) (-1119.829) [-1118.004] * [-1118.608] (-1118.322) (-1116.311) (-1121.050) -- 0:00:04
935000 -- (-1116.149) (-1117.571) (-1120.004) [-1118.604] * (-1120.632) (-1118.952) [-1116.251] (-1118.833) -- 0:00:04
Average standard deviation of split frequencies: 0.006917
935500 -- (-1115.627) (-1118.377) [-1116.398] (-1115.071) * (-1116.707) [-1116.331] (-1115.832) (-1117.511) -- 0:00:03
936000 -- (-1115.194) (-1117.214) (-1115.866) [-1115.868] * (-1115.595) (-1118.663) (-1118.384) [-1115.655] -- 0:00:03
936500 -- (-1117.828) [-1117.340] (-1116.742) (-1119.432) * [-1118.667] (-1115.109) (-1118.089) (-1119.891) -- 0:00:03
937000 -- [-1116.940] (-1117.675) (-1117.302) (-1117.656) * (-1116.987) [-1115.695] (-1118.556) (-1120.975) -- 0:00:03
937500 -- (-1117.102) (-1118.668) (-1117.509) [-1117.436] * [-1118.323] (-1119.448) (-1116.408) (-1118.177) -- 0:00:03
938000 -- [-1116.570] (-1121.321) (-1117.405) (-1117.333) * [-1117.860] (-1117.952) (-1118.106) (-1121.420) -- 0:00:03
938500 -- (-1115.072) [-1118.688] (-1116.431) (-1124.652) * [-1115.474] (-1115.835) (-1116.192) (-1120.475) -- 0:00:03
939000 -- (-1115.136) [-1115.426] (-1117.025) (-1117.864) * (-1115.388) (-1116.342) [-1115.076] (-1121.054) -- 0:00:03
939500 -- (-1117.225) (-1117.763) [-1116.791] (-1120.061) * (-1117.139) (-1118.159) (-1117.669) [-1119.319] -- 0:00:03
940000 -- (-1117.560) (-1116.726) [-1117.153] (-1116.862) * [-1116.306] (-1117.045) (-1115.478) (-1117.440) -- 0:00:03
Average standard deviation of split frequencies: 0.007049
940500 -- [-1117.857] (-1121.926) (-1117.555) (-1119.190) * (-1118.046) (-1119.899) (-1116.162) [-1119.679] -- 0:00:03
941000 -- (-1115.506) [-1123.296] (-1116.215) (-1118.410) * (-1116.457) (-1116.062) [-1115.580] (-1115.751) -- 0:00:03
941500 -- [-1117.216] (-1115.458) (-1117.438) (-1116.572) * (-1115.789) [-1122.721] (-1120.816) (-1115.646) -- 0:00:03
942000 -- [-1116.757] (-1118.699) (-1115.527) (-1117.606) * (-1115.086) (-1116.055) [-1117.632] (-1115.424) -- 0:00:03
942500 -- (-1118.285) (-1123.225) [-1115.740] (-1115.038) * (-1115.327) (-1116.765) [-1115.414] (-1115.163) -- 0:00:03
943000 -- [-1116.154] (-1121.002) (-1118.779) (-1120.935) * (-1117.480) [-1115.637] (-1118.419) (-1115.145) -- 0:00:03
943500 -- (-1115.812) [-1117.637] (-1117.875) (-1116.496) * (-1116.480) (-1116.240) [-1115.233] (-1117.206) -- 0:00:03
944000 -- (-1117.025) [-1115.718] (-1115.381) (-1115.404) * [-1118.347] (-1116.447) (-1115.738) (-1116.336) -- 0:00:03
944500 -- (-1117.943) (-1120.302) [-1115.273] (-1115.992) * (-1118.091) [-1118.484] (-1118.543) (-1117.566) -- 0:00:03
945000 -- [-1116.799] (-1116.700) (-1121.421) (-1115.639) * (-1116.764) [-1116.094] (-1117.145) (-1118.325) -- 0:00:03
Average standard deviation of split frequencies: 0.006910
945500 -- (-1116.540) (-1118.528) [-1116.216] (-1117.296) * (-1117.885) (-1121.615) [-1117.824] (-1117.415) -- 0:00:03
946000 -- (-1117.059) [-1116.005] (-1115.942) (-1114.877) * (-1115.983) [-1116.766] (-1118.391) (-1116.357) -- 0:00:03
946500 -- [-1116.126] (-1116.384) (-1117.720) (-1116.211) * [-1117.698] (-1116.311) (-1118.126) (-1119.734) -- 0:00:03
947000 -- (-1118.689) [-1115.887] (-1120.337) (-1116.208) * (-1117.547) (-1118.329) [-1116.078] (-1116.667) -- 0:00:03
947500 -- (-1117.629) [-1115.513] (-1120.219) (-1116.360) * (-1118.681) (-1118.541) [-1116.789] (-1118.017) -- 0:00:03
948000 -- (-1115.434) (-1115.201) [-1120.267] (-1120.446) * (-1116.603) (-1117.897) (-1118.251) [-1115.756] -- 0:00:03
948500 -- (-1116.862) [-1115.349] (-1116.110) (-1116.425) * (-1116.335) [-1119.480] (-1116.449) (-1120.547) -- 0:00:03
949000 -- (-1117.454) (-1118.218) [-1116.007] (-1120.755) * (-1116.718) (-1118.558) (-1119.366) [-1115.554] -- 0:00:03
949500 -- (-1119.588) (-1115.825) (-1116.407) [-1115.825] * (-1119.834) [-1115.356] (-1117.865) (-1116.974) -- 0:00:03
950000 -- (-1118.317) [-1123.386] (-1116.165) (-1115.956) * (-1117.877) [-1118.163] (-1117.059) (-1120.444) -- 0:00:03
Average standard deviation of split frequencies: 0.006810
950500 -- (-1117.531) (-1119.363) (-1116.082) [-1115.488] * [-1117.402] (-1115.494) (-1119.826) (-1123.420) -- 0:00:03
951000 -- (-1116.846) [-1115.841] (-1116.212) (-1115.514) * (-1120.972) [-1116.431] (-1118.813) (-1115.318) -- 0:00:03
951500 -- [-1116.957] (-1119.067) (-1116.420) (-1118.320) * (-1118.025) (-1119.581) (-1115.846) [-1119.877] -- 0:00:03
952000 -- (-1116.632) [-1115.263] (-1116.359) (-1116.089) * (-1118.569) [-1118.651] (-1116.939) (-1117.941) -- 0:00:02
952500 -- [-1118.944] (-1115.145) (-1114.747) (-1120.090) * [-1116.280] (-1119.291) (-1121.969) (-1115.241) -- 0:00:02
953000 -- (-1118.262) (-1117.952) [-1115.176] (-1114.961) * (-1116.371) (-1115.132) (-1117.130) [-1115.595] -- 0:00:02
953500 -- [-1118.097] (-1116.355) (-1115.102) (-1115.413) * (-1116.699) [-1115.675] (-1118.379) (-1115.770) -- 0:00:02
954000 -- [-1117.848] (-1116.744) (-1115.725) (-1116.704) * (-1118.636) (-1117.044) [-1117.200] (-1115.534) -- 0:00:02
954500 -- [-1118.269] (-1122.429) (-1116.845) (-1118.167) * [-1117.848] (-1120.627) (-1121.408) (-1115.838) -- 0:00:02
955000 -- [-1116.385] (-1118.655) (-1116.931) (-1115.279) * (-1118.061) [-1117.811] (-1115.821) (-1116.357) -- 0:00:02
Average standard deviation of split frequencies: 0.006509
955500 -- [-1117.212] (-1120.756) (-1116.737) (-1118.415) * [-1116.811] (-1116.405) (-1115.918) (-1115.837) -- 0:00:02
956000 -- [-1116.146] (-1121.114) (-1116.342) (-1117.396) * [-1115.934] (-1115.616) (-1121.352) (-1115.826) -- 0:00:02
