--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:53:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/arsC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -431.45 -434.48
2 -431.47 -435.27
--------------------------------------
TOTAL -431.46 -434.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899568 0.093368 0.329596 1.481552 0.864827 1472.86 1486.93 1.000
r(A<->C){all} 0.157864 0.018352 0.000091 0.434498 0.122103 257.58 276.04 1.000
r(A<->G){all} 0.169722 0.020245 0.000003 0.450827 0.131837 106.38 226.89 1.006
r(A<->T){all} 0.176700 0.020789 0.000006 0.451908 0.144262 168.82 227.05 1.004
r(C<->G){all} 0.168430 0.021380 0.000116 0.468843 0.128900 202.29 244.40 1.002
r(C<->T){all} 0.167912 0.018850 0.000108 0.449825 0.136554 246.50 355.04 1.003
r(G<->T){all} 0.159372 0.019836 0.000099 0.453162 0.121746 179.85 203.67 1.001
pi(A){all} 0.275331 0.000646 0.227257 0.325539 0.274766 906.79 1045.93 1.000
pi(C){all} 0.281555 0.000645 0.232296 0.331151 0.281090 1086.43 1163.75 1.000
pi(G){all} 0.243378 0.000579 0.197488 0.290679 0.242311 1191.28 1331.87 1.000
pi(T){all} 0.199737 0.000494 0.155881 0.242601 0.199640 1308.01 1335.97 1.000
alpha{1,2} 0.421818 0.231454 0.000132 1.364516 0.257399 1088.74 1198.59 1.001
alpha{3} 0.449780 0.218626 0.000113 1.393478 0.297395 1382.50 1441.75 1.000
pinvar{all} 0.995030 0.000036 0.983556 0.999998 0.996888 1356.86 1379.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -410.765871
Model 2: PositiveSelection -410.7659
Model 0: one-ratio -410.76584
Model 7: beta -410.765706
Model 8: beta&w>1 -410.765899
Model 0 vs 1 6.199999995715189E-5
Model 2 vs 1 5.7999999967250915E-5
Model 8 vs 7 3.859999999349384E-4
>C1
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C2
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C3
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C4
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C5
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C6
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=104
C1 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C2 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C3 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C4 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C5 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C6 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
**************************************************
C1 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C2 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C3 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C4 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C5 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C6 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
**************************************************
C1 HEIR
C2 HEIR
C3 HEIR
C4 HEIR
C5 HEIR
C6 HEIR
****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 104 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 104 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3120]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [3120]--->[3120]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C2 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C3 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C4 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C5 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C6 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
**************************************************
C1 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C2 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C3 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C4 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C5 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C6 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
**************************************************
C1 HEIR
C2 HEIR
C3 HEIR
C4 HEIR
C5 HEIR
C6 HEIR
****
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C2 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C3 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C4 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C5 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C6 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
**************************************************
C1 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C2 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C3 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C4 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C5 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C6 TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
**************************************************
C1 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C2 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C3 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C4 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C5 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C6 TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
**************************************************
C1 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C2 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C3 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C4 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C5 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C6 AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
**************************************************
C1 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C2 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C3 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C4 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C5 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C6 GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
**************************************************
C1 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C2 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C3 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C4 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C5 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C6 TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
**************************************************
C1 CACGAAATTCGG
C2 CACGAAATTCGG
C3 CACGAAATTCGG
C4 CACGAAATTCGG
C5 CACGAAATTCGG
C6 CACGAAATTCGG
************
>C1
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C2
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C3
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C4
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C5
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C6
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C1
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C2
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C3
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C4
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C5
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C6
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 312 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773127
Setting output file names to "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1612955149
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8861644520
Seed = 1287374584
Swapseed = 1579773127
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -698.270960 -- -24.965149
Chain 2 -- -698.270960 -- -24.965149
Chain 3 -- -698.270921 -- -24.965149
Chain 4 -- -698.270921 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -698.270960 -- -24.965149
Chain 2 -- -698.270921 -- -24.965149
Chain 3 -- -698.270960 -- -24.965149
Chain 4 -- -698.270960 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-698.271] (-698.271) (-698.271) (-698.271) * [-698.271] (-698.271) (-698.271) (-698.271)
500 -- (-439.851) [-442.639] (-443.314) (-438.225) * (-443.800) (-445.542) [-438.698] (-441.175) -- 0:00:00
1000 -- (-441.966) (-445.432) [-440.672] (-441.575) * (-442.190) (-438.047) [-440.514] (-439.466) -- 0:00:00
1500 -- (-437.673) (-442.984) [-443.398] (-435.120) * (-446.403) [-437.342] (-439.875) (-437.853) -- 0:00:00
2000 -- (-442.704) (-441.294) [-435.375] (-443.771) * (-437.655) (-440.798) [-439.021] (-449.946) -- 0:00:00
2500 -- [-442.033] (-441.202) (-443.520) (-446.146) * (-444.757) (-437.815) [-439.014] (-451.701) -- 0:00:00
3000 -- (-440.269) (-446.274) (-441.537) [-443.563] * (-437.057) (-438.814) [-438.927] (-447.741) -- 0:00:00
3500 -- [-437.980] (-436.683) (-440.747) (-440.142) * (-439.242) (-440.200) (-442.267) [-441.288] -- 0:00:00
4000 -- (-446.712) (-445.926) [-437.263] (-443.253) * (-440.507) [-439.639] (-440.736) (-438.143) -- 0:00:00
4500 -- (-451.589) (-440.940) (-441.208) [-435.942] * (-437.521) [-439.088] (-446.481) (-446.770) -- 0:00:00
5000 -- (-449.466) (-440.341) [-437.633] (-438.093) * (-446.526) [-438.650] (-439.707) (-444.509) -- 0:00:00
Average standard deviation of split frequencies: 0.111304
5500 -- (-439.472) [-438.640] (-446.676) (-438.883) * (-441.648) (-440.664) [-446.065] (-441.308) -- 0:00:00
6000 -- (-431.506) [-442.995] (-436.468) (-441.892) * (-439.295) (-441.858) (-446.034) [-439.963] -- 0:00:00
6500 -- (-431.692) [-436.296] (-451.556) (-440.534) * [-436.356] (-446.730) (-437.396) (-440.814) -- 0:00:00
7000 -- [-434.888] (-448.801) (-446.784) (-455.506) * (-439.183) (-444.058) (-440.327) [-438.036] -- 0:00:00
7500 -- [-433.596] (-438.817) (-440.263) (-456.056) * [-435.813] (-440.149) (-438.242) (-444.864) -- 0:00:00
8000 -- (-434.135) (-435.349) [-441.845] (-449.616) * (-437.693) (-438.383) (-443.379) [-440.983] -- 0:00:00
8500 -- (-431.814) [-447.715] (-453.407) (-432.417) * [-448.906] (-443.942) (-445.912) (-442.448) -- 0:00:00
9000 -- (-431.077) [-441.422] (-449.583) (-432.369) * [-434.144] (-444.549) (-440.446) (-441.597) -- 0:00:00
9500 -- (-433.664) [-449.848] (-440.745) (-434.168) * (-433.654) (-448.382) (-444.914) [-436.625] -- 0:00:00
10000 -- (-432.809) [-438.402] (-438.563) (-430.764) * (-435.117) [-440.331] (-439.766) (-436.756) -- 0:00:00
Average standard deviation of split frequencies: 0.041739
10500 -- (-432.800) (-440.039) (-440.650) [-432.057] * (-431.876) (-444.585) (-437.643) [-440.456] -- 0:00:00
11000 -- (-433.007) (-447.777) (-447.991) [-434.219] * (-432.197) [-441.399] (-441.220) (-441.500) -- 0:00:00
11500 -- (-443.178) [-437.502] (-443.700) (-431.311) * (-436.969) (-439.530) (-441.857) [-434.586] -- 0:00:00
12000 -- (-438.610) (-438.011) (-440.891) [-432.281] * (-431.929) (-444.499) [-442.961] (-442.323) -- 0:00:00
12500 -- (-431.383) (-443.893) [-443.280] (-431.065) * [-435.809] (-446.606) (-439.683) (-437.726) -- 0:00:00
13000 -- [-430.845] (-444.239) (-442.415) (-433.468) * (-434.077) (-440.535) [-445.904] (-447.095) -- 0:00:00
13500 -- [-431.235] (-448.408) (-439.607) (-433.735) * (-432.334) (-444.909) [-442.749] (-442.368) -- 0:00:00
14000 -- (-432.576) (-440.762) (-445.014) [-430.641] * (-432.190) [-436.883] (-443.369) (-439.547) -- 0:00:00
14500 -- (-432.931) [-439.130] (-440.242) (-430.001) * (-433.200) (-445.711) [-439.227] (-448.402) -- 0:00:00
15000 -- (-434.316) [-439.871] (-439.428) (-431.232) * (-431.429) (-438.192) (-439.944) [-440.601] -- 0:00:00
Average standard deviation of split frequencies: 0.055652
15500 -- (-435.069) (-455.183) (-452.832) [-432.440] * (-433.086) (-440.177) (-440.474) [-438.473] -- 0:01:03
16000 -- (-432.581) (-455.117) (-441.483) [-432.847] * (-431.716) (-441.021) [-436.674] (-443.002) -- 0:01:01
16500 -- [-431.133] (-431.072) (-442.177) (-433.233) * (-432.212) (-440.620) [-436.986] (-443.394) -- 0:00:59
17000 -- [-434.181] (-432.223) (-436.007) (-433.360) * (-431.967) [-442.576] (-440.782) (-439.164) -- 0:00:57
17500 -- (-434.418) (-437.181) [-437.658] (-430.554) * (-432.482) (-434.527) [-439.897] (-438.686) -- 0:00:56
18000 -- [-434.092] (-431.378) (-447.613) (-430.448) * (-435.457) (-438.526) (-443.154) [-439.550] -- 0:00:54
18500 -- (-436.090) (-430.749) [-444.341] (-432.091) * (-431.806) (-440.207) (-446.530) [-437.097] -- 0:00:53
19000 -- (-433.297) (-432.833) (-443.131) [-432.520] * (-432.663) (-437.202) [-438.438] (-436.585) -- 0:00:51
19500 -- (-432.003) (-432.859) [-438.307] (-436.469) * (-430.524) [-440.771] (-441.945) (-445.894) -- 0:00:50
20000 -- (-434.560) [-431.501] (-439.772) (-435.918) * [-430.997] (-443.680) (-436.716) (-440.954) -- 0:00:49
Average standard deviation of split frequencies: 0.064628
20500 -- (-431.228) (-432.824) (-447.795) [-431.025] * (-433.124) (-452.002) [-440.943] (-440.282) -- 0:00:47
21000 -- [-430.328] (-434.371) (-439.913) (-431.069) * (-434.902) (-443.721) [-444.071] (-440.943) -- 0:00:46
21500 -- (-432.005) (-436.318) [-436.967] (-430.685) * (-432.948) (-441.863) [-447.329] (-445.906) -- 0:00:45
22000 -- (-431.818) (-433.460) (-438.122) [-432.743] * [-431.479] (-437.653) (-445.787) (-440.781) -- 0:00:44
22500 -- (-433.603) [-432.285] (-443.560) (-433.158) * (-433.706) [-438.283] (-448.645) (-442.055) -- 0:00:43
23000 -- (-433.586) (-433.552) (-436.532) [-432.600] * (-438.007) [-435.246] (-441.288) (-443.155) -- 0:00:42
23500 -- (-432.331) (-431.933) (-443.277) [-432.033] * (-432.072) (-441.375) (-445.424) [-440.745] -- 0:00:41
24000 -- (-430.813) (-431.066) (-444.999) [-432.474] * (-430.633) [-438.891] (-440.048) (-446.402) -- 0:00:40
24500 -- (-432.033) (-433.567) (-439.273) [-431.029] * [-436.104] (-441.651) (-445.334) (-442.989) -- 0:00:39
25000 -- [-430.480] (-436.345) (-434.234) (-434.954) * [-433.083] (-439.966) (-439.298) (-443.625) -- 0:00:39
Average standard deviation of split frequencies: 0.043169
25500 -- (-430.859) [-432.612] (-432.314) (-432.580) * (-435.556) [-441.521] (-437.617) (-441.124) -- 0:00:38
26000 -- [-430.767] (-432.682) (-434.221) (-434.521) * (-433.522) (-443.472) (-436.416) [-442.934] -- 0:00:37
26500 -- (-432.881) (-433.810) (-437.280) [-431.089] * (-436.009) (-449.862) [-437.300] (-440.976) -- 0:00:36
27000 -- (-432.680) [-434.225] (-431.137) (-430.106) * (-432.472) (-438.773) [-448.210] (-442.122) -- 0:00:36
27500 -- (-432.005) (-430.264) [-431.958] (-431.018) * (-432.007) (-442.033) (-448.076) [-438.814] -- 0:00:35
28000 -- [-433.722] (-430.506) (-432.882) (-433.588) * [-431.215] (-447.639) (-442.419) (-453.600) -- 0:00:34
28500 -- (-430.712) [-430.496] (-433.707) (-433.869) * (-432.228) (-459.665) [-437.220] (-441.622) -- 0:00:34
29000 -- (-431.374) (-430.867) (-431.891) [-431.069] * [-431.801] (-450.338) (-445.937) (-436.443) -- 0:00:33
29500 -- (-433.055) [-430.830] (-431.427) (-431.693) * [-431.029] (-445.456) (-442.511) (-455.430) -- 0:00:32
30000 -- (-432.843) (-430.619) [-433.691] (-432.011) * [-431.865] (-442.450) (-438.074) (-450.850) -- 0:00:32
Average standard deviation of split frequencies: 0.049190
30500 -- (-432.024) (-432.615) [-431.868] (-430.045) * [-433.350] (-435.457) (-438.063) (-442.570) -- 0:00:31
31000 -- (-434.231) (-430.604) [-434.892] (-433.718) * (-434.118) [-432.497] (-439.256) (-433.216) -- 0:00:31
31500 -- (-436.839) (-432.599) (-432.988) [-431.752] * (-437.274) [-431.649] (-435.424) (-433.181) -- 0:00:30