956500 -- (-1121.167) (-1116.880) [-1116.033] (-1119.340) * (-1122.606) (-1115.689) [-1116.440] (-1115.080) -- 0:00:02
957000 -- [-1116.415] (-1115.895) (-1116.616) (-1116.037) * (-1116.443) (-1116.201) (-1115.382) [-1115.056] -- 0:00:02
957500 -- [-1115.527] (-1117.170) (-1116.476) (-1115.412) * (-1117.945) (-1116.806) [-1115.183] (-1115.540) -- 0:00:02
958000 -- (-1117.199) (-1117.346) (-1115.059) [-1115.468] * [-1114.942] (-1115.818) (-1115.588) (-1116.796) -- 0:00:02
958500 -- [-1115.720] (-1118.240) (-1116.233) (-1116.255) * [-1115.887] (-1115.170) (-1116.295) (-1121.085) -- 0:00:02
959000 -- (-1117.100) (-1118.382) (-1116.149) [-1114.772] * (-1115.570) [-1117.244] (-1116.692) (-1117.476) -- 0:00:02
959500 -- [-1116.208] (-1116.891) (-1115.792) (-1116.243) * (-1117.216) [-1117.091] (-1117.965) (-1116.573) -- 0:00:02
960000 -- (-1116.183) (-1117.596) (-1116.458) [-1116.646] * [-1118.465] (-1117.226) (-1116.517) (-1117.644) -- 0:00:02
Average standard deviation of split frequencies: 0.006608
960500 -- (-1119.179) [-1117.504] (-1117.323) (-1117.637) * (-1117.255) (-1116.614) [-1117.120] (-1116.773) -- 0:00:02
961000 -- [-1117.527] (-1116.216) (-1115.600) (-1117.188) * (-1117.091) (-1118.794) [-1117.035] (-1118.798) -- 0:00:02
961500 -- (-1120.352) (-1118.816) (-1115.592) [-1117.741] * (-1117.122) (-1117.745) [-1119.039] (-1119.287) -- 0:00:02
962000 -- (-1116.092) [-1117.538] (-1116.869) (-1120.545) * [-1115.579] (-1115.632) (-1118.017) (-1119.491) -- 0:00:02
962500 -- [-1120.115] (-1116.727) (-1119.658) (-1118.044) * [-1116.752] (-1116.091) (-1117.274) (-1119.258) -- 0:00:02
963000 -- (-1118.492) [-1117.245] (-1118.286) (-1121.626) * (-1115.408) (-1118.551) (-1116.374) [-1117.502] -- 0:00:02
963500 -- [-1117.190] (-1121.064) (-1118.733) (-1116.247) * [-1119.082] (-1116.762) (-1116.038) (-1115.636) -- 0:00:02
964000 -- (-1119.101) (-1118.668) [-1116.683] (-1115.416) * (-1118.897) (-1116.922) [-1115.721] (-1116.464) -- 0:00:02
964500 -- [-1116.616] (-1116.683) (-1118.814) (-1116.149) * (-1116.750) [-1118.113] (-1115.741) (-1116.046) -- 0:00:02
965000 -- (-1116.462) (-1118.836) (-1119.976) [-1116.469] * (-1117.546) [-1115.437] (-1116.646) (-1119.473) -- 0:00:02
Average standard deviation of split frequencies: 0.006930
965500 -- (-1117.159) [-1118.074] (-1118.066) (-1120.121) * (-1117.631) [-1115.706] (-1116.575) (-1117.023) -- 0:00:02
966000 -- (-1117.484) (-1117.655) (-1120.347) [-1119.724] * (-1117.621) (-1116.114) (-1117.585) [-1115.768] -- 0:00:02
966500 -- (-1116.600) (-1116.998) (-1115.002) [-1116.880] * (-1116.122) (-1115.349) (-1116.327) [-1115.537] -- 0:00:02
967000 -- (-1116.050) (-1116.189) [-1115.027] (-1117.671) * (-1115.344) (-1116.313) [-1116.819] (-1118.736) -- 0:00:02
967500 -- (-1117.220) [-1115.673] (-1117.798) (-1117.992) * (-1115.326) (-1116.594) (-1116.331) [-1116.247] -- 0:00:02
968000 -- [-1116.473] (-1116.432) (-1117.936) (-1115.227) * (-1116.250) (-1117.379) [-1116.482] (-1116.535) -- 0:00:01
968500 -- (-1116.234) (-1120.765) (-1116.631) [-1117.594] * (-1117.843) (-1118.842) (-1117.148) [-1115.905] -- 0:00:01
969000 -- [-1116.927] (-1117.972) (-1117.342) (-1115.966) * (-1118.034) [-1118.503] (-1117.736) (-1115.682) -- 0:00:01
969500 -- (-1120.772) (-1119.008) [-1117.747] (-1119.027) * (-1118.178) [-1118.058] (-1118.305) (-1115.821) -- 0:00:01
970000 -- (-1117.782) (-1115.708) [-1119.603] (-1116.288) * (-1116.843) [-1116.156] (-1117.864) (-1115.836) -- 0:00:01
Average standard deviation of split frequencies: 0.006993
970500 -- (-1117.738) (-1118.600) [-1116.348] (-1115.299) * [-1117.159] (-1119.787) (-1116.181) (-1123.593) -- 0:00:01
971000 -- (-1117.244) (-1119.194) [-1120.647] (-1116.251) * (-1115.774) [-1115.484] (-1116.573) (-1120.569) -- 0:00:01
971500 -- (-1117.689) (-1121.210) [-1118.222] (-1115.504) * (-1116.773) [-1115.695] (-1119.828) (-1115.158) -- 0:00:01
972000 -- (-1122.488) (-1118.784) [-1118.303] (-1119.726) * [-1117.506] (-1115.983) (-1120.266) (-1117.722) -- 0:00:01
972500 -- [-1116.023] (-1118.055) (-1117.371) (-1115.658) * (-1116.895) [-1116.283] (-1115.967) (-1116.893) -- 0:00:01
973000 -- (-1115.828) [-1118.715] (-1115.186) (-1117.039) * (-1116.862) (-1117.327) (-1116.287) [-1117.605] -- 0:00:01
973500 -- (-1118.011) (-1117.413) [-1117.049] (-1116.950) * (-1117.596) (-1116.694) (-1116.790) [-1118.034] -- 0:00:01
974000 -- [-1118.097] (-1117.662) (-1120.317) (-1117.484) * [-1117.469] (-1116.154) (-1120.886) (-1117.569) -- 0:00:01
974500 -- (-1119.987) (-1117.608) [-1116.130] (-1116.144) * (-1116.489) (-1115.736) (-1116.529) [-1117.695] -- 0:00:01
975000 -- (-1117.418) (-1115.872) [-1116.500] (-1116.262) * (-1117.007) [-1116.047] (-1117.446) (-1117.083) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
975500 -- (-1118.458) (-1120.255) [-1116.331] (-1117.950) * (-1119.328) [-1115.374] (-1115.510) (-1117.741) -- 0:00:01
976000 -- (-1116.652) [-1119.474] (-1117.360) (-1115.304) * (-1119.061) (-1116.549) [-1121.075] (-1119.021) -- 0:00:01
976500 -- (-1118.286) (-1118.216) [-1118.042] (-1116.451) * [-1116.371] (-1116.987) (-1120.659) (-1115.831) -- 0:00:01
977000 -- (-1116.800) [-1116.367] (-1117.845) (-1117.706) * (-1115.575) (-1117.773) (-1120.451) [-1115.811] -- 0:00:01
977500 -- [-1117.046] (-1118.843) (-1117.127) (-1116.305) * (-1116.549) (-1116.834) [-1116.088] (-1116.258) -- 0:00:01
978000 -- (-1116.615) [-1118.673] (-1115.804) (-1118.784) * (-1115.766) (-1118.120) (-1117.349) [-1116.052] -- 0:00:01