32000 -- (-433.505) [-432.655] (-434.418) (-433.197) * (-430.377) [-432.254] (-444.580) (-431.165) -- 0:00:30
32500 -- (-432.234) (-433.215) [-433.784] (-439.091) * [-431.483] (-432.587) (-441.084) (-430.783) -- 0:00:59
33000 -- (-434.557) (-431.958) (-433.104) [-435.205] * (-432.489) (-431.438) (-444.608) [-430.886] -- 0:00:58
33500 -- (-431.708) [-431.898] (-430.924) (-431.533) * (-431.504) (-430.336) (-445.345) [-431.716] -- 0:00:57
34000 -- (-433.770) (-431.364) (-431.047) [-431.080] * (-431.649) (-432.242) (-445.766) [-432.099] -- 0:00:56
34500 -- (-431.623) (-431.027) (-431.717) [-432.491] * (-432.193) [-430.201] (-443.164) (-436.458) -- 0:00:55
35000 -- (-432.541) (-432.434) [-432.534] (-431.546) * [-433.281] (-435.359) (-447.211) (-434.533) -- 0:00:55
Average standard deviation of split frequencies: 0.043905
35500 -- (-435.188) (-432.009) (-430.701) [-432.611] * (-434.698) (-440.002) (-447.183) [-435.421] -- 0:00:54
36000 -- (-430.241) [-432.619] (-436.699) (-434.169) * (-432.583) (-430.827) (-439.733) [-433.137] -- 0:00:53
36500 -- (-435.270) (-435.353) [-432.646] (-432.380) * [-430.976] (-432.102) (-443.183) (-430.564) -- 0:00:52
37000 -- [-430.309] (-433.911) (-434.369) (-432.847) * [-432.487] (-434.479) (-446.960) (-431.940) -- 0:00:52
37500 -- (-432.534) (-433.076) (-432.289) [-430.934] * [-430.586] (-432.159) (-439.416) (-430.491) -- 0:00:51
38000 -- (-432.440) (-431.409) [-432.891] (-438.518) * [-430.817] (-437.926) (-438.781) (-432.897) -- 0:00:50
38500 -- (-432.332) (-432.503) [-430.181] (-434.841) * (-436.198) (-430.922) [-439.845] (-436.550) -- 0:00:49
39000 -- (-432.178) (-432.304) (-435.519) [-435.733] * [-430.129] (-432.158) (-443.505) (-433.525) -- 0:00:49
39500 -- [-431.735] (-433.734) (-433.561) (-432.267) * (-432.437) [-430.054] (-453.470) (-432.227) -- 0:00:48
40000 -- (-432.464) [-431.997] (-436.536) (-432.858) * [-430.631] (-434.827) (-442.580) (-433.768) -- 0:00:48
Average standard deviation of split frequencies: 0.044322
40500 -- (-429.973) [-431.326] (-436.152) (-432.737) * (-430.529) (-439.717) (-458.196) [-433.989] -- 0:00:47
41000 -- (-432.311) (-434.153) [-430.786] (-430.855) * (-431.718) [-432.036] (-436.947) (-430.706) -- 0:00:46
41500 -- (-431.784) (-433.488) [-430.681] (-430.315) * [-433.375] (-432.458) (-431.334) (-431.713) -- 0:00:46
42000 -- (-432.504) (-430.441) (-435.574) [-431.386] * (-432.616) (-432.876) (-433.150) [-430.766] -- 0:00:45
42500 -- (-432.737) (-431.453) [-431.015] (-431.243) * [-431.019] (-430.932) (-436.019) (-430.929) -- 0:00:45
43000 -- (-436.066) (-430.723) [-434.122] (-434.112) * (-432.364) [-434.269] (-431.508) (-434.927) -- 0:00:44
43500 -- [-439.284] (-430.943) (-431.214) (-432.620) * (-435.273) (-432.433) [-430.909] (-431.658) -- 0:00:43
44000 -- (-435.721) (-433.704) (-432.656) [-431.752] * (-433.596) (-435.219) (-431.994) [-431.288] -- 0:00:43
44500 -- (-430.460) (-434.859) [-430.878] (-432.807) * (-431.880) [-433.165] (-430.699) (-431.597) -- 0:00:42
45000 -- (-430.932) [-435.416] (-430.961) (-434.379) * (-430.970) (-434.108) (-431.463) [-432.755] -- 0:00:42
Average standard deviation of split frequencies: 0.038663
45500 -- (-432.371) (-437.461) [-432.143] (-431.068) * (-433.429) [-434.108] (-430.611) (-431.282) -- 0:00:41
46000 -- (-430.375) [-436.737] (-432.086) (-434.233) * (-432.832) (-433.470) [-430.741] (-432.353) -- 0:00:41
46500 -- (-433.942) (-432.230) (-433.096) [-431.945] * [-433.352] (-431.186) (-435.063) (-433.749) -- 0:00:41
47000 -- [-432.282] (-432.892) (-435.709) (-431.104) * (-433.251) (-431.272) (-432.530) [-431.772] -- 0:00:40
47500 -- [-433.393] (-430.624) (-432.636) (-433.315) * (-430.803) [-431.479] (-431.652) (-430.043) -- 0:00:40
48000 -- (-431.388) [-431.630] (-430.315) (-433.178) * (-440.216) [-431.842] (-432.821) (-430.364) -- 0:00:39
48500 -- (-435.295) [-431.450] (-431.229) (-431.499) * (-434.139) [-430.582] (-430.550) (-432.653) -- 0:00:39
49000 -- (-433.462) [-432.296] (-430.798) (-432.346) * (-432.066) [-431.803] (-431.913) (-431.566) -- 0:00:38
49500 -- (-433.868) (-432.785) [-431.046] (-431.930) * (-431.726) (-432.692) [-430.233] (-438.098) -- 0:00:38
50000 -- (-432.060) (-430.513) [-431.845] (-436.493) * [-432.215] (-433.645) (-431.128) (-431.940) -- 0:00:57
Average standard deviation of split frequencies: 0.030127
50500 -- (-431.738) [-432.246] (-430.470) (-433.558) * (-431.114) (-437.363) [-432.099] (-431.733) -- 0:00:56
51000 -- (-433.288) [-433.787] (-431.664) (-435.786) * (-431.022) [-434.059] (-432.821) (-433.084) -- 0:00:55
51500 -- (-432.750) [-434.328] (-432.438) (-431.046) * (-431.618) [-430.176] (-433.151) (-432.982) -- 0:00:55
52000 -- (-432.514) [-432.581] (-436.316) (-432.893) * (-430.422) (-431.252) [-432.858] (-433.939) -- 0:00:54
52500 -- [-433.120] (-432.322) (-435.002) (-432.359) * (-434.406) [-435.127] (-435.624) (-434.495) -- 0:00:54
53000 -- [-430.160] (-430.944) (-432.272) (-434.373) * (-432.665) (-431.987) (-433.768) [-430.354] -- 0:00:53
53500 -- [-433.503] (-430.355) (-431.905) (-435.597) * (-434.356) (-432.073) [-430.171] (-431.058) -- 0:00:53
54000 -- [-434.840] (-432.553) (-431.851) (-434.070) * [-432.322] (-434.072) (-433.624) (-433.197) -- 0:00:52
54500 -- [-433.623] (-432.459) (-431.886) (-434.100) * (-433.184) (-432.402) (-433.427) [-433.435] -- 0:00:52
55000 -- (-432.450) [-430.423] (-430.219) (-430.799) * [-432.778] (-433.464) (-431.972) (-432.047) -- 0:00:51
Average standard deviation of split frequencies: 0.031900
55500 -- (-433.729) (-430.631) [-430.051] (-432.519) * (-431.184) [-431.531] (-430.511) (-434.299) -- 0:00:51
56000 -- (-430.664) (-435.682) [-436.055] (-440.444) * (-429.967) (-432.551) (-433.383) [-432.302] -- 0:00:50
56500 -- (-430.440) [-432.585] (-437.238) (-435.114) * [-431.342] (-435.836) (-433.968) (-430.675) -- 0:00:50
57000 -- (-432.575) (-432.014) (-431.335) [-432.605] * (-433.514) [-430.900] (-430.574) (-430.378) -- 0:00:49
57500 -- [-431.718] (-430.334) (-432.104) (-432.006) * (-433.752) [-430.645] (-430.561) (-430.653) -- 0:00:49
58000 -- [-431.802] (-437.028) (-431.151) (-431.789) * (-432.453) (-433.700) (-434.352) [-432.666] -- 0:00:48
58500 -- (-432.897) (-434.566) [-431.532] (-432.696) * (-433.379) [-433.057] (-435.696) (-430.689) -- 0:00:48
59000 -- [-432.877] (-432.458) (-434.132) (-434.568) * (-433.174) (-432.464) [-434.432] (-433.549) -- 0:00:47
59500 -- [-431.869] (-432.291) (-433.539) (-431.706) * (-435.601) [-433.076] (-435.227) (-432.611) -- 0:00:47
60000 -- (-431.201) [-430.872] (-435.277) (-436.237) * (-433.315) (-431.828) [-435.102] (-430.235) -- 0:00:47
Average standard deviation of split frequencies: 0.029916
60500 -- [-431.410] (-430.566) (-434.126) (-436.305) * (-436.277) (-430.294) [-430.814] (-433.413) -- 0:00:46
61000 -- (-431.195) [-431.562] (-435.229) (-434.885) * (-432.026) (-430.849) (-431.661) [-431.268] -- 0:00:46
61500 -- (-433.355) [-431.459] (-431.195) (-430.555) * (-436.092) (-431.930) [-436.061] (-433.145) -- 0:00:45
62000 -- (-435.828) (-432.022) [-431.276] (-431.805) * (-433.777) [-431.985] (-437.570) (-431.266) -- 0:00:45
62500 -- [-436.555] (-435.136) (-433.163) (-434.933) * (-433.551) (-433.021) (-440.082) [-431.869] -- 0:00:45
63000 -- (-430.040) (-430.337) (-432.723) [-435.555] * (-430.805) (-432.665) [-432.739] (-433.459) -- 0:00:44
63500 -- (-432.352) [-432.240] (-432.360) (-434.154) * (-433.688) (-432.220) (-434.206) [-433.458] -- 0:00:44
64000 -- (-434.703) (-434.135) [-432.881] (-434.444) * [-430.651] (-431.406) (-431.414) (-431.009) -- 0:00:43
64500 -- (-433.832) (-440.106) (-430.934) [-432.340] * [-431.191] (-431.469) (-430.826) (-433.404) -- 0:00:43
65000 -- (-436.601) [-430.903] (-431.960) (-435.183) * [-430.072] (-436.161) (-436.207) (-435.263) -- 0:00:43
Average standard deviation of split frequencies: 0.029219
65500 -- (-433.138) [-431.159] (-434.029) (-431.881) * [-431.485] (-432.971) (-436.195) (-430.416) -- 0:00:42
66000 -- [-432.204] (-432.526) (-436.407) (-432.361) * (-430.075) (-430.983) [-433.822] (-430.675) -- 0:00:42
66500 -- (-432.609) (-433.806) [-431.160] (-431.489) * (-434.391) (-431.106) [-431.897] (-430.896) -- 0:00:42
67000 -- (-430.561) (-432.926) [-432.119] (-431.662) * (-434.025) (-436.301) (-430.456) [-430.695] -- 0:00:55
67500 -- (-430.630) [-431.033] (-432.646) (-432.836) * (-431.929) (-434.122) (-430.025) [-430.592] -- 0:00:55
68000 -- [-430.659] (-436.357) (-432.480) (-431.940) * (-431.511) (-430.905) [-431.144] (-434.662) -- 0:00:54
68500 -- (-433.186) (-430.240) [-430.818] (-430.484) * (-430.933) [-430.800] (-431.628) (-430.086) -- 0:00:54
69000 -- (-433.562) (-435.026) (-432.190) [-435.495] * [-432.193] (-433.354) (-433.341) (-433.635) -- 0:00:53
69500 -- (-432.139) [-432.421] (-430.791) (-431.507) * [-430.111] (-430.825) (-434.794) (-432.312) -- 0:00:53
70000 -- (-432.353) (-436.274) (-433.840) [-433.954] * (-432.503) [-429.928] (-431.517) (-431.810) -- 0:00:53
Average standard deviation of split frequencies: 0.025774
70500 -- (-431.060) (-433.192) (-431.849) [-433.120] * (-432.029) (-430.792) (-430.177) [-431.842] -- 0:00:52
71000 -- (-440.036) [-432.091] (-433.168) (-431.710) * (-433.910) (-433.513) [-433.014] (-433.422) -- 0:00:52
71500 -- (-431.659) [-430.750] (-431.332) (-430.919) * (-432.448) (-435.666) [-430.873] (-431.524) -- 0:00:51
72000 -- (-431.793) [-433.598] (-432.256) (-432.034) * (-431.507) (-430.209) (-435.458) [-431.879] -- 0:00:51
72500 -- (-430.822) (-433.191) (-431.104) [-432.656] * (-431.314) (-430.934) [-431.845] (-430.149) -- 0:00:51
73000 -- (-432.828) (-430.007) [-431.790] (-431.741) * (-430.207) (-430.545) (-430.552) [-430.627] -- 0:00:50
73500 -- (-433.106) (-432.714) [-431.292] (-430.332) * [-430.154] (-433.717) (-431.577) (-431.586) -- 0:00:50
74000 -- (-433.091) (-430.792) (-432.965) [-430.265] * (-432.218) (-434.882) [-430.659] (-430.122) -- 0:00:50
74500 -- [-432.767] (-429.854) (-431.742) (-434.202) * (-433.423) (-432.296) [-430.860] (-432.121) -- 0:00:49
75000 -- (-432.768) [-431.998] (-431.701) (-432.865) * (-431.060) (-430.689) (-430.430) [-430.924] -- 0:00:49
Average standard deviation of split frequencies: 0.024484
75500 -- (-432.762) (-431.415) (-433.124) [-430.187] * (-431.999) [-431.290] (-430.555) (-432.669) -- 0:00:48
76000 -- (-432.860) (-430.806) [-431.292] (-431.255) * (-432.564) (-434.688) [-431.148] (-433.268) -- 0:00:48
76500 -- (-434.215) (-432.982) [-432.528] (-433.036) * (-436.429) [-430.428] (-432.210) (-436.454) -- 0:00:48
77000 -- [-432.641] (-436.519) (-432.437) (-435.779) * (-436.081) (-432.154) (-430.498) [-430.632] -- 0:00:47
77500 -- (-434.089) (-433.511) [-431.002] (-433.368) * (-431.513) [-432.876] (-433.092) (-432.257) -- 0:00:47
78000 -- (-434.149) (-432.363) (-433.794) [-432.124] * (-430.160) [-433.697] (-435.223) (-432.363) -- 0:00:47
78500 -- (-432.611) (-432.037) (-430.057) [-431.342] * [-430.887] (-433.687) (-435.768) (-430.469) -- 0:00:46
79000 -- (-433.961) [-434.916] (-430.097) (-431.835) * [-430.230] (-434.454) (-434.414) (-430.227) -- 0:00:46
79500 -- (-430.982) (-436.086) [-432.406] (-432.736) * (-431.708) (-431.283) [-434.000] (-432.596) -- 0:00:46
80000 -- (-433.105) (-434.938) (-432.992) [-432.148] * [-433.367] (-433.448) (-431.211) (-431.349) -- 0:00:46
Average standard deviation of split frequencies: 0.021838
80500 -- [-431.240] (-433.080) (-435.673) (-430.353) * [-431.755] (-432.925) (-431.426) (-432.059) -- 0:00:45
81000 -- [-432.981] (-431.395) (-431.019) (-430.898) * (-430.521) [-432.580] (-434.549) (-431.534) -- 0:00:45
81500 -- (-436.097) (-431.952) (-432.855) [-431.652] * (-430.527) (-434.026) [-432.102] (-430.779) -- 0:00:45
82000 -- [-433.631] (-437.295) (-433.986) (-431.387) * (-439.029) (-431.272) (-431.751) [-430.481] -- 0:00:44
82500 -- (-431.657) (-440.597) (-437.043) [-433.466] * (-432.640) [-431.493] (-432.027) (-434.026) -- 0:00:44
83000 -- (-430.031) (-433.981) (-431.232) [-431.216] * (-432.190) (-433.083) [-433.772] (-430.827) -- 0:00:44
83500 -- (-432.136) [-430.243] (-431.144) (-436.030) * (-429.943) (-432.000) [-432.042] (-434.146) -- 0:00:43
84000 -- (-433.766) (-432.477) [-430.992] (-434.051) * (-435.648) (-430.527) (-432.898) [-430.893] -- 0:00:43
84500 -- (-438.659) (-431.218) [-431.770] (-434.692) * (-431.697) (-431.048) (-434.995) [-431.904] -- 0:00:54
85000 -- (-438.875) (-432.392) [-433.901] (-432.261) * [-430.867] (-432.758) (-433.909) (-430.824) -- 0:00:53
Average standard deviation of split frequencies: 0.019329
85500 -- (-436.068) (-433.301) [-431.642] (-436.648) * (-434.230) (-434.399) (-430.379) [-431.434] -- 0:00:53
86000 -- (-434.301) (-433.064) [-432.786] (-431.821) * (-431.997) [-432.457] (-432.595) (-430.789) -- 0:00:53
86500 -- [-432.043] (-431.471) (-433.786) (-434.368) * (-431.968) (-433.519) [-431.221] (-431.482) -- 0:00:52
87000 -- (-431.983) (-432.748) (-432.715) [-431.063] * (-438.416) [-430.225] (-430.547) (-431.225) -- 0:00:52
87500 -- [-432.443] (-431.955) (-432.589) (-431.807) * (-432.421) (-430.875) (-431.618) [-433.369] -- 0:00:52
88000 -- (-430.416) (-432.154) (-432.321) [-432.348] * (-434.236) (-430.961) [-431.006] (-430.696) -- 0:00:51
88500 -- (-430.380) (-433.452) [-433.410] (-439.435) * (-432.011) (-435.426) (-431.373) [-431.792] -- 0:00:51
89000 -- (-431.011) [-432.892] (-431.772) (-439.811) * (-431.636) (-431.719) (-433.113) [-432.426] -- 0:00:51
89500 -- (-430.802) (-430.098) (-434.510) [-439.600] * [-430.746] (-433.616) (-433.932) (-433.594) -- 0:00:50
90000 -- [-434.474] (-435.098) (-433.592) (-436.663) * [-433.052] (-436.521) (-431.861) (-431.653) -- 0:00:50
Average standard deviation of split frequencies: 0.018656
90500 -- (-431.855) (-430.719) [-433.828] (-433.441) * [-431.466] (-433.518) (-431.273) (-432.512) -- 0:00:50
91000 -- (-431.215) (-443.142) [-432.639] (-435.737) * (-430.946) (-434.314) [-432.508] (-429.887) -- 0:00:49
91500 -- [-430.920] (-432.291) (-436.049) (-431.339) * (-430.623) [-430.481] (-439.085) (-432.665) -- 0:00:49
92000 -- (-432.729) (-432.015) (-436.670) [-434.564] * (-433.618) (-432.656) [-431.284] (-434.253) -- 0:00:49
92500 -- [-432.841] (-431.977) (-430.486) (-432.557) * [-433.892] (-431.744) (-432.531) (-432.020) -- 0:00:49
93000 -- (-432.277) [-430.432] (-430.617) (-431.078) * [-430.470] (-432.342) (-431.899) (-432.979) -- 0:00:48
93500 -- (-431.761) [-431.356] (-430.877) (-434.929) * (-431.765) (-432.445) (-434.270) [-431.274] -- 0:00:48
94000 -- (-432.272) (-432.042) [-431.377] (-433.679) * (-436.673) [-434.409] (-432.284) (-431.689) -- 0:00:48
94500 -- (-430.802) [-431.804] (-432.959) (-433.361) * (-436.452) (-436.872) (-436.160) [-430.380] -- 0:00:47
95000 -- (-430.119) [-431.119] (-431.813) (-432.327) * [-431.817] (-434.023) (-432.763) (-431.626) -- 0:00:47
Average standard deviation of split frequencies: 0.021709
95500 -- [-430.729] (-432.090) (-433.933) (-430.622) * (-432.199) (-435.103) [-430.786] (-435.549) -- 0:00:47
96000 -- [-430.810] (-432.302) (-432.427) (-431.948) * (-431.763) (-432.260) (-433.466) [-434.234] -- 0:00:47
96500 -- (-430.699) (-431.633) [-430.183] (-431.201) * (-431.026) (-434.254) (-433.533) [-432.780] -- 0:00:46