978500 -- (-1121.751) (-1121.110) [-1117.112] (-1120.407) * (-1116.089) (-1116.311) [-1117.132] (-1116.556) -- 0:00:01
979000 -- (-1119.484) (-1117.649) [-1119.750] (-1119.845) * (-1117.042) [-1116.631] (-1117.107) (-1116.840) -- 0:00:01
979500 -- (-1117.202) (-1117.632) (-1118.679) [-1117.827] * (-1118.953) (-1117.367) (-1118.294) [-1115.129] -- 0:00:01
980000 -- [-1116.288] (-1117.697) (-1118.061) (-1117.715) * (-1117.727) (-1117.030) [-1116.266] (-1117.723) -- 0:00:01
Average standard deviation of split frequencies: 0.006634
980500 -- (-1115.671) (-1119.868) [-1115.942] (-1120.836) * [-1117.148] (-1117.366) (-1117.788) (-1118.389) -- 0:00:01
981000 -- [-1116.486] (-1116.395) (-1116.373) (-1118.993) * (-1116.689) (-1115.430) (-1121.507) [-1118.552] -- 0:00:01
981500 -- (-1116.271) [-1116.656] (-1116.017) (-1116.005) * (-1118.086) [-1117.633] (-1118.676) (-1116.558) -- 0:00:01
982000 -- (-1115.902) (-1121.631) (-1118.059) [-1116.006] * (-1117.993) [-1115.946] (-1118.585) (-1117.151) -- 0:00:01
982500 -- (-1115.871) (-1118.249) (-1117.478) [-1118.338] * (-1116.541) (-1117.892) (-1115.656) [-1116.336] -- 0:00:01
983000 -- (-1120.772) (-1116.528) [-1119.261] (-1117.609) * (-1115.882) (-1117.017) (-1117.734) [-1116.015] -- 0:00:01
983500 -- [-1121.445] (-1116.149) (-1117.681) (-1117.541) * (-1114.883) (-1119.267) (-1119.685) [-1118.218] -- 0:00:01
984000 -- (-1121.441) [-1117.021] (-1117.753) (-1121.156) * (-1118.149) [-1116.482] (-1116.419) (-1118.270) -- 0:00:00
984500 -- [-1116.684] (-1116.922) (-1119.240) (-1118.240) * [-1116.954] (-1118.083) (-1116.264) (-1119.643) -- 0:00:00
985000 -- (-1120.178) (-1115.803) (-1116.061) [-1117.130] * [-1115.991] (-1117.383) (-1118.636) (-1116.427) -- 0:00:00
Average standard deviation of split frequencies: 0.006885
985500 -- (-1120.193) (-1118.212) (-1116.895) [-1117.279] * (-1117.135) [-1115.493] (-1116.788) (-1116.082) -- 0:00:00
986000 -- [-1117.256] (-1118.054) (-1119.397) (-1118.716) * [-1116.642] (-1117.015) (-1116.378) (-1117.283) -- 0:00:00
986500 -- (-1119.528) [-1116.019] (-1121.021) (-1115.059) * (-1121.579) (-1118.047) [-1115.873] (-1118.452) -- 0:00:00
987000 -- (-1115.923) (-1116.259) (-1117.381) [-1115.494] * [-1115.584] (-1116.418) (-1116.692) (-1116.049) -- 0:00:00
987500 -- [-1116.609] (-1118.669) (-1117.492) (-1116.032) * (-1116.089) (-1121.140) [-1116.729] (-1119.355) -- 0:00:00
988000 -- (-1116.146) (-1118.928) (-1118.210) [-1115.995] * (-1117.478) (-1120.525) [-1119.542] (-1119.790) -- 0:00:00
988500 -- (-1115.506) (-1121.254) [-1117.364] (-1115.619) * (-1116.583) [-1117.237] (-1120.721) (-1120.545) -- 0:00:00
989000 -- (-1120.518) (-1119.719) (-1117.292) [-1117.576] * (-1121.185) (-1118.437) [-1119.194] (-1120.486) -- 0:00:00
989500 -- (-1120.821) (-1115.457) [-1117.210] (-1117.617) * (-1116.720) [-1117.701] (-1118.694) (-1117.784) -- 0:00:00
990000 -- (-1115.890) [-1115.801] (-1115.831) (-1119.318) * [-1116.912] (-1119.117) (-1115.822) (-1116.976) -- 0:00:00
Average standard deviation of split frequencies: 0.006694
990500 -- (-1116.729) (-1116.738) [-1116.939] (-1118.122) * (-1115.947) [-1119.910] (-1116.956) (-1115.679) -- 0:00:00
991000 -- [-1116.461] (-1120.269) (-1117.384) (-1118.382) * (-1117.657) (-1116.485) [-1116.928] (-1117.198) -- 0:00:00
991500 -- (-1119.450) [-1116.036] (-1116.533) (-1116.073) * (-1117.072) (-1115.798) [-1115.764] (-1115.392) -- 0:00:00
992000 -- (-1117.797) (-1116.854) [-1117.689] (-1116.400) * (-1118.423) (-1115.830) (-1118.119) [-1117.300] -- 0:00:00
992500 -- (-1117.165) (-1117.290) (-1117.180) [-1118.313] * (-1119.118) [-1117.175] (-1125.251) (-1116.539) -- 0:00:00
993000 -- (-1116.344) [-1119.408] (-1117.698) (-1123.712) * [-1116.466] (-1117.447) (-1121.560) (-1116.527) -- 0:00:00
993500 -- (-1116.124) (-1115.932) [-1118.493] (-1116.035) * [-1118.682] (-1119.338) (-1119.905) (-1116.119) -- 0:00:00
994000 -- (-1116.643) [-1115.853] (-1116.740) (-1115.727) * (-1116.356) (-1117.238) (-1117.115) [-1116.098] -- 0:00:00
994500 -- (-1118.000) [-1116.981] (-1117.719) (-1115.491) * (-1118.942) (-1118.130) (-1117.920) [-1116.529] -- 0:00:00
995000 -- [-1117.186] (-1115.729) (-1115.176) (-1119.220) * [-1120.866] (-1116.834) (-1118.465) (-1115.784) -- 0:00:00
Average standard deviation of split frequencies: 0.006532
995500 -- (-1117.522) (-1120.124) [-1115.850] (-1119.226) * (-1119.716) (-1116.637) [-1116.128] (-1116.965) -- 0:00:00
996000 -- [-1117.728] (-1117.835) (-1119.281) (-1116.593) * (-1119.234) (-1115.362) (-1118.778) [-1115.973] -- 0:00:00
996500 -- (-1116.155) [-1120.690] (-1116.275) (-1119.389) * [-1115.988] (-1116.771) (-1116.384) (-1116.884) -- 0:00:00
997000 -- [-1118.523] (-1118.681) (-1116.751) (-1119.339) * [-1116.743] (-1118.398) (-1119.564) (-1116.327) -- 0:00:00
997500 -- (-1115.422) [-1117.079] (-1116.533) (-1115.763) * [-1115.012] (-1116.088) (-1116.322) (-1116.844) -- 0:00:00
998000 -- (-1120.611) (-1117.234) (-1116.518) [-1116.787] * (-1116.432) (-1117.154) [-1118.283] (-1118.515) -- 0:00:00
998500 -- [-1119.768] (-1116.519) (-1120.121) (-1123.577) * (-1118.194) (-1116.364) [-1118.806] (-1115.623) -- 0:00:00
999000 -- (-1116.250) (-1119.430) (-1115.568) [-1117.192] * (-1117.088) (-1117.924) (-1116.549) [-1117.533] -- 0:00:00
999500 -- (-1117.998) (-1116.167) [-1116.597] (-1116.108) * (-1117.419) (-1119.398) (-1116.534) [-1115.459] -- 0:00:00
1000000 -- (-1116.500) (-1119.202) (-1120.000) [-1116.243] * [-1117.648] (-1117.411) (-1118.889) (-1115.347) -- 0:00:00