97000 -- (-432.087) (-431.135) (-434.051) [-431.186] * [-433.529] (-433.303) (-430.443) (-432.391) -- 0:00:46
97500 -- [-435.054] (-430.311) (-433.774) (-430.125) * (-433.912) (-432.882) [-435.776] (-434.591) -- 0:00:46
98000 -- (-439.135) (-433.791) (-433.917) [-431.956] * (-432.695) [-434.757] (-435.752) (-430.290) -- 0:00:46
98500 -- (-435.035) (-432.002) (-431.831) [-430.037] * [-431.605] (-434.157) (-433.224) (-434.005) -- 0:00:45
99000 -- [-440.438] (-432.615) (-433.957) (-431.000) * [-432.778] (-432.181) (-435.206) (-432.991) -- 0:00:45
99500 -- (-433.832) (-430.094) [-433.308] (-437.897) * (-432.152) [-432.754] (-430.749) (-433.561) -- 0:00:45
100000 -- (-437.225) (-433.106) (-432.493) [-433.042] * [-435.432] (-432.352) (-430.412) (-433.942) -- 0:00:45
Average standard deviation of split frequencies: 0.020813
100500 -- (-431.460) [-433.871] (-432.968) (-430.316) * (-432.205) [-432.179] (-431.316) (-436.714) -- 0:00:44
101000 -- [-431.509] (-435.277) (-431.250) (-432.155) * (-432.199) (-431.249) [-434.458] (-433.163) -- 0:00:53
101500 -- (-431.754) (-430.631) [-431.294] (-432.986) * (-431.235) (-434.142) [-430.865] (-433.521) -- 0:00:53
102000 -- (-431.474) [-430.979] (-431.236) (-431.327) * [-430.946] (-433.156) (-430.502) (-433.742) -- 0:00:52
102500 -- (-430.452) [-431.324] (-431.899) (-430.673) * [-432.950] (-432.148) (-431.237) (-431.930) -- 0:00:52
103000 -- (-432.941) (-430.754) (-430.685) [-433.351] * [-431.981] (-431.413) (-432.594) (-434.078) -- 0:00:52
103500 -- (-430.465) (-431.640) (-432.154) [-434.433] * [-431.244] (-431.422) (-434.772) (-430.462) -- 0:00:51
104000 -- [-430.708] (-432.784) (-432.109) (-437.708) * (-434.832) (-430.311) (-432.538) [-430.661] -- 0:00:51
104500 -- [-430.203] (-432.510) (-431.967) (-434.350) * (-431.359) (-430.554) [-430.850] (-436.342) -- 0:00:51
105000 -- (-431.599) [-431.858] (-431.186) (-430.810) * (-432.153) (-432.094) (-431.612) [-431.651] -- 0:00:51
Average standard deviation of split frequencies: 0.018491
105500 -- [-431.817] (-431.982) (-431.053) (-431.192) * (-436.080) (-430.427) (-435.927) [-433.133] -- 0:00:50
106000 -- [-431.608] (-431.960) (-432.001) (-432.833) * (-433.261) (-433.146) (-431.283) [-430.684] -- 0:00:50
106500 -- (-432.960) (-432.396) [-433.902] (-431.076) * (-432.816) [-432.675] (-431.554) (-433.537) -- 0:00:50
107000 -- (-431.548) [-430.941] (-431.104) (-431.143) * (-435.353) (-432.381) [-430.158] (-431.143) -- 0:00:50
107500 -- [-431.340] (-430.961) (-433.166) (-433.330) * (-433.461) (-432.273) (-433.538) [-431.073] -- 0:00:49
108000 -- [-432.731] (-430.180) (-431.878) (-430.558) * (-431.216) (-434.691) [-431.220] (-431.630) -- 0:00:49
108500 -- [-430.146] (-436.811) (-434.443) (-430.904) * (-433.155) (-431.642) (-435.608) [-430.593] -- 0:00:49
109000 -- (-433.701) (-435.596) (-433.435) [-430.727] * [-433.298] (-433.513) (-434.331) (-430.245) -- 0:00:49
109500 -- (-432.399) (-430.479) (-440.538) [-430.061] * (-431.684) (-437.979) [-433.554] (-429.978) -- 0:00:48
110000 -- [-431.408] (-430.270) (-430.856) (-430.462) * (-432.831) (-431.132) [-430.351] (-432.769) -- 0:00:48
Average standard deviation of split frequencies: 0.018695
110500 -- (-432.494) (-433.579) [-432.489] (-435.068) * (-432.747) (-433.222) [-431.115] (-434.569) -- 0:00:48
111000 -- (-434.442) [-430.387] (-432.021) (-432.774) * [-431.430] (-434.146) (-430.452) (-430.982) -- 0:00:48
111500 -- (-435.549) [-430.195] (-435.872) (-432.664) * (-433.187) (-432.684) (-430.833) [-433.660] -- 0:00:47
112000 -- (-432.253) [-432.088] (-432.638) (-433.033) * (-435.415) (-432.628) [-430.164] (-430.759) -- 0:00:47
112500 -- (-436.837) [-431.484] (-433.253) (-431.558) * (-431.491) (-432.108) [-430.636] (-431.229) -- 0:00:47
113000 -- (-433.309) (-435.983) [-432.894] (-430.479) * (-431.259) [-431.727] (-434.948) (-433.354) -- 0:00:47
113500 -- (-431.708) [-433.333] (-433.297) (-434.361) * (-431.662) (-432.264) (-436.270) [-434.304] -- 0:00:46
114000 -- (-431.491) (-431.481) [-433.868] (-431.524) * [-432.250] (-433.530) (-430.107) (-430.817) -- 0:00:46
114500 -- (-430.764) [-437.456] (-436.890) (-432.190) * [-432.426] (-431.063) (-430.930) (-434.320) -- 0:00:46
115000 -- (-434.769) [-431.715] (-433.814) (-432.452) * (-432.657) (-431.720) [-431.322] (-433.861) -- 0:00:46
Average standard deviation of split frequencies: 0.020558
115500 -- (-433.174) (-430.709) (-432.153) [-431.176] * (-434.810) (-431.021) [-431.471] (-433.187) -- 0:00:45
116000 -- (-432.005) (-432.896) (-433.144) [-434.055] * (-431.323) (-431.562) [-431.185] (-431.812) -- 0:00:45
116500 -- (-433.429) (-432.501) [-432.879] (-433.338) * (-430.994) (-430.671) [-431.871] (-431.852) -- 0:00:45
117000 -- [-433.409] (-432.515) (-430.389) (-431.019) * (-433.280) [-437.332] (-434.174) (-431.359) -- 0:00:45
117500 -- (-431.022) (-431.320) (-435.105) [-431.998] * (-430.794) (-433.016) [-433.694] (-431.520) -- 0:00:45
118000 -- (-431.177) (-431.676) (-440.857) [-436.323] * (-431.439) (-432.959) (-433.051) [-431.218] -- 0:00:44
118500 -- (-431.896) (-431.437) (-433.251) [-431.989] * (-435.047) (-431.739) [-432.260] (-434.427) -- 0:00:52
119000 -- [-431.905] (-434.582) (-434.774) (-431.301) * (-441.516) (-431.089) [-432.513] (-431.442) -- 0:00:51
119500 -- (-432.943) (-433.862) [-430.748] (-431.205) * (-433.952) (-431.866) (-434.179) [-430.686] -- 0:00:51
120000 -- (-433.870) (-433.569) [-430.617] (-431.774) * (-433.635) (-432.533) [-434.178] (-430.544) -- 0:00:51
Average standard deviation of split frequencies: 0.015627
120500 -- [-434.679] (-430.785) (-431.232) (-432.111) * (-431.109) (-435.204) [-431.264] (-434.076) -- 0:00:51
121000 -- [-430.603] (-430.789) (-432.993) (-432.396) * [-433.776] (-433.751) (-430.842) (-435.393) -- 0:00:50
121500 -- (-436.076) (-431.147) [-430.888] (-430.507) * (-431.130) [-433.160] (-431.072) (-431.443) -- 0:00:50
122000 -- (-430.960) (-431.944) [-431.891] (-434.701) * (-431.385) (-432.010) (-430.754) [-431.341] -- 0:00:50
122500 -- (-436.293) (-431.292) (-432.701) [-430.341] * (-432.629) [-431.848] (-431.450) (-435.744) -- 0:00:50
123000 -- (-438.519) [-431.898] (-434.520) (-431.410) * (-434.398) [-434.133] (-430.551) (-433.050) -- 0:00:49
123500 -- (-435.090) (-432.008) [-431.657] (-437.821) * (-431.148) (-437.323) (-431.101) [-431.370] -- 0:00:49
124000 -- [-431.316] (-430.585) (-432.790) (-433.996) * (-431.243) (-429.947) (-431.806) [-432.301] -- 0:00:49
124500 -- (-431.954) [-431.947] (-431.746) (-434.550) * [-435.982] (-433.061) (-435.310) (-437.861) -- 0:00:49
125000 -- (-430.851) (-435.477) (-433.070) [-433.190] * (-436.993) [-429.933] (-432.756) (-432.959) -- 0:00:49
Average standard deviation of split frequencies: 0.017252
125500 -- (-430.513) (-432.854) (-431.548) [-432.739] * (-432.424) [-432.164] (-432.080) (-432.009) -- 0:00:48
126000 -- [-430.860] (-431.087) (-431.251) (-432.537) * (-431.734) (-431.132) (-432.484) [-430.877] -- 0:00:48
126500 -- (-433.472) (-430.305) [-431.309] (-434.025) * (-431.614) (-432.885) (-433.966) [-431.094] -- 0:00:48
127000 -- (-431.206) (-431.739) [-435.066] (-433.358) * (-433.106) (-433.546) [-430.357] (-432.739) -- 0:00:48
127500 -- (-432.290) (-431.323) (-430.476) [-432.502] * [-431.287] (-438.905) (-436.048) (-433.133) -- 0:00:47
128000 -- (-430.152) [-433.879] (-434.018) (-432.799) * [-432.186] (-442.262) (-431.442) (-432.927) -- 0:00:47
128500 -- [-434.032] (-431.018) (-431.079) (-433.175) * (-433.213) [-437.113] (-432.557) (-431.438) -- 0:00:47
129000 -- [-434.429] (-431.082) (-431.795) (-435.610) * [-433.092] (-432.592) (-433.105) (-430.549) -- 0:00:47
129500 -- (-430.794) (-432.068) [-434.467] (-439.680) * (-435.033) [-434.558] (-432.591) (-432.521) -- 0:00:47
130000 -- (-430.483) [-431.745] (-434.636) (-435.422) * (-438.371) (-435.681) [-430.224] (-431.612) -- 0:00:46
Average standard deviation of split frequencies: 0.017659
130500 -- (-430.788) [-430.074] (-430.731) (-439.636) * (-438.651) (-431.846) (-431.627) [-431.675] -- 0:00:46
131000 -- (-430.279) (-433.869) (-431.294) [-432.971] * (-439.255) (-433.272) (-433.247) [-430.465] -- 0:00:46
131500 -- (-430.380) (-431.720) [-431.213] (-430.731) * (-435.398) [-432.317] (-435.270) (-433.028) -- 0:00:46
132000 -- (-433.470) [-431.087] (-430.568) (-431.541) * (-441.552) (-430.663) (-433.870) [-430.772] -- 0:00:46
132500 -- (-433.023) (-432.201) [-431.092] (-431.327) * (-438.910) [-432.540] (-431.318) (-433.122) -- 0:00:45
133000 -- (-432.444) (-431.271) (-432.035) [-435.333] * (-431.641) (-433.623) [-430.879] (-430.689) -- 0:00:45
133500 -- [-432.278] (-431.450) (-436.304) (-433.364) * (-432.766) (-430.153) (-433.406) [-432.724] -- 0:00:45
134000 -- [-434.333] (-430.676) (-431.854) (-431.252) * (-431.280) [-430.203] (-433.761) (-431.468) -- 0:00:45
134500 -- (-433.540) (-430.658) [-431.634] (-431.401) * (-434.111) [-430.289] (-431.063) (-436.199) -- 0:00:45
135000 -- [-431.242] (-431.624) (-433.238) (-432.727) * [-433.039] (-431.423) (-431.375) (-431.162) -- 0:00:44
Average standard deviation of split frequencies: 0.020432
135500 -- (-431.834) (-431.485) (-436.513) [-433.265] * (-435.269) (-431.769) (-431.888) [-431.840] -- 0:00:44
136000 -- [-431.950] (-433.347) (-433.061) (-432.885) * (-439.009) [-431.427] (-431.593) (-435.438) -- 0:00:50
136500 -- (-433.054) [-433.504] (-431.644) (-433.457) * [-434.681] (-431.494) (-433.179) (-432.419) -- 0:00:50
137000 -- (-431.521) [-432.022] (-432.930) (-433.237) * (-432.335) (-431.619) (-434.996) [-433.477] -- 0:00:50
137500 -- (-435.041) (-430.035) [-431.891] (-432.663) * (-432.048) (-434.524) [-432.595] (-435.172) -- 0:00:50
138000 -- (-431.851) (-432.514) (-434.803) [-431.933] * (-432.999) (-430.935) [-432.466] (-432.174) -- 0:00:49
138500 -- (-430.736) [-430.572] (-432.156) (-432.404) * (-430.932) [-432.888] (-430.183) (-434.523) -- 0:00:49
139000 -- [-431.745] (-432.915) (-436.663) (-430.136) * (-430.844) (-431.980) (-431.302) [-431.976] -- 0:00:49
139500 -- (-431.452) (-434.273) [-433.453] (-431.804) * [-431.687] (-434.054) (-431.349) (-436.868) -- 0:00:49
140000 -- (-432.589) [-430.651] (-431.101) (-434.231) * (-430.848) (-432.284) [-436.322] (-432.081) -- 0:00:49
Average standard deviation of split frequencies: 0.019549
140500 -- (-433.413) [-431.820] (-430.524) (-431.350) * (-431.629) (-431.074) [-433.443] (-431.316) -- 0:00:48
141000 -- (-431.830) (-433.327) (-431.497) [-430.984] * (-432.385) (-432.184) [-432.291] (-430.963) -- 0:00:48
141500 -- (-431.168) (-433.132) (-433.630) [-433.321] * (-431.599) (-430.942) (-431.949) [-430.062] -- 0:00:48
142000 -- (-435.121) [-434.003] (-434.134) (-432.204) * (-430.234) [-430.377] (-433.450) (-433.789) -- 0:00:48
142500 -- (-434.514) (-432.435) [-435.316] (-433.440) * (-431.785) (-431.068) [-433.350] (-431.039) -- 0:00:48
143000 -- [-434.125] (-430.722) (-433.299) (-430.376) * (-431.366) (-433.642) [-433.129] (-436.114) -- 0:00:47
143500 -- (-430.916) (-431.419) [-431.772] (-437.392) * (-435.629) (-432.953) [-432.477] (-431.888) -- 0:00:47
144000 -- (-432.033) [-431.817] (-433.792) (-433.988) * (-432.226) (-430.234) [-431.446] (-432.181) -- 0:00:47
144500 -- (-430.600) (-436.529) [-431.848] (-431.373) * (-431.124) (-430.995) [-430.713] (-432.777) -- 0:00:47
145000 -- (-432.355) (-431.535) (-431.077) [-430.509] * (-433.845) [-433.914] (-431.301) (-431.565) -- 0:00:47
Average standard deviation of split frequencies: 0.020449
145500 -- [-432.313] (-431.818) (-432.475) (-433.662) * (-432.266) (-433.117) [-431.443] (-430.738) -- 0:00:46
146000 -- (-430.398) [-433.895] (-433.141) (-433.492) * (-434.320) (-432.393) [-432.731] (-430.682) -- 0:00:46
146500 -- (-431.344) (-431.347) (-432.491) [-431.170] * (-430.447) [-431.277] (-433.320) (-430.703) -- 0:00:46
147000 -- (-433.076) (-432.008) [-431.296] (-433.039) * [-429.989] (-431.045) (-432.256) (-431.836) -- 0:00:46
147500 -- (-432.157) (-431.922) (-431.065) [-431.409] * (-431.893) (-431.639) (-439.832) [-436.372] -- 0:00:46
148000 -- (-432.050) (-430.225) (-431.449) [-439.151] * (-432.030) (-432.107) [-432.028] (-438.015) -- 0:00:46
148500 -- [-430.851] (-432.986) (-432.303) (-435.301) * [-432.277] (-436.966) (-433.359) (-436.338) -- 0:00:45
149000 -- (-441.179) [-431.506] (-436.779) (-431.485) * (-432.735) [-431.421] (-431.795) (-440.720) -- 0:00:45
149500 -- (-431.379) (-434.419) (-431.052) [-433.474] * (-431.273) (-434.149) [-430.025] (-430.969) -- 0:00:45
150000 -- (-434.867) (-431.246) (-431.371) [-431.711] * [-433.564] (-431.849) (-435.998) (-435.730) -- 0:00:45
Average standard deviation of split frequencies: 0.018947
150500 -- (-431.384) (-433.437) (-431.914) [-431.552] * (-436.391) [-437.999] (-431.357) (-432.768) -- 0:00:45
151000 -- (-431.035) (-432.522) (-432.081) [-432.631] * (-433.617) (-431.463) (-434.884) [-432.401] -- 0:00:44
151500 -- (-433.932) [-430.384] (-432.036) (-434.029) * (-434.256) (-432.619) (-430.794) [-435.383] -- 0:00:44
152000 -- [-433.380] (-433.363) (-430.740) (-431.482) * (-438.498) (-432.126) [-433.693] (-437.288) -- 0:00:44
152500 -- (-431.075) (-437.757) [-431.240] (-435.215) * (-431.717) [-431.686] (-433.090) (-433.022) -- 0:00:44
153000 -- (-436.578) (-436.722) [-433.632] (-433.417) * (-431.136) (-434.504) (-434.057) [-429.898] -- 0:00:49
153500 -- (-431.673) (-434.633) [-430.983] (-434.657) * (-431.441) [-432.678] (-431.720) (-430.570) -- 0:00:49
154000 -- (-434.078) (-439.568) [-431.833] (-431.554) * (-430.585) [-433.274] (-433.229) (-430.454) -- 0:00:49
154500 -- (-433.765) [-431.516] (-430.867) (-433.943) * (-431.545) [-433.126] (-432.738) (-434.113) -- 0:00:49
155000 -- (-430.074) [-431.039] (-431.247) (-433.417) * (-433.189) (-430.866) [-432.953] (-432.629) -- 0:00:49
Average standard deviation of split frequencies: 0.021342
155500 -- [-430.401] (-431.159) (-432.715) (-430.163) * (-435.297) [-430.818] (-432.346) (-432.695) -- 0:00:48
156000 -- (-436.749) (-435.481) [-434.810] (-430.432) * (-435.615) [-430.816] (-434.785) (-432.608) -- 0:00:48
156500 -- [-433.411] (-434.165) (-432.370) (-432.531) * (-430.244) [-434.039] (-433.333) (-437.811) -- 0:00:48
157000 -- (-431.352) (-432.714) (-433.578) [-432.562] * [-434.794] (-432.639) (-430.076) (-436.731) -- 0:00:48
157500 -- (-433.905) (-431.755) [-433.913] (-434.643) * (-432.551) (-433.786) [-431.509] (-433.560) -- 0:00:48
158000 -- (-432.624) [-432.373] (-437.080) (-434.857) * [-432.140] (-432.205) (-430.821) (-431.324) -- 0:00:47
158500 -- (-431.090) (-434.773) (-432.888) [-430.434] * [-434.923] (-432.864) (-431.285) (-435.932) -- 0:00:47
159000 -- (-432.099) (-431.915) (-431.049) [-433.251] * (-431.685) (-431.027) [-433.091] (-435.902) -- 0:00:47
159500 -- (-431.645) (-432.405) (-434.682) [-431.601] * (-432.481) [-431.162] (-435.760) (-431.994) -- 0:00:47
160000 -- (-433.187) [-431.365] (-436.154) (-431.179) * (-434.968) (-433.212) (-431.160) [-433.162] -- 0:00:47
Average standard deviation of split frequencies: 0.023127
160500 -- [-432.733] (-431.079) (-431.388) (-439.674) * (-431.949) (-434.293) [-430.388] (-432.694) -- 0:00:47
161000 -- [-437.102] (-431.833) (-434.916) (-431.397) * (-432.801) (-434.660) (-433.543) [-432.116] -- 0:00:46
161500 -- (-431.229) (-431.235) (-433.769) [-432.011] * (-432.601) (-431.985) (-430.088) [-432.232] -- 0:00:46
162000 -- (-430.857) (-431.604) (-433.662) [-436.071] * (-432.908) (-432.039) [-430.934] (-430.568) -- 0:00:46
162500 -- (-431.708) (-430.799) (-433.432) [-431.679] * [-431.897] (-432.936) (-431.551) (-431.829) -- 0:00:46
163000 -- [-431.570] (-434.584) (-434.747) (-433.833) * (-432.232) (-432.426) (-436.090) [-434.349] -- 0:00:46
163500 -- (-431.093) (-430.555) (-432.786) [-432.569] * [-430.949] (-439.201) (-432.580) (-433.198) -- 0:00:46
164000 -- (-434.268) (-430.217) [-431.772] (-436.807) * [-430.787] (-435.024) (-431.572) (-430.849) -- 0:00:45
164500 -- (-433.093) (-430.695) (-431.990) [-432.035] * (-432.930) [-435.876] (-431.438) (-433.394) -- 0:00:45
165000 -- (-432.633) [-434.457] (-431.517) (-430.832) * (-434.721) (-434.140) (-430.269) [-432.358] -- 0:00:45
Average standard deviation of split frequencies: 0.022050
165500 -- (-432.668) (-433.245) (-440.357) [-431.218] * (-431.595) (-434.899) [-432.992] (-434.608) -- 0:00:45
166000 -- (-435.123) (-433.068) [-431.385] (-431.368) * [-433.112] (-433.264) (-434.565) (-433.354) -- 0:00:45
166500 -- [-430.473] (-433.802) (-430.839) (-430.118) * (-430.293) (-432.322) (-431.337) [-431.829] -- 0:00:45
167000 -- (-433.845) [-433.991] (-436.346) (-434.402) * (-432.164) (-430.762) (-432.411) [-431.943] -- 0:00:44
167500 -- (-433.520) (-432.851) (-436.837) [-431.189] * (-431.440) [-431.268] (-430.992) (-432.788) -- 0:00:44
168000 -- [-432.918] (-433.225) (-433.554) (-430.722) * (-430.822) (-432.769) [-433.983] (-433.375) -- 0:00:44
168500 -- [-431.395] (-435.280) (-430.775) (-431.627) * [-432.081] (-437.531) (-431.301) (-431.233) -- 0:00:49
169000 -- (-430.632) (-432.275) [-431.790] (-432.658) * (-430.498) (-431.001) (-431.120) [-431.892] -- 0:00:49
169500 -- (-434.639) (-433.877) [-433.887] (-433.029) * (-430.957) (-433.637) [-431.153] (-439.538) -- 0:00:48
170000 -- (-432.583) [-431.058] (-430.633) (-434.636) * (-432.070) [-434.094] (-433.002) (-433.739) -- 0:00:48
Average standard deviation of split frequencies: 0.018721
170500 -- (-431.168) (-432.999) [-430.795] (-436.037) * (-431.369) [-431.921] (-431.199) (-432.926) -- 0:00:48
171000 -- [-430.441] (-432.264) (-430.767) (-433.609) * [-434.054] (-435.455) (-433.155) (-430.836) -- 0:00:48
171500 -- (-433.165) [-432.310] (-433.470) (-433.007) * (-433.565) (-436.134) (-431.504) [-432.796] -- 0:00:48
172000 -- (-432.600) [-431.350] (-431.570) (-430.711) * (-433.604) (-435.502) (-430.822) [-432.244] -- 0:00:48
172500 -- (-436.489) (-431.472) (-431.335) [-432.608] * [-431.564] (-433.957) (-433.351) (-432.216) -- 0:00:47
173000 -- (-430.582) [-432.196] (-432.345) (-432.160) * (-432.379) (-432.523) (-434.867) [-430.787] -- 0:00:47
173500 -- [-435.453] (-430.882) (-437.831) (-430.752) * (-433.386) [-434.067] (-431.546) (-430.481) -- 0:00:47
174000 -- (-431.870) (-432.758) (-434.438) [-432.824] * (-432.636) [-434.897] (-431.260) (-431.198) -- 0:00:47
174500 -- (-430.377) [-432.413] (-436.625) (-433.115) * (-431.207) (-437.130) [-432.948] (-431.382) -- 0:00:47
175000 -- (-433.540) (-431.376) [-432.442] (-430.831) * (-432.732) (-433.976) [-431.227] (-431.228) -- 0:00:47
Average standard deviation of split frequencies: 0.019064
175500 -- [-430.520] (-432.993) (-432.766) (-432.920) * (-432.160) (-433.048) [-430.066] (-432.786) -- 0:00:46
176000 -- (-431.175) (-435.659) [-432.507] (-432.609) * (-432.555) (-433.967) [-430.161] (-435.445) -- 0:00:46
176500 -- (-431.680) (-431.167) [-430.555] (-433.456) * (-435.478) (-434.707) [-431.319] (-433.172) -- 0:00:46
177000 -- (-433.760) [-431.748] (-432.431) (-435.763) * (-431.510) [-433.376] (-432.185) (-434.728) -- 0:00:46
177500 -- (-433.814) (-431.350) [-431.784] (-430.939) * (-432.642) [-433.266] (-433.397) (-435.253) -- 0:00:46
178000 -- (-431.587) (-433.416) (-433.850) [-435.265] * [-431.567] (-434.001) (-430.900) (-433.419) -- 0:00:46
178500 -- (-433.732) (-434.855) [-432.281] (-431.507) * [-435.377] (-430.432) (-433.212) (-432.942) -- 0:00:46
179000 -- (-433.264) [-432.221] (-435.140) (-433.138) * (-431.081) [-431.513] (-432.642) (-433.827) -- 0:00:45
179500 -- (-434.565) [-430.808] (-430.565) (-432.134) * (-432.935) (-433.150) (-433.187) [-432.398] -- 0:00:45
180000 -- (-430.220) (-432.827) [-434.161] (-430.626) * (-431.361) (-432.695) [-433.754] (-432.305) -- 0:00:45
Average standard deviation of split frequencies: 0.018265
180500 -- (-430.380) [-431.956] (-431.302) (-438.964) * (-433.099) [-431.072] (-433.061) (-430.626) -- 0:00:45
181000 -- [-434.030] (-433.065) (-435.731) (-432.994) * (-431.536) [-431.170] (-433.769) (-434.401) -- 0:00:45
181500 -- (-431.717) [-434.263] (-442.255) (-431.994) * [-432.740] (-430.655) (-430.926) (-431.660) -- 0:00:45
182000 -- (-433.195) (-437.441) (-430.985) [-430.841] * (-433.700) [-432.973] (-433.172) (-432.598) -- 0:00:44
182500 -- (-433.654) (-434.378) (-435.867) [-435.876] * (-436.465) (-432.528) [-433.570] (-431.251) -- 0:00:44
183000 -- (-431.390) [-430.990] (-430.998) (-435.938) * (-433.034) (-431.057) [-433.943] (-432.033) -- 0:00:44
183500 -- (-431.073) (-435.677) (-431.566) [-430.478] * [-432.759] (-431.787) (-430.963) (-431.015) -- 0:00:48
184000 -- (-431.614) [-431.537] (-434.200) (-434.086) * (-436.079) [-432.696] (-431.005) (-433.642) -- 0:00:48
184500 -- (-433.102) (-430.637) [-433.946] (-433.678) * (-433.174) (-430.662) (-433.873) [-434.170] -- 0:00:48
185000 -- (-433.031) [-433.016] (-436.024) (-430.835) * (-430.616) (-430.475) [-429.990] (-432.934) -- 0:00:48
Average standard deviation of split frequencies: 0.017741
185500 -- (-430.202) [-431.973] (-432.083) (-430.405) * (-432.461) (-431.604) [-430.846] (-432.289) -- 0:00:48
186000 -- (-434.728) [-432.144] (-431.350) (-433.526) * (-436.401) (-437.135) (-432.226) [-431.419] -- 0:00:48
186500 -- [-431.196] (-429.788) (-434.637) (-433.581) * (-432.620) (-431.924) [-431.448] (-433.475) -- 0:00:47
187000 -- (-432.559) (-430.427) (-440.221) [-432.003] * (-432.576) [-431.318] (-434.236) (-431.000) -- 0:00:47
187500 -- (-434.445) [-430.886] (-436.927) (-432.979) * (-432.262) (-432.519) (-431.326) [-431.289] -- 0:00:47
188000 -- (-432.381) [-431.543] (-430.989) (-431.124) * (-432.469) (-433.131) [-430.832] (-430.540) -- 0:00:47
188500 -- (-430.210) (-437.548) (-430.291) [-432.184] * (-431.515) (-433.513) [-432.017] (-432.465) -- 0:00:47
189000 -- (-432.425) (-431.483) [-430.462] (-430.648) * (-432.110) [-430.635] (-431.424) (-432.970) -- 0:00:47
189500 -- (-430.914) [-430.333] (-432.565) (-430.890) * (-431.570) (-431.619) (-431.728) [-431.888] -- 0:00:47
190000 -- (-433.372) (-432.442) [-431.545] (-436.649) * (-432.724) (-430.657) (-430.802) [-432.632] -- 0:00:46
Average standard deviation of split frequencies: 0.015998
190500 -- (-435.480) (-434.466) (-431.269) [-431.553] * [-432.089] (-431.220) (-432.024) (-431.009) -- 0:00:46
191000 -- (-431.893) (-430.371) [-431.307] (-433.441) * (-433.057) (-434.433) (-431.924) [-433.421] -- 0:00:46
191500 -- (-433.539) (-432.925) [-431.241] (-431.619) * (-430.705) (-430.527) [-430.986] (-433.703) -- 0:00:46
192000 -- (-437.195) [-431.495] (-433.865) (-432.336) * (-430.414) (-430.851) (-433.558) [-430.667] -- 0:00:46
192500 -- (-430.876) (-434.536) [-433.118] (-432.206) * [-432.474] (-431.922) (-432.367) (-433.159) -- 0:00:46
193000 -- (-431.116) (-434.421) [-431.895] (-431.582) * (-435.951) (-436.262) [-432.929] (-430.847) -- 0:00:45
193500 -- (-432.974) (-430.978) (-437.669) [-432.874] * [-430.405] (-431.628) (-437.638) (-430.950) -- 0:00:45
194000 -- (-430.069) (-432.096) [-432.538] (-431.924) * (-432.859) (-433.976) [-432.001] (-432.301) -- 0:00:45
194500 -- (-433.609) [-432.068] (-430.226) (-431.459) * (-433.297) (-433.290) (-432.710) [-431.122] -- 0:00:45
195000 -- (-432.771) (-437.822) (-431.018) [-430.183] * (-430.992) (-432.432) (-433.402) [-431.529] -- 0:00:45
Average standard deviation of split frequencies: 0.016270
195500 -- (-432.230) (-434.869) (-430.465) [-430.761] * (-431.844) [-430.808] (-435.893) (-432.195) -- 0:00:45
196000 -- (-431.092) (-434.284) [-431.895] (-431.529) * (-430.500) (-431.982) [-432.582] (-432.479) -- 0:00:45
196500 -- (-433.851) (-431.984) [-433.105] (-432.108) * [-432.241] (-431.010) (-433.973) (-431.090) -- 0:00:44
197000 -- (-432.820) [-432.520] (-433.624) (-432.146) * (-432.175) [-432.539] (-433.872) (-433.000) -- 0:00:44
197500 -- [-432.508] (-431.809) (-433.289) (-432.921) * (-431.899) (-433.269) [-435.490] (-430.791) -- 0:00:44
198000 -- [-430.841] (-430.296) (-431.084) (-434.701) * (-434.900) [-431.008] (-433.667) (-432.018) -- 0:00:44
198500 -- (-431.941) (-434.588) (-432.204) [-431.062] * (-432.384) [-431.501] (-431.813) (-439.613) -- 0:00:44
199000 -- (-431.598) [-431.274] (-433.575) (-429.927) * (-431.076) (-433.723) (-431.533) [-430.361] -- 0:00:44
199500 -- (-430.089) [-431.867] (-434.744) (-430.430) * (-431.840) [-430.194] (-432.731) (-431.591) -- 0:00:44
200000 -- (-431.982) (-430.698) (-431.517) [-430.576] * (-433.376) [-431.826] (-433.007) (-434.188) -- 0:00:44
Average standard deviation of split frequencies: 0.013681
200500 -- (-435.775) [-431.952] (-432.442) (-431.496) * (-431.008) (-432.827) [-431.770] (-433.024) -- 0:00:47
201000 -- [-433.834] (-435.053) (-430.752) (-430.155) * (-430.810) (-434.026) [-431.053] (-431.205) -- 0:00:47
201500 -- [-431.631] (-437.499) (-433.788) (-431.974) * (-430.262) (-434.452) (-432.991) [-431.159] -- 0:00:47
202000 -- [-432.288] (-432.048) (-431.089) (-432.367) * (-432.387) (-431.824) (-430.147) [-430.917] -- 0:00:47
202500 -- (-432.791) (-433.191) [-430.108] (-439.293) * (-434.120) [-431.068] (-431.216) (-431.173) -- 0:00:47
203000 -- (-432.637) [-433.682] (-430.133) (-431.116) * (-432.507) (-431.046) [-430.632] (-430.663) -- 0:00:47
203500 -- (-432.574) (-433.016) [-431.777] (-431.736) * (-435.001) (-432.510) (-432.178) [-438.462] -- 0:00:46
204000 -- (-432.136) (-431.423) (-430.658) [-430.876] * [-430.853] (-430.116) (-431.326) (-433.784) -- 0:00:46
204500 -- (-433.987) (-434.212) (-432.884) [-431.149] * (-430.851) (-432.694) [-432.434] (-435.001) -- 0:00:46
205000 -- (-432.290) (-431.898) (-431.492) [-431.386] * (-434.186) [-431.727] (-430.549) (-436.132) -- 0:00:46
Average standard deviation of split frequencies: 0.011696
205500 -- (-431.670) (-432.178) (-434.459) [-433.063] * [-431.104] (-433.833) (-430.717) (-431.852) -- 0:00:46
206000 -- (-432.337) (-430.419) [-434.049] (-431.725) * (-430.765) (-433.701) [-436.010] (-432.695) -- 0:00:46
206500 -- [-432.381] (-431.866) (-431.176) (-432.433) * (-430.175) (-431.008) (-437.812) [-432.088] -- 0:00:46
207000 -- [-432.824] (-432.577) (-434.887) (-435.352) * (-434.296) [-430.201] (-432.360) (-431.782) -- 0:00:45
207500 -- (-433.004) [-432.587] (-435.725) (-434.962) * [-434.286] (-430.985) (-430.944) (-436.306) -- 0:00:45
208000 -- (-431.757) [-433.460] (-433.172) (-433.742) * (-430.853) (-435.784) [-431.809] (-433.621) -- 0:00:45
208500 -- (-434.437) (-433.209) [-432.535] (-433.163) * (-436.174) (-433.828) [-430.808] (-432.366) -- 0:00:45
209000 -- (-433.447) (-432.409) [-433.471] (-434.013) * (-432.537) [-432.822] (-432.968) (-431.608) -- 0:00:45
209500 -- (-430.525) (-433.166) (-433.370) [-435.186] * (-436.234) (-434.669) [-431.847] (-433.655) -- 0:00:45
210000 -- (-431.588) (-433.226) [-433.028] (-433.249) * (-431.607) [-431.508] (-430.744) (-433.643) -- 0:00:45
Average standard deviation of split frequencies: 0.010794
210500 -- [-431.013] (-436.035) (-436.077) (-436.191) * (-432.875) [-433.018] (-433.098) (-434.069) -- 0:00:45
211000 -- (-431.180) [-431.998] (-435.566) (-432.394) * (-431.271) (-434.009) [-433.850] (-435.236) -- 0:00:44
211500 -- (-433.454) [-431.210] (-432.447) (-433.536) * (-430.860) (-434.362) (-432.152) [-432.746] -- 0:00:44
212000 -- (-431.374) (-430.905) (-437.751) [-431.306] * (-431.350) [-431.236] (-432.754) (-430.457) -- 0:00:44
212500 -- (-435.395) (-432.669) (-431.443) [-430.786] * (-434.191) [-431.823] (-432.696) (-431.714) -- 0:00:44
213000 -- [-432.843] (-433.704) (-430.631) (-434.278) * (-435.952) (-430.314) [-432.423] (-435.506) -- 0:00:44
213500 -- (-430.009) (-429.997) [-431.333] (-430.561) * (-436.477) [-430.525] (-430.703) (-431.530) -- 0:00:44
214000 -- [-432.350] (-431.902) (-430.848) (-433.566) * (-432.355) (-433.710) (-431.551) [-432.607] -- 0:00:44
214500 -- (-430.238) [-431.016] (-431.093) (-437.737) * [-434.754] (-433.911) (-432.400) (-431.162) -- 0:00:43
215000 -- (-431.003) (-431.585) (-430.836) [-433.396] * (-430.376) (-430.540) (-432.462) [-432.787] -- 0:00:43
Average standard deviation of split frequencies: 0.011297
215500 -- (-430.386) [-433.035] (-430.470) (-432.465) * (-430.767) [-431.268] (-435.770) (-430.353) -- 0:00:43
216000 -- [-433.308] (-432.011) (-433.094) (-435.706) * [-430.200] (-431.499) (-436.484) (-430.356) -- 0:00:43
216500 -- (-432.461) [-431.528] (-435.407) (-436.943) * [-433.161] (-431.687) (-433.557) (-430.451) -- 0:00:43
217000 -- (-431.893) [-431.582] (-431.661) (-433.800) * [-432.410] (-432.146) (-430.288) (-431.093) -- 0:00:43
217500 -- [-433.190] (-435.162) (-432.809) (-432.909) * (-433.115) [-430.447] (-430.439) (-431.184) -- 0:00:43
218000 -- (-432.974) [-431.540] (-432.466) (-431.401) * [-433.101] (-430.689) (-434.163) (-437.008) -- 0:00:46
218500 -- (-434.940) (-431.303) [-434.361] (-434.860) * (-430.888) (-431.233) [-430.966] (-432.705) -- 0:00:46
219000 -- (-432.839) [-437.421] (-436.780) (-438.040) * (-431.927) (-431.890) [-434.786] (-430.397) -- 0:00:46
219500 -- (-435.627) (-431.557) (-431.680) [-432.995] * [-433.529] (-432.405) (-437.552) (-430.910) -- 0:00:46
220000 -- (-435.399) [-431.443] (-431.989) (-436.120) * (-433.856) [-432.042] (-431.265) (-431.647) -- 0:00:46
Average standard deviation of split frequencies: 0.010053
220500 -- (-433.283) (-432.798) (-430.007) [-432.751] * (-432.070) [-432.283] (-431.057) (-432.498) -- 0:00:45
221000 -- (-432.828) [-431.771] (-430.241) (-431.750) * [-431.503] (-430.515) (-433.180) (-430.998) -- 0:00:45
221500 -- (-432.130) (-433.768) [-433.465] (-432.759) * (-430.608) (-432.084) [-432.013] (-433.453) -- 0:00:45
222000 -- (-431.327) (-433.798) [-433.765] (-430.821) * (-433.878) (-436.409) (-430.636) [-431.923] -- 0:00:45
222500 -- [-432.382] (-434.711) (-430.977) (-430.379) * [-431.565] (-434.919) (-433.205) (-431.829) -- 0:00:45
223000 -- (-433.278) (-433.263) (-435.912) [-433.702] * (-432.301) (-433.008) [-435.375] (-432.734) -- 0:00:45
223500 -- (-430.514) (-431.485) (-433.124) [-430.548] * [-430.516] (-433.449) (-435.712) (-431.216) -- 0:00:45
224000 -- (-430.156) [-431.391] (-430.802) (-433.634) * (-430.267) (-436.310) [-436.525] (-430.967) -- 0:00:45
224500 -- (-433.080) (-432.356) (-437.706) [-433.229] * (-430.441) (-430.859) [-431.860] (-433.387) -- 0:00:44
225000 -- [-434.109] (-431.642) (-432.456) (-435.740) * (-430.005) [-431.308] (-436.436) (-432.425) -- 0:00:44
Average standard deviation of split frequencies: 0.011704