Average standard deviation of split frequencies: 0.006344
Analysis completed in 1 mins 2 seconds
Analysis used 60.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1114.74
Likelihood of best state for "cold" chain of run 2 was -1114.74
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.0 % ( 56 %) Dirichlet(Revmat{all})
100.0 % ( 99 %) Slider(Revmat{all})
26.9 % ( 28 %) Dirichlet(Pi{all})
28.5 % ( 32 %) Slider(Pi{all})
79.2 % ( 52 %) Multiplier(Alpha{1,2})
77.7 % ( 52 %) Multiplier(Alpha{3})
20.1 % ( 33 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 24 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.2 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
26.7 % ( 22 %) Dirichlet(Pi{all})
28.3 % ( 25 %) Slider(Pi{all})
78.9 % ( 58 %) Multiplier(Alpha{1,2})
77.2 % ( 59 %) Multiplier(Alpha{3})
18.8 % ( 26 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 73 %) ExtTBR(Tau{all},V{all})
100.0 % ( 99 %) NNI(Tau{all},V{all})
89.4 % ( 92 %) ParsSPR(Tau{all},V{all})
28.2 % ( 22 %) Multiplier(V{all})
97.3 % (100 %) Nodeslider(V{all})
30.8 % ( 33 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167072 0.82 0.67
3 | 166793 166990 0.83
4 | 166609 166273 166263
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166356 0.82 0.67
3 | 166256 167020 0.84
4 | 167364 166586 166418
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1116.46
| 1 |
| 1 2 1 2 |
| 221 21 2 |
|2 2 2 1 2 2 112 |
| *2 2 1 1 1 2 2 |
|1 2 1 1 1 2 2 1 2 2 1 2 21 |
| 2 1 1 2 1 2 1 1 1 * 22 |
| 1 2 *2 1 112 1 *1 11 |
| 12 2 222 1 2 1 2 2*1 1 1 1*|
| 22 2 1 1 1 2 1 12 1 |
| 1 1 2 2 2 2 2 2 |
| 2 1 |
| 2 22 |
| 1 1 1 |
| 1 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1118.07
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1116.47 -1119.77
2 -1116.44 -1119.22
--------------------------------------
TOTAL -1116.45 -1119.53
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.895727 0.093830 0.350791 1.510121 0.862087 1501.00 1501.00 1.000
r(A<->C){all} 0.156590 0.019248 0.000087 0.434955 0.115089 242.32 326.47 1.005
r(A<->G){all} 0.177462 0.021775 0.000082 0.475991 0.141194 195.28 238.03 1.000
r(A<->T){all} 0.173051 0.020877 0.000284 0.460668 0.137895 247.74 251.17 1.000
r(C<->G){all} 0.164295 0.020790 0.000030 0.472423 0.123937 61.37 90.88 1.000
r(C<->T){all} 0.167562 0.020277 0.000046 0.451709 0.128064 206.54 228.65 1.000
r(G<->T){all} 0.161040 0.019518 0.000066 0.453383 0.121080 217.09 276.33 1.009
pi(A){all} 0.151888 0.000152 0.127020 0.175163 0.151506 948.51 1173.51 1.000
pi(C){all} 0.276488 0.000231 0.247005 0.305820 0.276550 1308.81 1316.66 1.000
pi(G){all} 0.361305 0.000278 0.326140 0.390665 0.360952 1100.72 1167.60 1.000
pi(T){all} 0.210318 0.000198 0.184503 0.238991 0.210261 1160.02 1327.65 1.002
alpha{1,2} 0.421111 0.244078 0.000309 1.356907 0.254858 976.15 1066.86 1.000
alpha{3} 0.445313 0.212993 0.000188 1.405540 0.291608 1282.77 1293.91 1.000
pinvar{all} 0.998209 0.000005 0.994181 0.999999 0.998940 1311.05 1369.35 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .**.**
9 -- ....**
10 -- .**...
11 -- ...**.
12 -- .*..*.
13 -- ..*..*
14 -- .*...*
15 -- .*.***
16 -- .*.*..
17 -- .****.
18 -- ..****
19 -- .***.*
20 -- ..*.*.
21 -- ..**..
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 460 0.153231 0.002827 0.151233 0.155230 2
8 458 0.152565 0.000000 0.152565 0.152565 2
9 456 0.151899 0.002827 0.149900 0.153897 2
10 449 0.149567 0.011777 0.141239 0.157895 2
11 437 0.145570 0.005182 0.141905 0.149234 2
12 430 0.143238 0.005653 0.139241 0.147235 2
13 427 0.142239 0.011777 0.133911 0.150566 2
14 425 0.141572 0.009893 0.134577 0.148568 2
15 422 0.140573 0.000942 0.139907 0.141239 2
16 422 0.140573 0.008480 0.134577 0.146569 2
17 421 0.140240 0.006124 0.135909 0.144570 2
18 420 0.139907 0.002827 0.137908 0.141905 2
19 417 0.138907 0.007066 0.133911 0.143904 2
20 409 0.136243 0.009893 0.129247 0.143238 2
21 395 0.131579 0.009893 0.124584 0.138574 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/aroE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098501 0.009980 0.000016 0.305525 0.066393 1.000 2
length{all}[2] 0.102644 0.010372 0.000003 0.299629 0.071683 1.000 2
length{all}[3] 0.098069 0.009959 0.000035 0.295132 0.069931 1.000 2
length{all}[4] 0.098081 0.009957 0.000019 0.298515 0.067920 1.000 2
length{all}[5] 0.099427 0.010149 0.000018 0.301215 0.066400 1.000 2
length{all}[6] 0.101156 0.010845 0.000014 0.307843 0.068447 1.000 2
length{all}[7] 0.105851 0.012626 0.000151 0.304607 0.073325 1.004 2
length{all}[8] 0.093636 0.008730 0.000115 0.261917 0.066041 0.998 2
length{all}[9] 0.090354 0.008335 0.000481 0.275056 0.059136 0.998 2
length{all}[10] 0.094670 0.007707 0.000261 0.275129 0.074011 0.999 2
length{all}[11] 0.106903 0.010848 0.000060 0.324492 0.071379 0.999 2
length{all}[12] 0.089348 0.008359 0.000079 0.244957 0.060756 0.998 2
length{all}[13] 0.093534 0.009261 0.000007 0.289230 0.058625 0.998 2
length{all}[14] 0.100950 0.010716 0.000096 0.315559 0.068749 0.998 2
length{all}[15] 0.097707 0.010855 0.000356 0.282459 0.063566 0.998 2
length{all}[16] 0.096949 0.008908 0.000022 0.283469 0.065045 0.998 2
length{all}[17] 0.099507 0.010572 0.000098 0.302826 0.064336 0.999 2
length{all}[18] 0.098841 0.009522 0.000021 0.302879 0.069254 0.999 2
length{all}[19] 0.098377 0.011800 0.000090 0.308001 0.064025 0.999 2
length{all}[20] 0.103792 0.010379 0.000249 0.322516 0.064475 1.000 2
length{all}[21] 0.102365 0.010561 0.000100 0.305340 0.066820 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006344