225500 -- [-434.110] (-433.749) (-433.233) (-435.967) * (-433.509) [-432.438] (-432.980) (-433.413) -- 0:00:44
226000 -- (-432.937) (-432.155) (-435.635) [-431.815] * (-432.706) (-430.627) (-430.889) [-431.860] -- 0:00:44
226500 -- (-430.566) (-430.958) (-430.897) [-433.073] * (-432.531) (-430.767) (-434.039) [-431.570] -- 0:00:44
227000 -- (-432.170) [-431.808] (-433.282) (-431.198) * (-436.285) (-431.419) (-432.003) [-430.721] -- 0:00:44
227500 -- (-432.992) (-436.293) (-431.024) [-431.373] * (-435.053) (-432.889) (-430.458) [-432.167] -- 0:00:44
228000 -- (-431.665) (-432.277) [-432.492] (-431.595) * (-432.100) (-430.030) [-434.347] (-430.353) -- 0:00:44
228500 -- (-432.126) (-432.842) [-430.822] (-433.235) * [-434.496] (-430.779) (-431.201) (-433.297) -- 0:00:43
229000 -- [-431.430] (-434.217) (-430.566) (-431.438) * (-432.307) (-431.395) (-432.482) [-430.259] -- 0:00:43
229500 -- [-430.776] (-434.596) (-439.898) (-431.756) * (-433.221) [-432.412] (-431.603) (-430.759) -- 0:00:43
230000 -- (-433.864) (-436.883) (-431.711) [-434.969] * (-434.782) (-431.993) [-436.641] (-433.237) -- 0:00:43
Average standard deviation of split frequencies: 0.011127
230500 -- [-431.780] (-431.790) (-435.902) (-432.232) * (-431.927) (-433.559) (-433.573) [-433.133] -- 0:00:43
231000 -- (-431.361) [-433.867] (-432.522) (-432.982) * (-432.859) [-431.528] (-431.450) (-431.906) -- 0:00:43
231500 -- (-433.375) (-432.621) (-431.042) [-432.923] * [-432.234] (-431.769) (-430.907) (-438.160) -- 0:00:43
232000 -- (-433.080) (-431.941) (-432.562) [-433.509] * (-436.648) (-431.426) (-430.251) [-432.745] -- 0:00:43
232500 -- (-433.782) [-432.007] (-431.027) (-431.468) * (-433.182) (-431.778) [-429.813] (-432.247) -- 0:00:42
233000 -- (-436.953) [-430.846] (-433.584) (-433.559) * [-430.372] (-432.934) (-432.205) (-432.058) -- 0:00:42
233500 -- (-431.144) (-430.490) (-430.801) [-430.887] * (-431.909) (-431.360) [-432.518] (-430.871) -- 0:00:42
234000 -- (-431.640) (-430.500) [-431.235] (-435.736) * [-430.455] (-435.520) (-431.265) (-433.660) -- 0:00:42
234500 -- [-431.794] (-433.454) (-435.956) (-430.586) * (-434.583) (-432.951) [-433.534] (-433.972) -- 0:00:42
235000 -- (-433.075) (-437.212) (-435.494) [-430.726] * (-437.129) (-434.999) [-430.280] (-430.269) -- 0:00:45
Average standard deviation of split frequencies: 0.011652
235500 -- (-433.559) (-431.240) [-430.888] (-434.526) * (-440.119) [-434.358] (-431.499) (-432.711) -- 0:00:45
236000 -- [-433.930] (-431.954) (-431.339) (-431.817) * (-431.986) (-432.021) (-431.480) [-432.882] -- 0:00:45
236500 -- (-432.503) (-430.759) (-438.317) [-431.170] * (-434.503) [-431.616] (-431.635) (-432.857) -- 0:00:45
237000 -- (-430.847) (-431.026) (-434.540) [-431.407] * (-433.917) (-433.503) (-433.699) [-433.226] -- 0:00:45
237500 -- (-431.211) (-431.677) (-433.417) [-431.414] * (-431.898) (-432.833) (-432.098) [-433.160] -- 0:00:44
238000 -- (-434.988) (-432.240) [-433.368] (-433.655) * [-432.800] (-432.693) (-432.287) (-432.083) -- 0:00:44
238500 -- (-431.766) (-431.724) (-436.798) [-431.257] * [-431.048] (-434.666) (-436.191) (-430.664) -- 0:00:44
239000 -- (-430.425) (-435.856) [-436.138] (-432.411) * (-434.110) (-431.056) (-437.038) [-430.590] -- 0:00:44
239500 -- (-432.803) [-431.919] (-433.464) (-430.340) * (-434.703) (-431.057) (-436.372) [-430.730] -- 0:00:44
240000 -- (-437.723) (-433.010) [-431.839] (-431.090) * (-431.400) (-432.636) (-430.689) [-430.861] -- 0:00:44
Average standard deviation of split frequencies: 0.011292
240500 -- (-431.964) [-430.726] (-432.493) (-434.150) * [-431.572] (-433.933) (-431.356) (-433.286) -- 0:00:44
241000 -- (-431.469) (-435.391) [-434.087] (-432.959) * (-433.079) (-432.149) (-431.019) [-431.532] -- 0:00:44
241500 -- (-432.588) (-434.919) (-432.462) [-433.371] * (-433.053) (-432.350) [-436.278] (-431.995) -- 0:00:43
242000 -- (-432.695) (-437.819) (-431.635) [-432.552] * [-434.296] (-432.948) (-433.327) (-430.737) -- 0:00:43
242500 -- (-433.367) (-432.617) (-433.870) [-431.371] * (-431.497) (-433.040) (-432.699) [-430.543] -- 0:00:43
243000 -- (-431.103) [-430.733] (-434.058) (-431.656) * [-433.541] (-433.539) (-434.346) (-433.599) -- 0:00:43
243500 -- (-432.743) (-433.222) (-430.353) [-434.414] * (-433.751) (-434.331) [-430.251] (-431.845) -- 0:00:43
244000 -- (-436.165) (-431.406) [-431.590] (-431.060) * (-433.405) [-431.874] (-437.620) (-434.106) -- 0:00:43
244500 -- (-430.978) [-430.445] (-431.542) (-431.124) * (-430.075) (-435.945) [-434.289] (-430.534) -- 0:00:43
245000 -- (-435.398) [-435.343] (-432.249) (-432.495) * (-430.944) (-434.416) [-431.416] (-430.908) -- 0:00:43
Average standard deviation of split frequencies: 0.010859
245500 -- (-431.108) [-434.727] (-430.900) (-431.164) * (-431.869) (-431.326) (-431.104) [-432.179] -- 0:00:43
246000 -- (-431.947) (-432.002) (-431.015) [-433.074] * (-434.612) (-429.959) [-434.207] (-431.772) -- 0:00:42
246500 -- (-429.951) [-432.753] (-432.109) (-434.949) * (-434.949) (-431.692) [-433.672] (-430.299) -- 0:00:42
247000 -- [-432.443] (-431.638) (-433.101) (-432.954) * (-431.268) [-432.756] (-435.761) (-431.380) -- 0:00:42
247500 -- (-433.824) (-432.838) (-432.820) [-431.526] * (-431.549) (-431.812) [-433.882] (-431.856) -- 0:00:42
248000 -- (-432.029) (-436.094) (-430.511) [-430.401] * (-431.101) [-430.723] (-431.090) (-433.361) -- 0:00:42
248500 -- [-434.043] (-432.403) (-433.482) (-431.579) * (-432.863) (-430.915) [-433.155] (-430.903) -- 0:00:42
249000 -- (-433.208) (-433.641) (-435.885) [-430.547] * (-432.430) (-430.869) (-432.279) [-432.200] -- 0:00:42
249500 -- (-432.177) [-431.629] (-430.985) (-432.249) * (-435.785) [-430.197] (-434.410) (-435.018) -- 0:00:42
250000 -- [-431.357] (-431.394) (-430.518) (-434.252) * (-436.003) [-434.495] (-434.970) (-431.880) -- 0:00:42
Average standard deviation of split frequencies: 0.011173
250500 -- (-430.264) (-431.355) [-431.709] (-432.130) * (-437.519) [-430.622] (-431.832) (-432.545) -- 0:00:41
251000 -- (-432.665) (-430.198) [-433.456] (-432.218) * (-432.344) (-432.965) (-431.209) [-430.647] -- 0:00:41
251500 -- [-432.411] (-433.002) (-432.197) (-435.183) * [-432.478] (-432.863) (-432.868) (-431.084) -- 0:00:41
252000 -- (-431.564) [-433.456] (-431.065) (-434.626) * (-434.950) (-430.764) [-431.023] (-434.431) -- 0:00:44
252500 -- (-431.511) [-430.945] (-436.795) (-434.110) * (-431.072) [-431.212] (-430.759) (-436.872) -- 0:00:44
253000 -- (-434.927) (-436.687) [-431.011] (-430.353) * (-431.699) (-432.194) (-430.553) [-432.168] -- 0:00:44
253500 -- (-431.968) (-431.999) (-431.550) [-432.238] * (-431.645) (-432.655) [-434.525] (-434.679) -- 0:00:44
254000 -- (-432.065) [-433.339] (-430.261) (-434.376) * (-434.346) [-433.865] (-431.003) (-432.992) -- 0:00:44
254500 -- (-436.489) [-433.297] (-430.823) (-435.493) * (-433.705) (-433.887) [-429.987] (-433.702) -- 0:00:43
255000 -- (-436.514) (-431.484) (-433.783) [-435.071] * [-434.136] (-430.779) (-435.429) (-431.350) -- 0:00:43
Average standard deviation of split frequencies: 0.010615
255500 -- (-436.782) (-435.187) (-435.371) [-435.309] * (-432.916) (-432.195) (-431.566) [-432.819] -- 0:00:43
256000 -- [-434.283] (-433.666) (-431.102) (-437.009) * [-430.946] (-436.690) (-432.443) (-431.324) -- 0:00:43
256500 -- [-432.376] (-432.759) (-430.767) (-433.324) * [-431.904] (-433.144) (-432.088) (-430.868) -- 0:00:43
257000 -- (-431.177) (-430.881) [-431.123] (-430.237) * (-430.815) (-430.979) (-432.375) [-430.844] -- 0:00:43
257500 -- (-432.821) [-431.316] (-431.057) (-434.501) * (-434.065) [-430.860] (-431.154) (-434.375) -- 0:00:43
258000 -- (-431.171) [-431.492] (-430.433) (-429.969) * (-431.217) (-431.648) (-432.518) [-431.475] -- 0:00:43
258500 -- (-432.572) (-432.697) [-430.510] (-434.647) * (-430.870) [-431.690] (-434.389) (-431.516) -- 0:00:43
259000 -- [-430.576] (-432.538) (-434.405) (-431.779) * (-432.963) (-431.924) (-431.265) [-430.779] -- 0:00:42
259500 -- (-433.776) (-433.484) [-435.858] (-430.592) * (-433.522) [-435.725] (-432.319) (-432.968) -- 0:00:42
260000 -- (-432.208) [-431.845] (-441.452) (-431.140) * (-433.021) [-434.181] (-431.202) (-433.312) -- 0:00:42
Average standard deviation of split frequencies: 0.011595
260500 -- [-431.130] (-433.127) (-444.088) (-433.405) * (-431.476) (-434.586) (-432.608) [-430.320] -- 0:00:42
261000 -- (-430.682) [-430.757] (-434.948) (-432.023) * (-431.750) [-431.070] (-434.484) (-430.533) -- 0:00:42
261500 -- (-432.098) (-434.209) [-431.798] (-432.039) * (-433.762) (-432.115) (-434.465) [-430.512] -- 0:00:42
262000 -- (-432.365) (-431.497) (-431.969) [-432.075] * (-433.220) [-431.487] (-431.279) (-437.787) -- 0:00:42
262500 -- (-431.186) (-434.299) [-431.249] (-431.521) * (-430.895) (-431.238) [-434.857] (-434.976) -- 0:00:42
263000 -- (-430.334) (-431.526) (-432.116) [-430.081] * (-431.265) [-432.042] (-435.935) (-437.297) -- 0:00:42
263500 -- (-431.499) [-433.214] (-435.121) (-431.778) * (-436.279) [-433.216] (-431.693) (-438.418) -- 0:00:41
264000 -- (-431.543) (-431.646) (-433.184) [-431.906] * (-431.040) (-434.831) (-432.856) [-435.059] -- 0:00:41
264500 -- [-431.627] (-431.404) (-435.959) (-431.830) * (-431.245) (-432.573) [-431.745] (-434.783) -- 0:00:41
265000 -- (-430.696) (-435.318) [-430.784] (-431.909) * (-436.375) [-432.166] (-434.054) (-433.471) -- 0:00:41
Average standard deviation of split frequencies: 0.010737
265500 -- (-431.190) (-432.011) (-432.757) [-433.055] * (-430.506) (-432.877) (-431.848) [-431.207] -- 0:00:41
266000 -- (-434.450) (-430.970) (-431.972) [-429.989] * (-430.029) (-431.186) (-431.011) [-431.802] -- 0:00:41
266500 -- (-436.771) (-432.114) [-437.711] (-430.058) * (-434.179) (-433.919) (-433.044) [-432.527] -- 0:00:41
267000 -- (-436.308) (-434.121) (-441.274) [-430.363] * (-431.721) (-432.132) (-433.596) [-436.225] -- 0:00:41
267500 -- [-432.260] (-435.213) (-431.748) (-432.945) * (-431.831) (-432.911) [-431.302] (-431.161) -- 0:00:41
268000 -- (-430.649) [-432.875] (-432.990) (-432.158) * (-432.311) (-433.721) [-431.893] (-430.290) -- 0:00:40
268500 -- (-431.944) [-434.931] (-431.518) (-436.867) * (-431.338) (-430.989) (-431.024) [-431.669] -- 0:00:40
269000 -- (-431.721) (-431.470) (-430.169) [-431.988] * (-431.858) [-431.270] (-431.853) (-430.474) -- 0:00:40
269500 -- (-435.500) (-432.850) (-431.626) [-430.724] * (-433.280) (-430.584) [-432.967] (-432.222) -- 0:00:43
270000 -- [-430.132] (-431.847) (-431.294) (-430.865) * (-430.620) (-430.722) (-431.114) [-431.191] -- 0:00:43
Average standard deviation of split frequencies: 0.011269
270500 -- (-433.278) (-431.492) [-432.653] (-430.619) * (-432.497) (-432.087) [-431.499] (-431.895) -- 0:00:43
271000 -- (-430.964) (-432.102) (-433.831) [-430.760] * (-431.872) [-432.558] (-429.993) (-434.379) -- 0:00:43
271500 -- (-432.311) [-430.918] (-432.995) (-431.058) * [-431.710] (-433.782) (-431.690) (-433.239) -- 0:00:42
272000 -- (-432.691) [-434.709] (-432.246) (-431.869) * [-431.318] (-431.706) (-432.176) (-431.354) -- 0:00:42
272500 -- (-432.503) (-434.232) (-435.844) [-430.534] * (-432.028) (-430.936) [-430.282] (-433.910) -- 0:00:42
273000 -- (-431.493) (-430.751) [-431.087] (-433.090) * (-430.908) (-432.834) [-430.005] (-433.123) -- 0:00:42
273500 -- (-430.577) (-435.159) (-430.298) [-430.989] * (-431.553) (-432.081) (-431.088) [-432.312] -- 0:00:42
274000 -- (-435.181) [-430.660] (-430.802) (-431.415) * (-434.173) (-438.163) (-433.057) [-436.999] -- 0:00:42
274500 -- (-432.267) (-430.574) (-430.675) [-431.630] * (-432.217) (-433.586) (-436.236) [-431.089] -- 0:00:42
275000 -- (-433.470) (-430.100) [-432.997] (-435.249) * [-431.002] (-432.165) (-433.495) (-432.215) -- 0:00:42
Average standard deviation of split frequencies: 0.010750
275500 -- (-436.330) (-431.704) [-433.380] (-434.365) * (-433.007) [-431.500] (-432.786) (-432.525) -- 0:00:42
276000 -- (-434.344) (-431.017) [-432.213] (-434.203) * (-431.623) (-430.200) (-434.434) [-433.052] -- 0:00:41
276500 -- (-432.680) (-431.407) [-431.267] (-431.680) * (-432.566) (-431.522) [-430.639] (-431.471) -- 0:00:41
277000 -- (-432.247) [-434.925] (-434.603) (-431.467) * (-435.600) (-433.517) (-430.957) [-433.292] -- 0:00:41
277500 -- [-432.604] (-431.921) (-435.106) (-430.439) * (-436.199) (-435.004) [-432.044] (-432.532) -- 0:00:41
278000 -- (-433.354) (-429.998) [-431.233] (-431.839) * (-430.414) [-430.716] (-430.942) (-432.217) -- 0:00:41
278500 -- (-435.075) (-430.802) [-434.161] (-430.543) * (-432.604) [-430.882] (-431.209) (-433.832) -- 0:00:41
279000 -- (-432.312) [-433.846] (-432.710) (-431.286) * (-432.192) (-432.634) [-431.638] (-432.049) -- 0:00:41
279500 -- (-430.346) [-433.838] (-433.657) (-432.885) * [-430.574] (-431.769) (-431.360) (-431.516) -- 0:00:41
280000 -- [-430.492] (-432.953) (-430.628) (-431.019) * (-430.497) (-432.096) [-431.192] (-432.202) -- 0:00:41
Average standard deviation of split frequencies: 0.011757
280500 -- (-432.327) (-435.336) [-431.840] (-430.996) * (-433.657) [-431.756] (-433.360) (-430.576) -- 0:00:41
281000 -- [-432.142] (-433.227) (-431.793) (-435.013) * [-432.853] (-430.308) (-434.995) (-430.576) -- 0:00:40
281500 -- (-435.683) (-432.290) [-432.361] (-430.184) * [-433.217] (-432.496) (-433.711) (-433.294) -- 0:00:40
282000 -- (-432.195) (-433.255) [-431.432] (-433.204) * [-432.248] (-432.017) (-431.400) (-432.699) -- 0:00:40
282500 -- (-436.257) [-430.668] (-431.781) (-430.661) * [-432.200] (-433.081) (-431.305) (-431.057) -- 0:00:40
283000 -- (-440.017) (-430.389) [-432.411] (-431.058) * (-433.052) (-431.329) [-432.389] (-434.280) -- 0:00:40
283500 -- (-434.447) (-432.981) (-432.685) [-431.757] * (-431.878) (-432.380) (-431.178) [-434.064] -- 0:00:40
284000 -- (-436.432) (-430.590) [-431.052] (-431.134) * [-433.855] (-434.372) (-431.090) (-431.894) -- 0:00:40
284500 -- (-433.963) (-432.036) (-434.255) [-431.699] * (-432.201) (-430.240) [-431.613] (-431.048) -- 0:00:40
285000 -- (-432.051) (-431.403) (-430.970) [-432.952] * (-431.453) (-433.084) [-434.937] (-434.694) -- 0:00:40
Average standard deviation of split frequencies: 0.012217
285500 -- (-431.677) (-433.637) (-433.996) [-436.368] * (-430.542) [-431.362] (-432.425) (-431.536) -- 0:00:40
286000 -- (-431.345) (-430.657) [-430.852] (-433.444) * (-431.259) [-432.239] (-431.537) (-432.961) -- 0:00:39
286500 -- [-433.590] (-431.136) (-436.222) (-434.734) * (-436.386) (-430.860) [-436.640] (-433.385) -- 0:00:42
287000 -- (-430.360) [-430.340] (-435.204) (-433.734) * (-433.887) (-430.216) [-441.831] (-437.309) -- 0:00:42
287500 -- (-431.938) [-433.192] (-433.672) (-432.094) * (-433.111) [-430.851] (-432.269) (-433.872) -- 0:00:42
288000 -- (-431.201) [-433.976] (-432.524) (-436.998) * (-432.202) [-432.341] (-431.937) (-435.162) -- 0:00:42
288500 -- [-435.206] (-430.955) (-432.354) (-433.312) * (-431.001) (-430.938) (-436.209) [-429.876] -- 0:00:41
289000 -- (-431.866) (-431.277) [-433.750] (-433.503) * (-435.435) [-432.168] (-438.296) (-432.110) -- 0:00:41
289500 -- [-434.524] (-430.384) (-435.772) (-431.886) * [-431.255] (-430.570) (-434.582) (-434.127) -- 0:00:41
290000 -- (-432.361) (-432.931) (-433.506) [-433.088] * (-433.755) (-433.654) [-434.186] (-431.595) -- 0:00:41
Average standard deviation of split frequencies: 0.011257
290500 -- (-430.998) (-432.148) [-430.343] (-430.964) * [-431.370] (-440.059) (-430.810) (-432.142) -- 0:00:41
291000 -- (-431.832) [-435.838] (-430.625) (-431.365) * (-433.863) (-434.480) [-432.638] (-433.367) -- 0:00:41
291500 -- (-435.275) (-434.505) (-431.011) [-430.333] * (-430.934) (-430.343) (-432.357) [-432.618] -- 0:00:41
292000 -- (-433.380) [-431.901] (-431.505) (-431.037) * (-431.208) (-435.065) [-432.631] (-432.354) -- 0:00:41
292500 -- [-432.873] (-434.511) (-431.738) (-430.736) * (-433.605) (-432.900) (-430.870) [-432.055] -- 0:00:41
293000 -- (-430.250) (-433.486) [-431.675] (-430.570) * (-431.926) (-432.480) [-432.439] (-432.771) -- 0:00:41
293500 -- (-432.885) [-434.461] (-431.868) (-432.973) * [-431.494] (-434.290) (-431.014) (-433.277) -- 0:00:40
294000 -- (-431.299) (-433.727) (-432.229) [-431.530] * (-431.020) (-431.971) [-434.572] (-433.991) -- 0:00:40
294500 -- (-433.926) (-433.849) [-431.461] (-430.607) * [-432.593] (-434.257) (-432.483) (-433.731) -- 0:00:40
295000 -- (-431.515) (-432.297) (-433.254) [-431.174] * (-433.897) (-437.017) [-430.937] (-432.347) -- 0:00:40
Average standard deviation of split frequencies: 0.010399
295500 -- (-431.621) [-431.062] (-433.653) (-430.524) * [-432.484] (-431.929) (-431.817) (-431.117) -- 0:00:40
296000 -- [-430.420] (-431.235) (-432.748) (-431.140) * [-432.476] (-430.371) (-432.180) (-431.676) -- 0:00:40
296500 -- (-432.254) [-435.227] (-437.947) (-432.247) * (-436.645) (-433.662) (-434.078) [-433.847] -- 0:00:40
297000 -- (-434.146) [-433.568] (-434.434) (-432.421) * [-433.950] (-438.587) (-433.551) (-430.236) -- 0:00:40
297500 -- (-440.024) (-432.918) (-431.173) [-435.573] * [-431.577] (-435.231) (-430.724) (-432.646) -- 0:00:40
298000 -- (-435.480) [-431.068] (-431.878) (-431.550) * (-432.017) (-438.216) [-431.002] (-436.101) -- 0:00:40
298500 -- (-433.044) [-432.259] (-434.433) (-433.665) * (-430.886) [-434.227] (-435.363) (-432.522) -- 0:00:39
299000 -- (-430.964) [-433.939] (-431.002) (-431.887) * [-431.477] (-432.294) (-433.784) (-431.292) -- 0:00:39
299500 -- (-435.774) (-434.178) (-435.897) [-430.909] * (-429.941) (-432.869) (-432.831) [-431.780] -- 0:00:39
300000 -- (-430.649) [-432.818] (-430.156) (-430.783) * [-435.536] (-430.788) (-436.611) (-432.119) -- 0:00:39
Average standard deviation of split frequencies: 0.011465
300500 -- (-432.658) (-432.178) [-430.385] (-432.740) * (-430.028) (-434.164) [-435.483] (-431.518) -- 0:00:39
301000 -- [-430.886] (-433.230) (-430.083) (-431.718) * [-432.078] (-433.770) (-430.076) (-431.462) -- 0:00:39
301500 -- (-434.537) (-432.261) (-431.679) [-430.867] * (-431.508) (-431.922) (-434.182) [-431.346] -- 0:00:39
302000 -- (-434.908) (-432.491) (-437.678) [-434.764] * [-430.636] (-435.344) (-431.556) (-431.962) -- 0:00:39
302500 -- (-435.284) (-431.717) (-439.650) [-430.440] * (-433.326) [-431.381] (-436.312) (-431.723) -- 0:00:39
303000 -- (-432.607) [-430.118] (-432.122) (-431.962) * (-436.086) [-431.052] (-434.483) (-432.980) -- 0:00:39
303500 -- (-431.288) (-431.633) (-432.120) [-430.548] * (-432.159) (-434.136) (-434.499) [-431.832] -- 0:00:39
304000 -- (-430.626) [-431.262] (-434.980) (-434.908) * (-431.935) (-433.359) [-430.889] (-431.068) -- 0:00:41
304500 -- (-431.211) (-432.624) (-432.023) [-433.843] * [-430.338] (-432.381) (-430.535) (-432.501) -- 0:00:41
305000 -- (-432.499) [-431.399] (-431.585) (-432.280) * (-432.092) (-430.986) [-433.982] (-436.081) -- 0:00:41
Average standard deviation of split frequencies: 0.010149
305500 -- (-431.877) [-431.283] (-430.916) (-433.432) * (-435.932) (-437.579) (-431.684) [-431.348] -- 0:00:40
306000 -- (-434.006) (-435.479) [-432.431] (-432.831) * (-439.344) (-431.349) (-432.138) [-433.968] -- 0:00:40
306500 -- [-431.508] (-432.331) (-434.907) (-431.055) * (-437.647) (-431.966) (-438.165) [-430.421] -- 0:00:40
307000 -- (-433.781) (-434.109) (-431.641) [-430.554] * [-431.400] (-432.743) (-431.878) (-432.105) -- 0:00:40
307500 -- (-431.707) [-431.527] (-432.440) (-432.957) * (-431.596) [-434.654] (-432.582) (-432.182) -- 0:00:40
308000 -- (-435.503) (-430.489) (-433.386) [-430.474] * [-432.833] (-431.029) (-434.291) (-433.763) -- 0:00:40
308500 -- (-431.949) (-433.245) (-431.579) [-430.868] * (-435.322) (-433.298) (-431.531) [-430.253] -- 0:00:40
309000 -- (-433.617) (-433.122) (-430.975) [-435.992] * (-432.744) (-431.476) [-430.531] (-432.452) -- 0:00:40
309500 -- [-433.548] (-431.128) (-431.639) (-434.160) * (-433.286) (-434.677) [-432.105] (-430.401) -- 0:00:40
310000 -- [-434.668] (-432.625) (-430.787) (-433.390) * (-432.931) (-432.598) (-431.727) [-431.395] -- 0:00:40
Average standard deviation of split frequencies: 0.010086
310500 -- (-431.202) (-430.827) (-431.233) [-430.806] * (-436.115) [-431.668] (-432.888) (-431.319) -- 0:00:39
311000 -- (-430.691) (-430.791) [-431.397] (-434.284) * (-430.332) [-437.199] (-434.211) (-432.181) -- 0:00:39
311500 -- (-432.333) [-432.839] (-431.606) (-430.704) * (-433.274) (-430.317) (-435.794) [-433.373] -- 0:00:39
312000 -- [-432.682] (-431.750) (-432.385) (-430.598) * (-432.091) (-433.040) (-431.134) [-436.584] -- 0:00:39
312500 -- (-430.911) (-434.183) (-431.225) [-431.985] * (-432.175) (-434.076) (-434.815) [-431.067] -- 0:00:39
313000 -- [-430.893] (-432.824) (-430.992) (-431.633) * (-430.849) [-431.511] (-432.346) (-432.679) -- 0:00:39
313500 -- [-431.164] (-430.949) (-431.346) (-429.911) * (-431.172) (-432.581) (-430.786) [-430.501] -- 0:00:39
314000 -- (-434.008) (-436.117) (-432.954) [-435.450] * (-431.172) [-431.755] (-431.711) (-431.057) -- 0:00:39
314500 -- [-432.462] (-431.469) (-431.716) (-432.802) * (-432.462) (-434.894) (-431.052) [-431.247] -- 0:00:39
315000 -- (-435.010) [-430.750] (-434.348) (-432.704) * (-431.451) (-430.783) [-430.357] (-431.068) -- 0:00:39
Average standard deviation of split frequencies: 0.010618
315500 -- [-433.369] (-430.553) (-432.416) (-431.118) * (-430.865) (-430.621) (-433.298) [-438.469] -- 0:00:39
316000 -- [-431.541] (-434.840) (-431.571) (-435.073) * (-435.199) [-433.392] (-430.394) (-432.452) -- 0:00:38
316500 -- (-436.024) [-431.671] (-432.907) (-437.162) * (-432.754) [-430.933] (-435.827) (-431.821) -- 0:00:38
317000 -- (-431.986) (-440.023) (-431.398) [-430.948] * (-430.486) [-432.603] (-432.014) (-429.919) -- 0:00:38
317500 -- (-432.341) (-430.574) (-431.062) [-431.344] * (-431.126) (-433.554) (-431.392) [-431.429] -- 0:00:38
318000 -- [-430.609] (-430.369) (-431.161) (-430.882) * (-431.585) (-433.015) [-430.690] (-430.749) -- 0:00:38
318500 -- (-434.184) [-432.454] (-433.565) (-431.242) * (-430.584) [-432.712] (-435.063) (-430.665) -- 0:00:38
319000 -- (-433.119) [-431.122] (-430.136) (-431.656) * (-432.778) (-433.749) (-436.335) [-432.268] -- 0:00:38
319500 -- (-435.500) (-431.474) [-430.926] (-433.581) * (-430.933) [-431.159] (-431.455) (-432.144) -- 0:00:38
320000 -- [-431.560] (-432.405) (-432.801) (-434.481) * (-430.204) (-432.956) [-431.838] (-431.798) -- 0:00:38
Average standard deviation of split frequencies: 0.011209
320500 -- (-434.325) (-429.910) (-433.854) [-432.522] * (-431.594) [-431.878] (-434.053) (-435.653) -- 0:00:38
321000 -- [-433.117] (-433.142) (-435.550) (-432.396) * [-430.978] (-433.306) (-431.364) (-432.601) -- 0:00:38
321500 -- (-430.259) [-433.425] (-431.340) (-434.400) * (-430.895) (-430.303) (-433.720) [-434.849] -- 0:00:40
322000 -- (-432.410) (-430.783) [-430.716] (-431.346) * [-432.456] (-434.373) (-436.495) (-433.227) -- 0:00:40
322500 -- (-431.370) (-433.462) [-430.985] (-431.489) * [-431.204] (-431.839) (-434.715) (-432.493) -- 0:00:39
323000 -- (-434.507) [-430.004] (-436.290) (-432.488) * [-430.695] (-433.595) (-431.887) (-430.525) -- 0:00:39
323500 -- [-430.444] (-433.747) (-431.327) (-432.232) * (-434.929) (-430.967) (-434.064) [-432.999] -- 0:00:39
324000 -- (-432.041) [-432.861] (-433.000) (-430.316) * (-431.910) (-433.310) [-433.150] (-430.836) -- 0:00:39
324500 -- [-434.037] (-430.735) (-430.952) (-439.028) * (-430.928) (-433.967) [-432.642] (-430.781) -- 0:00:39
325000 -- (-439.313) (-431.996) (-431.467) [-431.207] * (-433.295) (-430.648) [-431.683] (-433.298) -- 0:00:39
Average standard deviation of split frequencies: 0.011207
325500 -- (-435.955) (-432.642) (-430.443) [-431.557] * (-435.057) (-433.104) [-432.969] (-431.690) -- 0:00:39
326000 -- (-431.878) (-435.748) (-434.223) [-431.123] * (-438.008) (-431.462) [-431.682] (-435.466) -- 0:00:39
326500 -- (-431.605) (-437.753) [-431.238] (-430.395) * (-432.592) [-433.686] (-437.104) (-432.036) -- 0:00:39
327000 -- (-432.978) (-430.694) (-432.277) [-439.057] * (-434.004) (-429.885) (-431.566) [-433.245] -- 0:00:39
327500 -- [-431.412] (-430.666) (-433.625) (-431.338) * [-431.188] (-430.975) (-431.130) (-433.859) -- 0:00:39
328000 -- (-431.126) [-431.497] (-435.524) (-431.143) * (-431.645) (-431.023) (-430.877) [-433.210] -- 0:00:38
328500 -- (-431.022) (-430.929) (-434.125) [-437.179] * (-436.187) [-431.459] (-431.811) (-432.470) -- 0:00:38
329000 -- (-431.406) (-431.961) (-439.736) [-433.190] * (-431.422) [-430.378] (-432.626) (-431.849) -- 0:00:38
329500 -- [-432.388] (-431.179) (-432.824) (-430.631) * (-438.408) (-433.429) (-433.067) [-432.949] -- 0:00:38
330000 -- (-438.342) (-431.221) (-431.925) [-436.175] * (-432.520) [-433.665] (-433.878) (-430.762) -- 0:00:38
Average standard deviation of split frequencies: 0.010870
330500 -- [-430.820] (-431.177) (-431.109) (-434.863) * (-433.031) [-433.476] (-430.565) (-430.870) -- 0:00:38
331000 -- [-430.075] (-435.606) (-430.667) (-433.686) * (-433.956) (-434.817) (-434.129) [-431.286] -- 0:00:38
331500 -- [-432.253] (-434.284) (-430.900) (-433.069) * (-432.225) (-434.848) (-432.483) [-433.667] -- 0:00:38
332000 -- (-430.775) (-433.732) (-433.972) [-431.593] * (-432.717) [-433.016] (-431.170) (-433.573) -- 0:00:38
332500 -- (-431.956) [-429.942] (-434.170) (-432.724) * [-432.330] (-432.035) (-432.023) (-432.086) -- 0:00:38
333000 -- (-433.108) [-431.356] (-438.226) (-430.139) * (-434.660) (-435.360) [-432.546] (-429.999) -- 0:00:38
333500 -- (-430.877) (-431.944) [-431.901] (-430.681) * (-430.070) (-432.202) (-432.758) [-431.742] -- 0:00:37
334000 -- (-433.811) [-429.926] (-433.396) (-431.763) * [-432.869] (-438.353) (-432.751) (-431.516) -- 0:00:37
334500 -- [-432.106] (-430.371) (-433.411) (-431.982) * (-432.383) (-437.091) [-434.094] (-431.937) -- 0:00:37
335000 -- (-433.169) (-432.868) (-431.872) [-435.018] * (-431.281) (-433.159) (-434.282) [-430.049] -- 0:00:37
Average standard deviation of split frequencies: 0.010259
335500 -- (-431.085) [-432.800] (-431.818) (-433.605) * (-430.270) [-438.128] (-431.184) (-434.194) -- 0:00:37
336000 -- (-433.058) (-433.873) (-430.742) [-431.746] * [-432.648] (-433.581) (-435.665) (-432.410) -- 0:00:37
336500 -- (-432.658) [-433.451] (-430.274) (-431.461) * (-431.886) [-431.636] (-433.102) (-432.255) -- 0:00:37
337000 -- (-434.224) [-432.876] (-432.381) (-430.396) * (-431.964) [-434.599] (-434.023) (-431.922) -- 0:00:37
337500 -- (-430.671) (-432.633) (-434.348) [-431.712] * [-434.810] (-434.375) (-430.316) (-431.172) -- 0:00:37
338000 -- (-432.900) (-433.242) (-433.122) [-431.815] * (-433.898) (-434.297) (-430.467) [-433.685] -- 0:00:37
338500 -- (-431.583) [-431.044] (-434.369) (-436.307) * (-433.933) (-431.564) (-433.720) [-432.646] -- 0:00:39
339000 -- (-433.024) [-431.983] (-434.408) (-432.042) * (-437.983) (-431.767) (-430.714) [-433.246] -- 0:00:38
339500 -- (-430.845) [-432.780] (-433.514) (-432.313) * (-433.871) [-431.450] (-435.869) (-436.743) -- 0:00:38
340000 -- (-430.588) (-430.842) [-430.810] (-432.258) * (-435.470) [-431.672] (-430.945) (-431.551) -- 0:00:38
Average standard deviation of split frequencies: 0.009773
340500 -- (-430.399) (-433.755) (-432.383) [-432.004] * (-435.134) [-431.399] (-431.549) (-433.930) -- 0:00:38
341000 -- (-430.544) (-430.568) [-432.034] (-431.649) * (-435.364) [-430.668] (-430.920) (-433.256) -- 0:00:38
341500 -- (-431.874) [-430.513] (-432.655) (-430.597) * (-434.144) (-431.653) [-431.013] (-433.264) -- 0:00:38
342000 -- (-431.967) (-430.407) [-431.957] (-432.028) * (-434.781) [-432.076] (-432.723) (-441.082) -- 0:00:38
342500 -- (-430.301) (-431.444) [-435.180] (-436.716) * (-430.895) (-430.510) [-434.433] (-433.925) -- 0:00:38
343000 -- (-431.415) [-430.847] (-433.984) (-432.420) * (-432.721) [-431.586] (-431.618) (-434.267) -- 0:00:38
343500 -- (-430.867) (-436.547) [-431.465] (-434.346) * [-433.136] (-436.028) (-432.224) (-434.915) -- 0:00:38
344000 -- (-434.509) (-433.973) (-430.212) [-431.896] * (-433.367) (-438.565) [-431.968] (-436.427) -- 0:00:38
344500 -- (-436.030) [-431.474] (-432.812) (-431.557) * [-430.839] (-431.295) (-434.890) (-434.035) -- 0:00:38
345000 -- (-433.721) (-433.438) (-430.514) [-431.622] * (-431.433) (-433.377) (-431.912) [-432.310] -- 0:00:37
Average standard deviation of split frequencies: 0.010389
345500 -- [-434.037] (-430.979) (-432.350) (-430.674) * [-433.383] (-433.824) (-431.026) (-431.940) -- 0:00:37
346000 -- (-432.770) (-430.936) (-431.229) [-433.771] * [-430.920] (-431.770) (-432.242) (-432.076) -- 0:00:37
346500 -- [-435.115] (-431.334) (-432.282) (-432.880) * (-431.575) (-432.349) [-430.649] (-430.998) -- 0:00:37
347000 -- [-433.586] (-431.162) (-430.608) (-432.326) * [-431.984] (-431.449) (-435.461) (-430.942) -- 0:00:37
347500 -- (-433.116) (-432.191) [-432.255] (-434.817) * [-433.864] (-430.540) (-434.186) (-433.011) -- 0:00:37
348000 -- [-432.142] (-433.551) (-432.626) (-433.151) * [-431.861] (-431.562) (-430.217) (-433.958) -- 0:00:37
348500 -- (-433.707) (-433.739) [-432.747] (-434.775) * (-431.084) (-432.282) (-430.910) [-430.871] -- 0:00:37
349000 -- (-430.716) [-435.206] (-435.174) (-435.863) * (-430.969) [-434.031] (-430.925) (-430.965) -- 0:00:37
349500 -- (-430.511) [-432.006] (-432.193) (-432.511) * (-431.939) (-431.183) [-432.928] (-435.207) -- 0:00:37
350000 -- (-432.314) (-431.681) (-433.255) [-433.554] * [-432.845] (-433.891) (-432.388) (-431.221) -- 0:00:37
Average standard deviation of split frequencies: 0.010082
350500 -- (-432.270) (-430.094) (-433.751) [-430.739] * [-434.595] (-430.815) (-433.354) (-430.925) -- 0:00:37
351000 -- [-429.918] (-430.097) (-432.477) (-432.323) * (-431.140) [-430.588] (-434.843) (-432.421) -- 0:00:36
351500 -- (-433.711) (-430.006) (-432.336) [-431.245] * [-431.186] (-431.359) (-436.480) (-431.342) -- 0:00:36
352000 -- (-431.921) (-432.564) [-433.432] (-431.452) * (-430.905) (-433.532) [-433.220] (-436.429) -- 0:00:36
352500 -- (-434.446) (-430.216) (-431.721) [-433.265] * [-432.550] (-431.586) (-432.160) (-431.814) -- 0:00:36
353000 -- (-431.847) (-430.330) [-433.169] (-434.822) * [-430.720] (-432.716) (-435.013) (-437.969) -- 0:00:36
353500 -- [-431.286] (-434.528) (-433.178) (-434.033) * (-430.512) (-433.878) [-433.296] (-436.495) -- 0:00:36
354000 -- (-433.045) (-431.869) (-433.729) [-430.957] * [-433.153] (-434.441) (-433.350) (-437.063) -- 0:00:36