Maximum standard deviation of split frequencies = 0.011777
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------- C5 (5)
|
\--------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 834
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 56 patterns at 278 / 278 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 56 patterns at 278 / 278 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
54656 bytes for conP
4928 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.032358 0.052811 0.106794 0.064529 0.039496 0.040108 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1175.997102
Iterating by ming2
Initial: fx= 1175.997102
x= 0.03236 0.05281 0.10679 0.06453 0.03950 0.04011 0.30000 1.30000
1 h-m-p 0.0000 0.0001 669.0609 ++ 1123.052879 m 0.0001 13 | 1/8
2 h-m-p 0.0018 0.0157 40.0768 ------------.. | 1/8
3 h-m-p 0.0000 0.0000 614.0942 ++ 1113.223608 m 0.0000 45 | 2/8
4 h-m-p 0.0005 0.0445 31.0323 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 549.4569 ++ 1112.549164 m 0.0000 76 | 3/8
6 h-m-p 0.0001 0.0558 25.1048 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 475.0844 ++ 1102.045633 m 0.0000 106 | 4/8
8 h-m-p 0.0009 0.0665 19.1407 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 388.0337 ++ 1095.567634 m 0.0000 137 | 5/8
10 h-m-p 0.0009 0.1122 12.7224 -----------.. | 5/8
11 h-m-p 0.0000 0.0002 273.8608 ++ 1083.793902 m 0.0002 168 | 6/8
12 h-m-p 0.4656 8.0000 0.0000 +++ 1083.793902 m 8.0000 180 | 6/8
13 h-m-p 0.0924 8.0000 0.0014 ++++ 1083.793901 m 8.0000 195 | 6/8
14 h-m-p 0.0160 8.0000 0.7440 +++Y 1083.793892 0 2.4833 211 | 6/8
15 h-m-p 1.6000 8.0000 0.0705 C 1083.793892 0 1.9748 224 | 6/8
16 h-m-p 1.6000 8.0000 0.0056 Y 1083.793892 0 0.8439 237 | 6/8
17 h-m-p 1.6000 8.0000 0.0003 -C 1083.793892 0 0.1000 251 | 6/8
18 h-m-p 1.6000 8.0000 0.0000 C 1083.793892 0 1.6000 264 | 6/8
19 h-m-p 0.0611 8.0000 0.0002 ++++ 1083.793892 m 8.0000 279 | 6/8
20 h-m-p 0.3765 8.0000 0.0036 +Y 1083.793892 0 2.5951 293 | 6/8
21 h-m-p 1.6000 8.0000 0.0012 C 1083.793892 0 2.2964 306 | 6/8
22 h-m-p 1.6000 8.0000 0.0001 ++ 1083.793892 m 8.0000 319 | 6/8
23 h-m-p 0.0160 8.0000 0.2411 +++Y 1083.793891 0 0.7058 335 | 6/8
24 h-m-p 1.6000 8.0000 0.0214 ++ 1083.793890 m 8.0000 348 | 6/8
25 h-m-p 0.1165 1.3959 1.4687 ----------Y 1083.793890 0 0.0000 371 | 6/8
26 h-m-p 0.0160 8.0000 0.2467 +++C 1083.793890 0 1.0852 385 | 6/8
27 h-m-p 1.6000 8.0000 0.0060 Y 1083.793890 0 1.0940 398 | 6/8
28 h-m-p 1.6000 8.0000 0.0001 -Y 1083.793890 0 0.1000 412 | 6/8
29 h-m-p 0.2050 8.0000 0.0000 +++ 1083.793890 m 8.0000 426 | 6/8
30 h-m-p 0.0160 8.0000 0.0217 ++++Y 1083.793890 0 2.8295 443 | 6/8
31 h-m-p 1.6000 8.0000 0.0001 ++ 1083.793890 m 8.0000 456 | 6/8
32 h-m-p 0.0160 8.0000 4.4371 +++++ 1083.793755 m 8.0000 472 | 6/8
33 h-m-p 1.6000 8.0000 2.2232 ++ 1083.793744 m 8.0000 483 | 6/8
34 h-m-p 1.6000 8.0000 10.3680 ++ 1083.793728 m 8.0000 494 | 6/8
35 h-m-p 1.6000 8.0000 31.6569 ++ 1083.793721 m 8.0000 505 | 6/8
36 h-m-p 1.6000 8.0000 42.1154 ++ 1083.793719 m 8.0000 516 | 6/8
37 h-m-p 1.6000 8.0000 19.2414 ++ 1083.793718 m 8.0000 527 | 6/8
38 h-m-p 0.7576 4.3408 203.1781 ---------C 1083.793718 0 0.0000 547 | 6/8
39 h-m-p 0.1370 8.0000 0.0011 +++ 1083.793718 m 8.0000 559 | 6/8
40 h-m-p 0.1058 8.0000 0.0810 -C 1083.793718 0 0.0066 573 | 6/8
41 h-m-p 0.1097 8.0000 0.0049 ---Y 1083.793718 0 0.0004 589 | 6/8
42 h-m-p 0.0685 8.0000 0.0000 -----Y 1083.793718 0 0.0000 607
Out..
lnL = -1083.793718
608 lfun, 608 eigenQcodon, 3648 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.015406 0.021165 0.064080 0.050318 0.049873 0.010504 362.605650 0.538266 0.309764
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.062766
np = 9
lnL0 = -1141.203269
Iterating by ming2
Initial: fx= 1141.203269
x= 0.01541 0.02116 0.06408 0.05032 0.04987 0.01050 362.60565 0.53827 0.30976
1 h-m-p 0.0000 0.0000 652.7636 ++ 1124.538423 m 0.0000 14 | 1/9
2 h-m-p 0.0002 0.0012 98.8669 ++ 1114.580923 m 0.0012 26 | 2/9
3 h-m-p 0.0000 0.0000 227428.3169 ++ 1106.068836 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 13248.1373 ++ 1101.340374 m 0.0000 50 | 4/9
5 h-m-p 0.0005 0.0027 20.1506 -----------.. | 4/9
6 h-m-p 0.0000 0.0001 467.7544 ++ 1086.681440 m 0.0001 83 | 5/9
7 h-m-p 0.0038 0.0802 6.5976 ------------.. | 5/9
8 h-m-p 0.0000 0.0000 393.8765 ++ 1086.505760 m 0.0000 117 | 6/9
9 h-m-p 0.0001 0.0370 14.2082 +++++ 1086.109237 m 0.0370 132 | 7/9
10 h-m-p 0.0094 0.0597 0.1407 ++ 1083.793902 m 0.0597 144 | 8/9
11 h-m-p 1.6000 8.0000 0.0000 +Y 1083.793902 0 6.4000 159
Out..
lnL = -1083.793902
160 lfun, 480 eigenQcodon, 1920 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.042748 0.060764 0.025128 0.086989 0.062742 0.022688 362.605626 1.245009 0.276647 0.342216 808.955111
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.000476
np = 11
lnL0 = -1121.139726
Iterating by ming2
Initial: fx= 1121.139726
x= 0.04275 0.06076 0.02513 0.08699 0.06274 0.02269 362.60563 1.24501 0.27665 0.34222 808.95511
1 h-m-p 0.0000 0.0004 132.8208 +++ 1111.999389 m 0.0004 17 | 1/11
2 h-m-p 0.0018 0.0207 24.8631 ++ 1099.171865 m 0.0207 31 | 2/11
3 h-m-p 0.0000 0.0000 20081.1982 ++ 1096.893579 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0001 129.4091 ++ 1095.433500 m 0.0001 59 | 4/11
5 h-m-p 0.0000 0.0007 753.3577 +++ 1090.651211 m 0.0007 74 | 5/11
6 h-m-p 0.0002 0.0008 144.5555 ++ 1083.793721 m 0.0008 88 | 6/11
7 h-m-p 1.6000 8.0000 0.0000 ---------Y 1083.793721 0 0.0000 111
Out..