354500 -- (-432.955) [-432.668] (-430.513) (-431.628) * (-431.880) [-435.275] (-431.905) (-432.868) -- 0:00:36
355000 -- (-430.891) [-432.006] (-430.457) (-432.948) * (-438.018) (-436.828) (-435.273) [-432.302] -- 0:00:36
Average standard deviation of split frequencies: 0.009931
355500 -- (-431.275) [-431.962] (-432.239) (-432.307) * (-434.554) (-432.821) (-434.308) [-433.357] -- 0:00:38
356000 -- (-430.360) (-432.928) (-434.584) [-433.138] * [-431.655] (-433.775) (-433.982) (-434.148) -- 0:00:37
356500 -- (-430.799) (-432.070) [-433.541] (-434.529) * (-433.302) [-431.854] (-432.788) (-435.461) -- 0:00:37
357000 -- [-430.979] (-433.326) (-432.797) (-433.736) * (-431.311) (-430.621) (-433.332) [-430.939] -- 0:00:37
357500 -- [-432.145] (-431.897) (-432.775) (-431.506) * (-431.410) (-430.988) [-434.768] (-436.181) -- 0:00:37
358000 -- (-439.550) [-433.342] (-432.883) (-431.453) * [-430.933] (-432.371) (-431.454) (-434.267) -- 0:00:37
358500 -- (-436.871) (-432.471) (-437.823) [-432.125] * (-431.615) [-430.357] (-431.934) (-435.900) -- 0:00:37
359000 -- [-431.694] (-433.076) (-430.336) (-431.810) * (-431.308) (-430.586) (-432.052) [-433.616] -- 0:00:37
359500 -- (-431.487) (-433.973) [-432.579] (-431.864) * (-433.805) (-433.136) (-432.727) [-432.933] -- 0:00:37
360000 -- (-431.656) (-435.047) [-431.340] (-430.835) * (-434.512) [-430.758] (-431.719) (-441.393) -- 0:00:37
Average standard deviation of split frequencies: 0.011028
360500 -- (-433.031) (-432.996) [-433.459] (-432.541) * [-437.042] (-431.457) (-434.069) (-431.644) -- 0:00:37
361000 -- (-431.115) [-431.534] (-434.138) (-433.676) * (-431.676) (-432.783) [-435.433] (-430.849) -- 0:00:37
361500 -- [-432.719] (-432.402) (-436.830) (-433.360) * [-431.329] (-431.883) (-435.297) (-430.037) -- 0:00:37
362000 -- (-430.248) (-431.939) (-435.416) [-434.480] * [-432.160] (-432.298) (-433.450) (-432.835) -- 0:00:37
362500 -- [-430.600] (-433.240) (-433.663) (-431.464) * (-432.246) (-432.698) (-435.375) [-433.384] -- 0:00:36
363000 -- [-430.799] (-433.632) (-435.723) (-433.240) * (-431.467) (-431.762) [-430.508] (-432.415) -- 0:00:36
363500 -- [-433.655] (-432.856) (-433.504) (-435.119) * [-431.184] (-440.730) (-430.392) (-432.312) -- 0:00:36
364000 -- (-430.869) (-431.093) (-430.924) [-432.167] * [-429.970] (-431.971) (-432.391) (-432.138) -- 0:00:36
364500 -- (-429.895) (-431.370) (-432.457) [-430.764] * (-431.970) (-432.010) [-433.979] (-432.734) -- 0:00:36
365000 -- (-432.869) (-430.859) (-432.468) [-432.122] * (-435.434) [-431.884] (-431.643) (-435.297) -- 0:00:36
Average standard deviation of split frequencies: 0.010834
365500 -- (-431.315) (-431.478) (-442.313) [-432.869] * (-432.855) [-431.061] (-433.772) (-434.614) -- 0:00:36
366000 -- (-431.839) (-432.897) (-431.111) [-432.614] * (-430.722) [-432.407] (-431.806) (-434.202) -- 0:00:36
366500 -- (-433.876) (-435.231) (-430.184) [-435.525] * (-430.836) (-432.438) (-433.911) [-432.070] -- 0:00:36
367000 -- (-430.890) [-432.761] (-432.372) (-432.157) * [-430.915] (-434.457) (-432.831) (-431.474) -- 0:00:36
367500 -- (-430.678) (-434.568) (-433.104) [-430.765] * (-430.258) (-432.398) [-431.754] (-433.043) -- 0:00:36
368000 -- [-432.402] (-431.102) (-430.027) (-430.593) * (-430.266) (-433.579) (-432.272) [-430.497] -- 0:00:36
368500 -- (-431.537) [-431.116] (-432.130) (-431.817) * [-431.884] (-431.398) (-432.116) (-434.532) -- 0:00:35
369000 -- (-433.007) (-430.567) (-431.962) [-432.173] * (-431.889) [-436.608] (-436.525) (-431.175) -- 0:00:35
369500 -- (-433.310) (-430.145) [-431.282] (-431.722) * (-433.128) (-432.098) [-432.979] (-431.259) -- 0:00:35
370000 -- (-430.737) (-431.584) (-438.854) [-432.333] * [-431.187] (-430.542) (-432.144) (-430.553) -- 0:00:35
Average standard deviation of split frequencies: 0.011222
370500 -- (-430.366) [-432.313] (-430.469) (-430.858) * (-431.578) (-432.687) (-430.737) [-430.816] -- 0:00:35
371000 -- (-433.624) (-433.037) (-432.686) [-431.643] * [-430.966] (-436.584) (-433.621) (-431.051) -- 0:00:35
371500 -- [-433.106] (-431.209) (-433.318) (-432.543) * [-432.079] (-430.860) (-433.289) (-433.280) -- 0:00:35
372000 -- (-430.439) (-431.010) (-431.413) [-432.432] * (-431.036) [-430.915] (-431.538) (-430.591) -- 0:00:35
372500 -- (-432.934) [-430.158] (-432.449) (-430.451) * (-436.564) (-434.503) [-433.217] (-431.917) -- 0:00:35
373000 -- (-431.945) (-430.249) (-433.775) [-430.743] * (-434.232) [-434.503] (-431.967) (-433.168) -- 0:00:36
373500 -- (-434.104) (-432.384) [-431.162] (-432.271) * (-434.683) [-438.517] (-430.869) (-432.492) -- 0:00:36
374000 -- (-432.239) [-432.210] (-436.312) (-433.797) * [-433.320] (-431.589) (-431.637) (-434.479) -- 0:00:36
374500 -- [-431.357] (-431.397) (-433.344) (-431.114) * [-432.373] (-430.475) (-431.315) (-433.949) -- 0:00:36
375000 -- (-433.376) (-433.146) (-430.748) [-432.755] * (-431.109) (-432.837) (-431.970) [-433.619] -- 0:00:36
Average standard deviation of split frequencies: 0.011284
375500 -- (-430.585) (-433.326) [-432.163] (-434.028) * (-437.302) (-433.465) [-431.267] (-433.170) -- 0:00:36
376000 -- (-431.371) [-430.581] (-431.128) (-432.592) * (-432.900) (-432.910) [-431.860] (-432.589) -- 0:00:36
376500 -- [-430.974] (-434.854) (-434.661) (-432.171) * (-433.468) (-441.320) (-432.683) [-430.368] -- 0:00:36
377000 -- [-432.352] (-437.195) (-430.446) (-435.619) * [-432.636] (-434.080) (-430.628) (-432.190) -- 0:00:36
377500 -- (-431.246) [-434.625] (-431.963) (-433.361) * [-431.601] (-431.653) (-431.823) (-432.408) -- 0:00:36
378000 -- (-429.893) (-430.951) (-433.930) [-432.490] * (-436.025) (-434.836) (-433.335) [-430.781] -- 0:00:36
378500 -- (-434.881) [-435.287] (-431.308) (-431.063) * (-431.345) (-432.512) (-436.297) [-432.676] -- 0:00:36
379000 -- (-430.597) [-431.457] (-433.277) (-431.471) * (-431.103) [-432.186] (-437.110) (-433.973) -- 0:00:36
379500 -- (-433.364) [-431.887] (-436.299) (-430.437) * [-433.554] (-435.874) (-432.995) (-433.724) -- 0:00:35
380000 -- (-434.787) (-431.224) (-432.248) [-431.983] * (-434.027) (-433.926) [-437.369] (-432.138) -- 0:00:35
Average standard deviation of split frequencies: 0.011218
380500 -- (-436.886) [-432.934] (-435.132) (-431.798) * (-432.443) [-431.881] (-430.934) (-430.830) -- 0:00:35
381000 -- (-432.393) [-431.040] (-434.173) (-433.673) * (-435.644) (-433.249) [-433.549] (-430.855) -- 0:00:35
381500 -- [-432.132] (-431.951) (-432.096) (-430.932) * (-431.335) [-432.632] (-433.479) (-432.623) -- 0:00:35
382000 -- [-430.895] (-433.798) (-431.092) (-434.249) * (-433.109) (-434.006) (-431.121) [-431.858] -- 0:00:35
382500 -- (-431.152) (-433.991) (-433.419) [-430.873] * (-435.303) (-430.820) [-434.617] (-431.593) -- 0:00:35
383000 -- [-431.581] (-433.819) (-431.301) (-433.983) * (-436.119) [-432.331] (-435.272) (-435.178) -- 0:00:35
383500 -- [-430.526] (-437.941) (-430.754) (-432.875) * (-440.059) [-432.846] (-432.468) (-431.261) -- 0:00:35
384000 -- (-435.095) [-433.148] (-434.996) (-431.495) * (-433.212) (-435.411) [-432.453] (-433.467) -- 0:00:35
384500 -- (-430.154) (-432.182) [-432.713] (-434.219) * (-431.899) [-431.282] (-430.698) (-435.560) -- 0:00:35
385000 -- (-432.100) [-433.115] (-432.955) (-436.952) * (-431.825) (-431.068) (-430.852) [-432.876] -- 0:00:35
Average standard deviation of split frequencies: 0.010704
385500 -- (-431.268) (-433.480) [-433.967] (-430.831) * (-433.467) [-430.957] (-430.140) (-430.385) -- 0:00:35
386000 -- (-431.092) (-434.181) (-433.494) [-433.457] * (-433.453) [-432.215] (-430.761) (-431.030) -- 0:00:34
386500 -- (-431.324) (-432.253) (-431.730) [-433.113] * (-433.413) (-432.500) [-431.367] (-432.683) -- 0:00:34
387000 -- (-434.593) (-431.412) (-432.987) [-434.151] * (-434.106) (-431.756) (-430.829) [-432.327] -- 0:00:34
387500 -- (-430.918) (-431.646) [-430.266] (-436.174) * [-431.694] (-435.968) (-430.698) (-430.813) -- 0:00:34
388000 -- [-431.061] (-430.867) (-430.676) (-432.187) * (-431.889) (-431.468) (-433.444) [-431.982] -- 0:00:34
388500 -- (-432.334) [-430.444] (-432.769) (-433.766) * (-430.164) [-430.365] (-434.384) (-432.325) -- 0:00:34
389000 -- (-431.902) [-432.274] (-434.879) (-430.870) * [-431.115] (-432.241) (-430.932) (-432.365) -- 0:00:34
389500 -- [-434.257] (-433.415) (-434.110) (-432.385) * (-431.738) [-434.680] (-435.720) (-435.484) -- 0:00:34
390000 -- [-432.177] (-432.949) (-433.325) (-434.667) * (-432.415) (-432.967) [-432.110] (-433.117) -- 0:00:35
Average standard deviation of split frequencies: 0.011002
390500 -- [-438.180] (-431.177) (-434.322) (-433.722) * (-435.643) (-431.532) (-430.336) [-431.541] -- 0:00:35
391000 -- (-431.653) [-433.482] (-431.153) (-432.298) * (-434.575) (-430.087) [-431.335] (-433.824) -- 0:00:35
391500 -- (-431.974) (-431.139) (-433.952) [-431.805] * (-434.056) [-430.100] (-432.450) (-432.781) -- 0:00:35
392000 -- (-430.513) [-432.203] (-437.894) (-434.045) * (-437.390) (-432.216) (-434.558) [-434.455] -- 0:00:35
392500 -- (-431.989) (-432.788) [-431.896] (-433.196) * (-434.154) (-431.074) (-431.389) [-440.154] -- 0:00:35
393000 -- (-433.968) (-431.624) [-432.591] (-432.758) * (-432.773) (-430.905) [-432.121] (-435.503) -- 0:00:35
393500 -- [-433.723] (-433.213) (-432.910) (-433.907) * (-432.955) (-431.436) [-434.674] (-430.799) -- 0:00:35
394000 -- (-434.193) [-437.587] (-435.946) (-432.964) * (-432.426) (-430.545) [-431.240] (-431.521) -- 0:00:35
394500 -- (-432.888) [-433.415] (-431.449) (-430.175) * (-433.454) (-432.371) [-429.851] (-430.221) -- 0:00:35
395000 -- (-433.095) [-431.084] (-431.540) (-430.676) * (-433.458) [-431.627] (-433.788) (-431.884) -- 0:00:35
Average standard deviation of split frequencies: 0.010924
395500 -- [-433.034] (-434.835) (-432.629) (-430.975) * (-429.827) (-432.410) (-431.190) [-431.631] -- 0:00:35
396000 -- (-434.374) (-432.083) (-430.649) [-431.137] * [-430.156] (-430.831) (-431.607) (-431.280) -- 0:00:35
396500 -- (-431.917) [-430.246] (-431.900) (-430.536) * (-430.776) (-431.939) [-433.644] (-433.448) -- 0:00:35
397000 -- (-431.780) (-435.548) (-431.474) [-431.374] * [-434.242] (-431.977) (-432.868) (-430.598) -- 0:00:34
397500 -- (-430.087) (-433.658) [-431.674] (-434.115) * (-434.405) [-433.109] (-433.746) (-431.617) -- 0:00:34
398000 -- (-436.626) [-431.372] (-432.309) (-430.957) * (-431.946) (-433.833) [-430.187] (-430.701) -- 0:00:34
398500 -- (-432.522) [-431.743] (-432.021) (-434.614) * [-430.894] (-434.884) (-433.545) (-431.027) -- 0:00:34
399000 -- [-431.605] (-432.068) (-430.951) (-431.396) * (-433.444) (-432.284) [-433.155] (-431.943) -- 0:00:34
399500 -- (-435.334) [-431.807] (-430.869) (-432.685) * (-431.225) [-431.012] (-432.209) (-431.158) -- 0:00:34
400000 -- (-437.185) [-431.651] (-431.857) (-433.687) * (-432.277) (-434.336) [-433.602] (-430.718) -- 0:00:34
Average standard deviation of split frequencies: 0.010520
400500 -- (-435.320) (-433.710) [-434.410] (-431.684) * (-431.090) (-436.505) (-433.110) [-431.949] -- 0:00:34
401000 -- [-432.106] (-430.497) (-431.884) (-432.300) * [-431.945] (-433.239) (-441.147) (-433.003) -- 0:00:34
401500 -- [-433.519] (-431.325) (-431.843) (-430.663) * (-430.970) (-433.044) (-432.844) [-430.740] -- 0:00:34
402000 -- (-434.857) (-432.027) [-431.665] (-430.011) * [-430.233] (-430.358) (-432.483) (-435.506) -- 0:00:34
402500 -- (-430.846) [-434.985] (-434.346) (-433.037) * (-437.116) [-430.104] (-432.531) (-432.187) -- 0:00:34
403000 -- (-431.410) (-434.755) (-433.500) [-431.526] * (-431.029) [-430.865] (-432.342) (-433.545) -- 0:00:34
403500 -- (-433.526) (-430.132) (-433.736) [-431.429] * (-434.160) (-431.466) [-430.496] (-432.289) -- 0:00:34
404000 -- (-432.087) [-430.733] (-434.358) (-435.128) * (-430.343) (-431.497) [-434.565] (-430.665) -- 0:00:33
404500 -- [-430.338] (-431.756) (-431.204) (-433.209) * (-431.452) (-433.372) (-431.891) [-431.003] -- 0:00:33
405000 -- [-432.536] (-432.918) (-430.923) (-434.764) * (-432.827) (-432.193) (-431.694) [-431.010] -- 0:00:33
Average standard deviation of split frequencies: 0.010382
405500 -- [-434.234] (-432.102) (-431.783) (-431.521) * [-432.473] (-431.793) (-431.039) (-434.672) -- 0:00:33
406000 -- (-432.421) (-432.106) [-430.577] (-431.868) * (-431.107) (-435.045) [-430.389] (-430.623) -- 0:00:33
406500 -- (-430.861) [-432.586] (-431.837) (-431.488) * [-432.074] (-433.244) (-430.740) (-436.373) -- 0:00:33
407000 -- [-431.386] (-431.183) (-430.521) (-431.188) * [-430.768] (-430.779) (-433.059) (-437.191) -- 0:00:34
407500 -- (-431.888) (-433.498) [-436.444] (-432.606) * (-430.027) (-432.405) [-431.853] (-433.686) -- 0:00:34
408000 -- [-430.812] (-431.019) (-432.351) (-433.841) * (-430.837) (-436.788) (-432.985) [-435.939] -- 0:00:34
408500 -- (-431.117) (-432.624) (-431.244) [-432.148] * (-433.264) [-436.106] (-433.943) (-434.235) -- 0:00:34
409000 -- (-434.050) (-433.792) (-435.030) [-435.273] * [-430.535] (-440.765) (-432.988) (-433.663) -- 0:00:34
409500 -- (-433.981) (-432.362) (-436.223) [-431.549] * (-430.224) (-433.872) [-430.618] (-431.572) -- 0:00:34
410000 -- (-432.170) (-433.095) [-433.668] (-432.664) * (-430.608) (-435.417) [-432.827] (-430.241) -- 0:00:34
Average standard deviation of split frequencies: 0.010534
410500 -- (-431.214) (-437.536) [-436.456] (-434.374) * (-431.120) (-431.126) (-431.100) [-430.348] -- 0:00:34
411000 -- (-430.200) (-431.868) [-431.329] (-432.281) * (-431.062) [-431.532] (-431.850) (-433.225) -- 0:00:34
411500 -- (-432.353) (-431.842) [-430.488] (-431.177) * [-430.418] (-431.086) (-431.525) (-430.629) -- 0:00:34
412000 -- (-430.657) (-433.864) [-431.009] (-433.747) * (-431.132) (-432.293) (-433.629) [-432.402] -- 0:00:34
412500 -- (-431.413) (-433.646) (-430.344) [-432.085] * (-430.781) [-431.392] (-430.498) (-433.337) -- 0:00:34
413000 -- [-432.668] (-431.135) (-431.669) (-433.450) * [-431.944] (-431.705) (-431.905) (-431.282) -- 0:00:34
413500 -- (-435.472) (-433.158) [-431.807] (-435.823) * (-432.773) [-430.981] (-438.591) (-431.778) -- 0:00:34
414000 -- (-431.848) [-430.692] (-430.777) (-430.498) * (-434.829) (-431.098) (-436.931) [-431.067] -- 0:00:33
414500 -- [-434.966] (-432.299) (-431.011) (-431.556) * [-431.863] (-431.197) (-429.965) (-432.524) -- 0:00:33
415000 -- (-431.541) (-432.333) (-433.000) [-433.968] * (-434.598) (-434.062) (-433.846) [-432.246] -- 0:00:33
Average standard deviation of split frequencies: 0.009932
415500 -- (-430.452) (-431.694) (-431.060) [-433.799] * [-433.376] (-432.150) (-431.388) (-436.217) -- 0:00:33
416000 -- (-431.388) (-432.284) (-430.512) [-431.972] * (-431.464) [-433.587] (-430.699) (-439.920) -- 0:00:33
416500 -- (-432.068) [-432.763] (-432.954) (-431.460) * (-433.931) (-435.515) [-431.682] (-435.210) -- 0:00:33
417000 -- (-434.460) [-433.389] (-430.539) (-437.331) * (-435.443) [-433.368] (-431.944) (-432.440) -- 0:00:33
417500 -- [-437.898] (-432.145) (-431.472) (-430.876) * [-431.211] (-432.145) (-434.845) (-430.207) -- 0:00:33
418000 -- (-432.426) (-431.911) (-434.036) [-434.732] * (-431.303) [-430.910] (-430.917) (-430.750) -- 0:00:33