lnL = -1083.793721
112 lfun, 448 eigenQcodon, 2016 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1083.787562 S = -1083.787325 -0.000091
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:02
did 20 / 56 patterns 0:02
did 30 / 56 patterns 0:02
did 40 / 56 patterns 0:02
did 50 / 56 patterns 0:02
did 56 / 56 patterns 0:02
Time used: 0:02
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.103093 0.057910 0.073430 0.071989 0.053042 0.044398 362.605635 0.556397 1.008235
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.084443
np = 9
lnL0 = -1191.620553
Iterating by ming2
Initial: fx= 1191.620553
x= 0.10309 0.05791 0.07343 0.07199 0.05304 0.04440 362.60563 0.55640 1.00824
1 h-m-p 0.0000 0.0002 620.9431 +++ 1122.816355 m 0.0002 15 | 1/9
2 h-m-p 0.0035 0.0256 28.1878 ------------.. | 1/9
3 h-m-p 0.0000 0.0000 605.5594 ++ 1110.836412 m 0.0000 49 | 2/9
4 h-m-p 0.0012 0.0475 14.2463 -----------.. | 2/9
5 h-m-p 0.0000 0.0000 546.8494 ++ 1105.371034 m 0.0000 82 | 3/9
6 h-m-p 0.0006 0.0748 13.2350 -----------.. | 3/9
7 h-m-p 0.0000 0.0001 474.5745 ++ 1093.321453 m 0.0001 115 | 4/9
8 h-m-p 0.0016 0.1036 12.9675 -----------.. | 4/9
9 h-m-p 0.0000 0.0000 392.5921 ++ 1092.489131 m 0.0000 148 | 5/9
10 h-m-p 0.0003 0.1378 11.3713 ----------.. | 5/9
11 h-m-p 0.0000 0.0001 275.0060 ++ 1083.794052 m 0.0001 180 | 6/9
12 h-m-p 1.0491 8.0000 0.0000 ++ 1083.794052 m 8.0000 192 | 6/9
13 h-m-p 0.0160 8.0000 0.0145 +++++ 1083.794050 m 8.0000 210 | 6/9
14 h-m-p 0.2346 8.0000 0.4959 +++ 1083.794034 m 8.0000 226 | 6/9
15 h-m-p 1.6000 8.0000 0.2322 ++ 1083.794033 m 8.0000 241 | 6/9
16 h-m-p 0.8447 8.0000 2.1991 ++ 1083.794030 m 8.0000 256 | 6/9
17 h-m-p 1.6000 8.0000 3.3414 ++ 1083.794030 m 8.0000 268 | 6/9
18 h-m-p 0.5385 2.6926 25.7859 ++ 1083.794030 m 2.6926 280 | 6/9
19 h-m-p 0.0000 0.0000 273.9329
h-m-p: 0.00000000e+00 0.00000000e+00 2.73932942e+02 1083.794030
.. | 6/9
20 h-m-p 0.0160 8.0000 0.0000 +++++ 1083.794030 m 8.0000 304 | 6/9
21 h-m-p 0.0160 8.0000 0.0018 +++++ 1083.794030 m 8.0000 322 | 6/9
22 h-m-p 0.0000 0.0001 198.7709 --------.. | 6/9
23 h-m-p 0.0160 8.0000 0.0000 Y 1083.794030 0 0.0312 355 | 6/9
24 h-m-p 0.0160 8.0000 0.0000 +++++ 1083.794030 m 8.0000 373 | 6/9
25 h-m-p 0.0000 0.0017 8.0747 ----N 1083.794030 0 0.0000 392 | 6/9
26 h-m-p 0.0160 8.0000 0.0000 ------Y 1083.794030 0 0.0000 410 | 6/9
27 h-m-p 0.0160 8.0000 0.0000 ----------Y 1083.794030 0 0.0000 435
Out..
lnL = -1083.794030
436 lfun, 4796 eigenQcodon, 26160 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.090906 0.026422 0.057058 0.093422 0.107689 0.092259 362.614643 0.900000 0.370448 1.699355 804.295021
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.000826
np = 11
lnL0 = -1111.570047
Iterating by ming2
Initial: fx= 1111.570047
x= 0.09091 0.02642 0.05706 0.09342 0.10769 0.09226 362.61464 0.90000 0.37045 1.69936 804.29502
1 h-m-p 0.0000 0.0004 235.2265 ++YCYYYCCC 1093.968688 7 0.0004 29 | 0/11
2 h-m-p 0.0004 0.0018 29.5774 ++ 1092.362297 m 0.0018 43 | 1/11
3 h-m-p 0.0011 0.0054 10.7197 ++ 1091.100068 m 0.0054 57 | 2/11
4 h-m-p 0.0020 0.0098 10.1748 ++ 1088.631728 m 0.0098 71 | 3/11
5 h-m-p 0.0012 0.0061 14.7231 ++ 1086.623891 m 0.0061 85 | 4/11
6 h-m-p 0.0001 0.0007 182.0812 ++ 1085.513545 m 0.0007 99 | 5/11
7 h-m-p 0.0025 0.0124 24.1125 ++ 1083.793733 m 0.0124 113 | 6/11
8 h-m-p 1.6000 8.0000 0.0000 ++ 1083.793733 m 8.0000 127 | 6/11
9 h-m-p 0.0440 8.0000 0.0018 ++++ 1083.793733 m 8.0000 148 | 6/11
10 h-m-p 0.0236 8.0000 0.6117 +++++ 1083.793721 m 8.0000 170 | 6/11
11 h-m-p 1.6000 8.0000 0.2089 ++ 1083.793721 m 8.0000 189 | 6/11
12 h-m-p 0.2616 1.3079 2.7379 +
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
+ 1083.793720 m 1.3079 208
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
13 h-m-p 0.0000 0.0000 3.2083
h-m-p: 1.55654927e-18 7.78274633e-18 3.20833323e+00 1083.793720
..
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
14 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
+ 1083.793720 m 8.0000 236
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03869, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
15 h-m-p 0.0032 0.0159 0.0070
QuantileBeta(0.85, 10.03841, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
Y 1083.793720 0 0.0000 259
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03869, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03814, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
| 6/11
16 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.85, 10.03842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 10.03842, 0.00501) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 10.03842, 0.00501) = 1.000000e+00 2000 rounds
++++ 1083.793720 m 8.0000 281 | 6/11
17 h-m-p 0.0296 8.0000 0.0669 +++++ 1083.793719 m 8.0000 303 | 6/11
18 h-m-p 1.6000 8.0000 0.0234 ++ 1083.793719 m 8.0000 322 | 6/11
19 h-m-p 0.1008 0.5038 0.2947 ++ 1083.793718 m 0.5038 341 | 7/11
20 h-m-p 0.0419 8.0000 0.4167 ++++ 1083.793718 m 8.0000 362 | 7/11
21 h-m-p 0.0078 0.2238 428.0257 +++ 1083.793718 m 0.2238 381 | 7/11
22 h-m-p 0.0000 0.0000 150.6046
h-m-p: 0.00000000e+00 0.00000000e+00 1.50604595e+02 1083.793718
.. | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +Y 1083.793718 0 0.0640 407 | 7/11
24 h-m-p 0.2390 8.0000 0.0000 ----C 1083.793718 0 0.0002 429
Out..
lnL = -1083.793718
430 lfun, 5160 eigenQcodon, 28380 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1083.787303 S = -1083.787278 -0.000011
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 56 patterns 0:17
did 20 / 56 patterns 0:17
did 30 / 56 patterns 0:17
did 40 / 56 patterns 0:17
did 50 / 56 patterns 0:17
did 56 / 56 patterns 0:17
Time used: 0:17
CodeML output code: -1
CODONML (in paml version 4.9h, March 2018) /data/1res/aroE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 278
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 2 2 2 2 2 2 | Cys TGT 1 1 1 1 1 1
TTC 5 5 5 5 5 5 | TCC 5 5 5 5 5 5 | TAC 2 2 2 2 2 2 | TGC 4 4 4 4 4 4
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 11 11 11 11 11 11 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 3 3 3 3 3 3 | His CAT 3 3 3 3 3 3 | Arg CGT 5 5 5 5 5 5
CTC 3 3 3 3 3 3 | CCC 1 1 1 1 1 1 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 3 3 3 3 3 3 | CGA 4 4 4 4 4 4
CTG 14 14 14 14 14 14 | CCG 10 10 10 10 10 10 | CAG 4 4 4 4 4 4 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 3 3 3 3 3 3 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 7 7 7 7 7 7 | AAC 3 3 3 3 3 3 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 5 5 5 5 5 5 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 6 6 6 6 6 6 | Ala GCT 12 12 12 12 12 12 | Asp GAT 9 9 9 9 9 9 | Gly GGT 6 6 6 6 6 6
GTC 9 9 9 9 9 9 | GCC 6 6 6 6 6 6 | GAC 6 6 6 6 6 6 | GGC 10 10 10 10 10 10
GTA 1 1 1 1 1 1 | GCA 9 9 9 9 9 9 | Glu GAA 4 4 4 4 4 4 | GGA 1 1 1 1 1 1
GTG 13 13 13 13 13 13 | GCG 20 20 20 20 20 20 | GAG 6 6 6 6 6 6 | GGG 11 11 11 11 11 11
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907764_1_532_MLBR_RS02520
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
#2: NC_002677_1_NP_301440_1_312_aroE
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
#3: NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
#4: NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
#5: NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
#6: NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 6 | Tyr Y TAT 12 | Cys C TGT 6
TTC 30 | TCC 30 | TAC 12 | TGC 24
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 66 | TCG 12 | TAG 0 | Trp W TGG 24
------------------------------------------------------------------------------
Leu L CTT 0 | Pro P CCT 18 | His H CAT 18 | Arg R CGT 30
CTC 18 | CCC 6 | CAC 24 | CGC 12
CTA 12 | CCA 12 | Gln Q CAA 18 | CGA 24
CTG 84 | CCG 60 | CAG 24 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 18 | Asn N AAT 6 | Ser S AGT 6
ATC 36 | ACC 42 | AAC 18 | AGC 24
ATA 0 | ACA 6 | Lys K AAA 12 | Arg R AGA 0
Met M ATG 30 | ACG 30 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 36 | Ala A GCT 72 | Asp D GAT 54 | Gly G GGT 36
GTC 54 | GCC 36 | GAC 36 | GGC 60
GTA 6 | GCA 54 | Glu E GAA 24 | GGA 6
GTG 78 | GCG 120 | GAG 36 | GGG 66
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14029 C:0.23741 A:0.15827 G:0.46403
position 2: T:0.28417 C:0.31655 A:0.18705 G:0.21223
position 3: T:0.20504 C:0.27698 A:0.10791 G:0.41007
Average T:0.20983 C:0.27698 A:0.15108 G:0.36211
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -1083.793718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 362.605650 804.295021
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907764_1_532_MLBR_RS02520: 0.000004, NC_002677_1_NP_301440_1_312_aroE: 0.000004, NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545: 0.000004, NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950: 0.000004, NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790: 0.000004, NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 362.60565
omega (dN/dS) = 804.29502
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
7..2 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
7..3 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
7..4 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
7..5 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
7..6 0.000 580.2 253.8 804.2950 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1083.793902 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 362.605626 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907764_1_532_MLBR_RS02520: 0.000004, NC_002677_1_NP_301440_1_312_aroE: 0.000004, NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545: 0.000004, NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950: 0.000004, NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790: 0.000004, NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 362.60563
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 580.2 253.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1083.793721 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 362.605635 0.763510 0.155217 0.317515 808.955153
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907764_1_532_MLBR_RS02520: 0.000004, NC_002677_1_NP_301440_1_312_aroE: 0.000004, NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545: 0.000004, NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950: 0.000004, NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790: 0.000004, NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 362.60563
MLEs of dN/dS (w) for site classes (K=3)
p: 0.76351 0.15522 0.08127
w: 0.31751 1.00000 808.95515
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
7..2 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
7..3 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
7..4 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
7..5 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
7..6 0.000 580.2 253.8 66.1444 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907764_1_532_MLBR_RS02520)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907764_1_532_MLBR_RS02520)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:02
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -1083.794030 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 362.614643 69.307436 98.992073
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907764_1_532_MLBR_RS02520: 0.000004, NC_002677_1_NP_301440_1_312_aroE: 0.000004, NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545: 0.000004, NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950: 0.000004, NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790: 0.000004, NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 362.61464
Parameters in M7 (beta):
p = 69.30744 q = 98.99207
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.35017 0.37253 0.38601 0.39688 0.40669 0.41624 0.42615 0.43723 0.45115 0.47464
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
7..2 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
7..3 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
7..4 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
7..5 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
7..6 0.000 580.2 253.8 0.4118 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -1083.793718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 366.054868 0.000010 15.748092 99.000000 805.987850
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907764_1_532_MLBR_RS02520: 0.000004, NC_002677_1_NP_301440_1_312_aroE: 0.000004, NZ_LVXE01000008_1_WP_010907764_1_2750_A3216_RS04545: 0.000004, NZ_LYPH01000055_1_WP_010907764_1_2077_A8144_RS09950: 0.000004, NZ_CP029543_1_WP_010907764_1_546_DIJ64_RS02790: 0.000004, NZ_AP014567_1_WP_010907764_1_564_JK2ML_RS02880: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 366.05487
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 15.74809 q = 99.00000
(p1 = 0.99999) w = 805.98785
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.08845 0.10434 0.11456 0.12314 0.13115 0.13918 0.14775 0.15764 0.17048 0.19324 805.98785
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
7..2 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
7..3 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
7..4 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
7..5 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
7..6 0.000 580.2 253.8 805.9798 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907764_1_532_MLBR_RS02520)
Pr(w>1) post mean +- SE for w
1 V 1.000** 805.980
2 S 1.000** 805.980
3 L 1.000** 805.980
4 T 1.000** 805.980
5 A 1.000** 805.980
6 C 1.000** 805.980
7 A 1.000** 805.980
8 N 1.000** 805.980
9 K 1.000** 805.980
10 G 1.000** 805.980
11 P 1.000** 805.980
12 R 1.000** 805.980
13 K 1.000** 805.980
14 A 1.000** 805.980
15 G 1.000** 805.980
16 I 1.000** 805.980
17 I 1.000** 805.980
18 G 1.000** 805.980
19 S 1.000** 805.980
20 P 1.000** 805.980
21 I 1.000** 805.980
22 A 1.000** 805.980
23 H 1.000** 805.980
24 S 1.000** 805.980
25 R 1.000** 805.980
26 S 1.000** 805.980
27 P 1.000** 805.980
28 H 1.000** 805.980
29 L 1.000** 805.980
30 H 1.000** 805.980
31 L 1.000** 805.980
32 A 1.000** 805.980
33 A 1.000** 805.980
34 Y 1.000** 805.980
35 R 1.000** 805.980
36 A 1.000** 805.980
37 L 1.000** 805.980
38 R 1.000** 805.980
39 L 1.000** 805.980
40 H 1.000** 805.980
41 D 1.000** 805.980
42 W 1.000** 805.980
43 T 1.000** 805.980
44 Y 1.000** 805.980
45 E 1.000** 805.980
46 R 1.000** 805.980
47 I 1.000** 805.980
48 E 1.000** 805.980
49 C 1.000** 805.980
50 D 1.000** 805.980
51 A 1.000** 805.980
52 E 1.000** 805.980
53 E 1.000** 805.980
54 L 1.000** 805.980
55 P 1.000** 805.980
56 T 1.000** 805.980
57 V 1.000** 805.980
58 V 1.000** 805.980
59 S 1.000** 805.980
60 G 1.000** 805.980
61 F 1.000** 805.980
62 G 1.000** 805.980
63 P 1.000** 805.980
64 Q 1.000** 805.980
65 W 1.000** 805.980
66 V 1.000** 805.980
67 G 1.000** 805.980
68 V 1.000** 805.980
69 S 1.000** 805.980
70 V 1.000** 805.980
71 T 1.000** 805.980
72 M 1.000** 805.980
73 P 1.000** 805.980
74 G 1.000** 805.980
75 K 1.000** 805.980
76 F 1.000** 805.980
77 A 1.000** 805.980
78 A 1.000** 805.980
79 L 1.000** 805.980
80 R 1.000** 805.980
81 F 1.000** 805.980
82 A 1.000** 805.980
83 D 1.000** 805.980
84 E 1.000** 805.980
85 H 1.000** 805.980
86 T 1.000** 805.980
87 A 1.000** 805.980
88 R 1.000** 805.980
89 A 1.000** 805.980
90 S 1.000** 805.980
91 L 1.000** 805.980
92 V 1.000** 805.980
93 G 1.000** 805.980
94 S 1.000** 805.980
95 A 1.000** 805.980
96 N 1.000** 805.980
97 T 1.000** 805.980
98 L 1.000** 805.980
99 L 1.000** 805.980
100 R 1.000** 805.980
101 T 1.000** 805.980
102 Q 1.000** 805.980
103 R 1.000** 805.980
104 G 1.000** 805.980
105 W 1.000** 805.980
106 R 1.000** 805.980
107 A 1.000** 805.980
108 D 1.000** 805.980
109 N 1.000** 805.980
110 T 1.000** 805.980
111 D 1.000** 805.980
112 I 1.000** 805.980
113 D 1.000** 805.980
114 G 1.000** 805.980
115 V 1.000** 805.980
116 A 1.000** 805.980
117 G 1.000** 805.980
118 A 1.000** 805.980
119 L 1.000** 805.980
120 A 1.000** 805.980
121 A 1.000** 805.980
122 I 1.000** 805.980
123 G 1.000** 805.980
124 P 1.000** 805.980
125 L 1.000** 805.980
126 A 1.000** 805.980
127 G 1.000** 805.980
128 R 1.000** 805.980
129 A 1.000** 805.980
130 L 1.000** 805.980
131 V 1.000** 805.980
132 C 1.000** 805.980
133 G 1.000** 805.980
134 S 1.000** 805.980
135 G 1.000** 805.980
136 G 1.000** 805.980
137 T 1.000** 805.980
138 A 1.000** 805.980
139 P 1.000** 805.980
140 A 1.000** 805.980
141 A 1.000** 805.980
142 V 1.000** 805.980
143 M 1.000** 805.980
144 G 1.000** 805.980
145 L 1.000** 805.980
146 A 1.000** 805.980
147 E 1.000** 805.980
148 L 1.000** 805.980
149 G 1.000** 805.980
150 V 1.000** 805.980
151 T 1.000** 805.980
152 D 1.000** 805.980
153 I 1.000** 805.980
154 T 1.000** 805.980
155 V 1.000** 805.980
156 L 1.000** 805.980
157 A 1.000** 805.980
158 R 1.000** 805.980
159 N 1.000** 805.980
160 P 1.000** 805.980
161 D 1.000** 805.980
162 K 1.000** 805.980
163 A 1.000** 805.980
164 S 1.000** 805.980
165 R 1.000** 805.980
166 L 1.000** 805.980
167 V 1.000** 805.980
168 D 1.000** 805.980
169 L 1.000** 805.980
170 G 1.000** 805.980
171 V 1.000** 805.980
172 Q 1.000** 805.980
173 V 1.000** 805.980
174 G 1.000** 805.980
175 V 1.000** 805.980
176 A 1.000** 805.980
177 T 1.000** 805.980
178 R 1.000** 805.980
179 L 1.000** 805.980
180 C 1.000** 805.980
181 G 1.000** 805.980
182 L 1.000** 805.980
183 D 1.000** 805.980
184 S 1.000** 805.980
185 G 1.000** 805.980
186 G 1.000** 805.980
187 L 1.000** 805.980
188 A 1.000** 805.980
189 D 1.000** 805.980
190 E 1.000** 805.980
191 V 1.000** 805.980
192 K 1.000** 805.980
193 A 1.000** 805.980
194 A 1.000** 805.980
195 E 1.000** 805.980
196 V 1.000** 805.980
197 L 1.000** 805.980
198 V 1.000** 805.980
199 S 1.000** 805.980
200 T 1.000** 805.980
201 V 1.000** 805.980
202 P 1.000** 805.980
203 A 1.000** 805.980
204 D 1.000** 805.980
205 V 1.000** 805.980
206 A 1.000** 805.980
207 A 1.000** 805.980
208 R 1.000** 805.980
209 Y 1.000** 805.980
210 V 1.000** 805.980
211 D 1.000** 805.980
212 V 1.000** 805.980
213 F 1.000** 805.980
214 A 1.000** 805.980
215 T 1.000** 805.980
216 V 1.000** 805.980
217 P 1.000** 805.980
218 V 1.000** 805.980
219 L 1.000** 805.980
220 L 1.000** 805.980
221 D 1.000** 805.980
222 A 1.000** 805.980
223 I 1.000** 805.980
224 Y 1.000** 805.980
225 D 1.000** 805.980
226 P 1.000** 805.980
227 W 1.000** 805.980
228 P 1.000** 805.980
229 T 1.000** 805.980
230 P 1.000** 805.980
231 L 1.000** 805.980
232 V 1.000** 805.980
233 A 1.000** 805.980
234 A 1.000** 805.980
235 V 1.000** 805.980
236 S 1.000** 805.980
237 A 1.000** 805.980
238 A 1.000** 805.980
239 G 1.000** 805.980
240 G 1.000** 805.980
241 R 1.000** 805.980
242 V 1.000** 805.980
243 I 1.000** 805.980
244 S 1.000** 805.980
245 G 1.000** 805.980
246 L 1.000** 805.980
247 Q 1.000** 805.980
248 M 1.000** 805.980
249 L 1.000** 805.980
250 L 1.000** 805.980
251 H 1.000** 805.980
252 Q 1.000** 805.980
253 A 1.000** 805.980
254 F 1.000** 805.980
255 A 1.000** 805.980
256 Q 1.000** 805.980
257 V 1.000** 805.980
258 E 1.000** 805.980
259 Q 1.000** 805.980
260 F 1.000** 805.980
261 T 1.000** 805.980
262 G 1.000** 805.980
263 M 1.000** 805.980
264 P 1.000** 805.980
265 A 1.000** 805.980
266 P 1.000** 805.980
267 R 1.000** 805.980
268 E 1.000** 805.980
269 A 1.000** 805.980
270 M 1.000** 805.980
271 A 1.000** 805.980
272 C 1.000** 805.980
273 A 1.000** 805.980
274 L 1.000** 805.980
275 A 1.000** 805.980
276 G 1.000** 805.980
277 L 1.000** 805.980
278 H 1.000** 805.980
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907764_1_532_MLBR_RS02520)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:17