418500 -- (-430.839) [-430.383] (-432.727) (-432.840) * [-430.826] (-431.094) (-430.437) (-432.284) -- 0:00:33
419000 -- [-430.392] (-430.828) (-432.724) (-431.614) * (-432.575) [-432.368] (-432.064) (-432.957) -- 0:00:33
419500 -- (-433.153) [-431.767] (-433.997) (-432.324) * [-430.901] (-436.348) (-434.887) (-434.886) -- 0:00:33
420000 -- (-431.332) (-432.924) (-432.218) [-430.759] * (-433.123) (-434.260) (-433.548) [-431.663] -- 0:00:33
Average standard deviation of split frequencies: 0.009945
420500 -- (-431.443) [-431.659] (-435.095) (-444.618) * [-433.616] (-433.197) (-430.203) (-431.486) -- 0:00:33
421000 -- (-432.904) [-432.158] (-432.148) (-444.035) * (-431.049) [-432.056] (-430.009) (-431.937) -- 0:00:33
421500 -- (-432.159) (-436.934) (-433.493) [-432.344] * (-430.193) [-434.441] (-430.906) (-431.166) -- 0:00:32
422000 -- (-432.141) [-431.133] (-432.723) (-430.997) * [-431.912] (-437.455) (-433.883) (-431.524) -- 0:00:32
422500 -- (-430.836) (-430.296) [-431.542] (-432.302) * [-434.565] (-435.297) (-430.077) (-435.046) -- 0:00:32
423000 -- (-432.232) (-432.232) (-431.294) [-433.922] * [-431.394] (-433.565) (-431.309) (-430.227) -- 0:00:32
423500 -- [-431.683] (-433.349) (-434.373) (-434.987) * (-432.777) (-430.410) [-431.124] (-431.646) -- 0:00:32
424000 -- (-430.941) [-431.700] (-432.793) (-431.147) * [-433.353] (-431.317) (-432.775) (-432.116) -- 0:00:32
424500 -- (-432.299) (-433.065) (-432.903) [-430.459] * (-433.478) (-431.568) (-432.838) [-430.599] -- 0:00:33
425000 -- [-434.431] (-431.771) (-432.101) (-431.691) * [-432.127] (-430.840) (-433.098) (-435.546) -- 0:00:33
Average standard deviation of split frequencies: 0.008853
425500 -- (-433.829) (-434.332) (-433.789) [-431.711] * (-431.068) (-431.090) [-436.072] (-432.905) -- 0:00:33
426000 -- (-433.013) (-441.903) [-434.790] (-432.282) * (-433.813) (-430.593) (-438.636) [-431.794] -- 0:00:33
426500 -- [-436.143] (-434.580) (-433.554) (-433.274) * (-432.034) [-431.605] (-439.584) (-437.132) -- 0:00:33
427000 -- [-434.161] (-433.309) (-432.996) (-432.869) * (-437.679) (-431.324) [-431.694] (-431.588) -- 0:00:33
427500 -- (-438.140) (-434.462) [-432.789] (-435.758) * (-435.902) [-430.959] (-435.650) (-429.984) -- 0:00:33
428000 -- (-431.608) [-430.997] (-431.672) (-432.585) * (-432.376) (-430.353) (-430.466) [-430.322] -- 0:00:33
428500 -- (-432.311) (-430.186) [-430.668] (-434.401) * (-434.091) (-430.805) [-437.255] (-434.661) -- 0:00:33
429000 -- (-436.690) [-431.560] (-432.399) (-431.165) * (-433.106) [-435.675] (-435.444) (-432.297) -- 0:00:33
429500 -- (-431.804) [-432.226] (-435.186) (-430.474) * (-431.845) [-432.817] (-432.455) (-432.899) -- 0:00:33
430000 -- (-433.790) (-441.807) [-432.943] (-431.522) * (-432.874) (-431.710) [-430.627] (-431.501) -- 0:00:33
Average standard deviation of split frequencies: 0.009336
430500 -- (-432.521) (-443.689) [-431.812] (-432.035) * (-430.314) [-433.329] (-433.023) (-432.571) -- 0:00:33
431000 -- (-434.501) (-432.583) (-433.287) [-430.946] * [-431.460] (-430.919) (-431.993) (-434.284) -- 0:00:33
431500 -- (-431.811) (-433.141) [-434.224] (-431.073) * (-431.963) (-430.930) (-431.565) [-433.549] -- 0:00:32
432000 -- (-432.040) (-433.715) (-432.304) [-432.627] * (-434.276) [-433.836] (-432.112) (-434.410) -- 0:00:32
432500 -- (-432.351) (-432.355) [-431.494] (-432.338) * (-433.571) (-434.073) (-433.385) [-431.496] -- 0:00:32
433000 -- (-432.098) (-436.520) (-431.607) [-431.344] * (-437.661) [-430.663] (-431.772) (-431.501) -- 0:00:32
433500 -- (-432.131) (-434.691) (-434.880) [-437.125] * (-438.944) (-432.534) (-432.678) [-430.664] -- 0:00:32
434000 -- (-431.190) [-430.640] (-433.828) (-433.362) * (-431.647) (-432.280) (-433.083) [-433.098] -- 0:00:32
434500 -- (-431.392) [-431.859] (-431.678) (-430.893) * [-432.189] (-431.641) (-432.362) (-431.835) -- 0:00:32
435000 -- (-435.570) (-432.378) (-433.131) [-433.840] * (-433.833) [-430.616] (-431.197) (-431.871) -- 0:00:32
Average standard deviation of split frequencies: 0.009663
435500 -- (-431.348) (-430.549) [-430.303] (-432.760) * [-432.676] (-432.500) (-430.264) (-430.802) -- 0:00:32
436000 -- (-432.242) (-431.575) [-430.131] (-437.267) * (-432.886) (-430.858) [-431.691] (-433.090) -- 0:00:32
436500 -- (-432.767) (-431.817) (-430.642) [-432.344] * [-430.566] (-432.432) (-433.185) (-430.911) -- 0:00:32
437000 -- (-430.516) (-430.081) [-433.249] (-432.958) * (-432.488) (-431.825) [-431.680] (-431.170) -- 0:00:32
437500 -- (-432.467) (-431.121) [-430.869] (-440.020) * (-430.317) [-430.370] (-432.319) (-434.977) -- 0:00:32
438000 -- (-434.138) (-432.775) [-431.570] (-433.021) * (-436.002) (-431.823) (-433.221) [-432.967] -- 0:00:32
438500 -- (-431.830) (-431.392) (-434.013) [-432.018] * (-433.339) (-431.904) (-431.122) [-433.744] -- 0:00:32
439000 -- [-431.864] (-431.365) (-432.672) (-432.801) * (-434.411) [-431.054] (-433.965) (-434.355) -- 0:00:31
439500 -- (-431.530) (-430.485) [-432.533] (-434.158) * (-430.602) [-430.617] (-433.163) (-432.093) -- 0:00:31
440000 -- (-432.153) [-435.072] (-438.436) (-435.243) * (-432.010) [-433.474] (-430.941) (-431.998) -- 0:00:31
Average standard deviation of split frequencies: 0.009561
440500 -- (-435.455) (-434.611) (-435.733) [-431.271] * (-430.882) (-431.875) [-435.753] (-434.198) -- 0:00:31
441000 -- (-432.352) [-430.299] (-432.669) (-433.015) * [-432.148] (-432.631) (-435.143) (-430.069) -- 0:00:31
441500 -- [-432.365] (-436.298) (-434.694) (-432.505) * (-430.675) (-433.026) [-431.918] (-435.911) -- 0:00:32
442000 -- (-432.409) (-437.031) (-430.190) [-435.461] * (-433.904) (-434.062) (-434.650) [-430.795] -- 0:00:32
442500 -- (-430.493) (-434.892) (-432.978) [-430.392] * (-435.743) (-431.952) (-431.985) [-434.183] -- 0:00:32
443000 -- (-432.064) (-432.777) (-432.326) [-431.413] * (-434.522) [-432.830] (-434.028) (-436.110) -- 0:00:32
443500 -- (-434.651) (-430.716) (-433.943) [-430.870] * [-431.594] (-432.938) (-430.788) (-431.452) -- 0:00:32
444000 -- (-432.268) (-433.141) (-431.383) [-431.771] * (-432.582) [-430.727] (-432.543) (-433.074) -- 0:00:32
444500 -- (-433.424) (-431.998) (-431.407) [-432.112] * (-432.502) (-433.410) (-431.525) [-434.633] -- 0:00:32
445000 -- (-431.673) (-432.607) (-431.137) [-430.434] * (-432.344) (-433.980) [-431.433] (-432.708) -- 0:00:32
Average standard deviation of split frequencies: 0.009314
445500 -- (-433.325) (-431.620) (-431.526) [-431.351] * (-435.429) [-434.602] (-432.346) (-430.833) -- 0:00:32
446000 -- (-431.153) (-431.477) (-432.308) [-431.955] * (-433.025) (-434.818) (-434.537) [-431.369] -- 0:00:32
446500 -- (-431.023) [-433.782] (-431.274) (-434.494) * [-433.868] (-433.558) (-430.540) (-431.554) -- 0:00:32
447000 -- (-433.338) (-432.953) (-435.021) [-433.817] * (-431.306) (-438.056) (-430.384) [-431.556] -- 0:00:32
447500 -- (-435.075) [-435.679] (-431.561) (-433.813) * (-434.026) [-432.095] (-431.132) (-432.375) -- 0:00:32
448000 -- [-432.408] (-432.721) (-433.961) (-435.948) * (-433.520) (-434.091) [-431.166] (-436.355) -- 0:00:32
448500 -- (-435.135) (-431.636) [-432.028] (-437.492) * (-430.437) [-430.673] (-435.370) (-433.099) -- 0:00:31
449000 -- (-434.442) [-432.208] (-436.733) (-439.261) * (-430.847) (-432.503) [-434.867] (-436.438) -- 0:00:31
449500 -- (-431.658) (-433.972) [-432.581] (-439.496) * (-433.553) [-430.086] (-434.487) (-434.389) -- 0:00:31
450000 -- (-431.511) [-432.345] (-431.084) (-434.209) * (-432.171) [-429.908] (-435.528) (-431.999) -- 0:00:31
Average standard deviation of split frequencies: 0.009045
450500 -- (-430.920) (-431.905) [-436.300] (-433.110) * [-431.634] (-431.445) (-432.153) (-431.119) -- 0:00:31
451000 -- (-432.292) (-433.769) (-433.105) [-430.789] * (-435.189) (-431.790) [-432.185] (-433.412) -- 0:00:31
451500 -- (-436.657) (-433.073) [-430.815] (-434.730) * (-431.210) (-430.874) (-432.624) [-433.547] -- 0:00:31
452000 -- [-436.003] (-433.038) (-431.384) (-432.563) * (-433.905) [-431.993] (-430.816) (-435.102) -- 0:00:31
452500 -- (-434.845) [-439.393] (-434.091) (-432.261) * (-434.175) [-431.938] (-431.271) (-431.713) -- 0:00:31
453000 -- (-431.680) (-433.070) (-430.692) [-433.446] * (-437.317) [-431.819] (-433.685) (-431.455) -- 0:00:31
453500 -- (-433.456) (-432.899) (-431.680) [-433.545] * (-434.375) (-430.928) [-430.325] (-434.174) -- 0:00:31
454000 -- (-435.518) [-431.975] (-431.907) (-436.533) * [-431.360] (-431.159) (-430.377) (-433.682) -- 0:00:31
454500 -- (-433.540) (-434.332) (-431.078) [-438.698] * (-430.195) [-433.649] (-433.155) (-430.760) -- 0:00:31
455000 -- [-431.894] (-431.745) (-430.973) (-433.227) * (-430.437) (-431.170) (-435.252) [-439.919] -- 0:00:31
Average standard deviation of split frequencies: 0.008939
455500 -- [-430.334] (-433.331) (-432.167) (-431.807) * [-429.910] (-431.134) (-435.426) (-436.080) -- 0:00:31
456000 -- (-432.200) [-431.972] (-430.762) (-431.207) * (-430.125) (-430.880) (-433.696) [-432.029] -- 0:00:31
456500 -- (-431.573) (-431.775) (-434.332) [-434.915] * (-430.903) [-432.652] (-432.388) (-435.279) -- 0:00:30
457000 -- (-434.770) [-431.447] (-431.735) (-431.941) * (-432.372) [-432.639] (-432.534) (-434.037) -- 0:00:30
457500 -- (-431.106) (-436.235) [-436.607] (-435.715) * (-435.466) (-432.291) (-432.918) [-433.580] -- 0:00:30
458000 -- (-432.573) [-433.093] (-434.678) (-430.497) * [-433.921] (-434.286) (-433.923) (-432.136) -- 0:00:30
458500 -- (-431.717) (-434.911) (-434.068) [-431.013] * (-430.402) (-433.464) (-431.031) [-430.855] -- 0:00:30
459000 -- (-430.143) (-431.248) [-433.494] (-434.512) * (-430.773) (-432.628) (-430.586) [-434.319] -- 0:00:31
459500 -- [-431.623] (-430.905) (-432.327) (-434.311) * (-431.063) (-430.943) (-432.318) [-436.336] -- 0:00:31
460000 -- (-431.428) (-431.146) (-432.299) [-434.233] * (-433.031) [-430.310] (-432.120) (-432.359) -- 0:00:31
Average standard deviation of split frequencies: 0.009089
460500 -- (-434.599) (-431.619) (-432.120) [-431.611] * (-432.770) [-433.625] (-432.499) (-434.189) -- 0:00:31
461000 -- (-433.394) [-432.841] (-432.581) (-430.889) * (-430.818) (-431.110) [-430.388] (-430.864) -- 0:00:31
461500 -- [-433.951] (-432.736) (-431.997) (-431.776) * [-431.391] (-431.612) (-431.695) (-431.785) -- 0:00:31
462000 -- (-433.955) (-431.654) [-434.977] (-431.188) * (-432.604) (-433.094) (-430.805) [-431.100] -- 0:00:31
462500 -- [-430.614] (-432.223) (-432.525) (-430.646) * [-431.028] (-431.489) (-431.935) (-432.167) -- 0:00:31
463000 -- (-433.497) (-432.135) [-430.996] (-431.076) * [-431.576] (-430.646) (-431.215) (-431.505) -- 0:00:31
463500 -- [-432.321] (-430.717) (-430.342) (-430.238) * [-431.166] (-432.232) (-430.259) (-431.269) -- 0:00:31
464000 -- (-430.704) (-430.278) (-430.653) [-436.525] * (-430.505) (-432.402) (-430.208) [-431.769] -- 0:00:31
464500 -- (-430.533) (-431.052) [-432.482] (-432.051) * [-429.915] (-430.860) (-431.266) (-432.982) -- 0:00:31
465000 -- (-432.294) (-431.356) [-432.427] (-432.742) * (-434.423) (-432.233) (-432.030) [-431.717] -- 0:00:31
Average standard deviation of split frequencies: 0.008985
465500 -- (-432.688) [-432.705] (-431.650) (-436.927) * [-433.958] (-430.750) (-431.400) (-432.357) -- 0:00:31
466000 -- [-431.237] (-431.141) (-433.486) (-434.592) * [-431.289] (-435.182) (-435.151) (-432.229) -- 0:00:30
466500 -- (-431.968) (-430.816) [-432.589] (-433.392) * (-434.861) [-432.650] (-433.272) (-432.109) -- 0:00:30
467000 -- (-430.351) [-432.592] (-430.848) (-431.031) * [-435.456] (-430.632) (-431.851) (-432.329) -- 0:00:30
467500 -- [-430.163] (-429.807) (-430.732) (-431.168) * (-431.241) (-430.262) [-431.565] (-430.698) -- 0:00:30
468000 -- (-430.909) [-431.977] (-436.437) (-432.361) * (-431.357) [-432.434] (-431.124) (-431.754) -- 0:00:30
468500 -- (-432.762) (-432.867) [-434.581] (-431.573) * (-435.201) (-430.126) (-431.938) [-430.408] -- 0:00:30
469000 -- (-431.864) (-434.752) (-432.548) [-432.635] * (-430.104) (-430.909) [-430.203] (-432.702) -- 0:00:30
469500 -- (-431.186) [-433.225] (-434.202) (-434.346) * (-433.572) (-432.350) (-430.278) [-432.373] -- 0:00:30
470000 -- (-432.915) [-431.171] (-434.593) (-432.309) * [-430.541] (-430.184) (-431.056) (-432.820) -- 0:00:30
Average standard deviation of split frequencies: 0.007600
470500 -- [-430.222] (-431.196) (-432.829) (-434.664) * (-431.396) [-430.035] (-432.616) (-431.653) -- 0:00:30
471000 -- [-430.318] (-431.600) (-430.572) (-431.681) * [-434.084] (-431.294) (-436.241) (-432.130) -- 0:00:30
471500 -- (-434.196) (-432.406) [-433.003] (-431.715) * (-431.699) [-430.707] (-431.922) (-432.722) -- 0:00:30
472000 -- [-432.807] (-431.456) (-435.772) (-431.897) * (-433.277) [-430.890] (-430.827) (-431.194) -- 0:00:30
472500 -- (-433.029) (-433.332) (-433.029) [-433.138] * (-432.022) (-434.145) (-430.919) [-430.730] -- 0:00:30
473000 -- (-433.176) (-433.169) (-430.851) [-431.907] * (-433.103) (-433.904) (-432.599) [-432.465] -- 0:00:30
473500 -- [-435.029] (-433.658) (-430.237) (-433.406) * (-431.523) (-432.314) (-431.615) [-432.170] -- 0:00:30
474000 -- [-430.694] (-433.692) (-432.974) (-434.591) * (-432.524) [-431.184] (-434.379) (-432.714) -- 0:00:29
474500 -- (-431.981) (-433.007) (-431.480) [-431.239] * (-435.174) (-431.546) [-433.540] (-431.731) -- 0:00:29
475000 -- (-434.271) (-436.647) (-431.622) [-431.713] * (-438.131) (-434.474) (-431.150) [-434.146] -- 0:00:29
Average standard deviation of split frequencies: 0.007340
475500 -- (-439.027) (-434.116) [-431.690] (-432.584) * (-431.157) (-432.247) [-431.934] (-434.983) -- 0:00:29
476000 -- (-431.483) (-435.366) [-430.903] (-431.390) * (-432.868) [-431.923] (-434.184) (-431.191) -- 0:00:29
476500 -- (-431.538) (-429.885) (-434.591) [-430.966] * [-430.819] (-430.802) (-431.828) (-431.511) -- 0:00:30
477000 -- (-433.590) (-434.877) [-433.579] (-431.359) * [-432.625] (-431.240) (-438.278) (-433.865) -- 0:00:30
477500 -- [-431.302] (-431.577) (-432.180) (-440.331) * [-435.746] (-433.346) (-438.386) (-432.817) -- 0:00:30
478000 -- (-433.596) [-431.079] (-436.856) (-433.070) * (-432.183) [-431.862] (-432.166) (-433.141) -- 0:00:30
478500 -- (-431.702) (-430.452) (-433.446) [-431.820] * [-433.216] (-432.974) (-434.427) (-435.253) -- 0:00:30
479000 -- (-432.100) [-432.363] (-431.119) (-430.728) * [-430.464] (-430.967) (-433.434) (-433.383) -- 0:00:30
479500 -- [-432.249] (-431.472) (-433.370) (-431.323) * [-431.721] (-432.054) (-430.496) (-433.950) -- 0:00:30
480000 -- [-432.197] (-432.083) (-432.248) (-430.406) * (-432.299) (-434.019) (-431.164) [-432.090] -- 0:00:30
Average standard deviation of split frequencies: 0.007211
480500 -- (-431.445) [-434.024] (-434.576) (-431.301) * (-430.307) (-433.628) [-432.462] (-431.437) -- 0:00:30
481000 -- (-432.432) [-431.083] (-433.995) (-430.384) * [-431.623] (-431.483) (-434.366) (-433.271) -- 0:00:30
481500 -- (-431.872) [-431.934] (-434.607) (-430.544) * (-433.628) (-433.823) [-432.651] (-431.420) -- 0:00:30
482000 -- [-438.127] (-432.078) (-432.461) (-430.650) * (-433.801) [-433.446] (-431.225) (-432.121) -- 0:00:30
482500 -- (-431.473) (-431.901) (-432.549) [-433.251] * (-433.514) (-431.130) [-432.400] (-430.502) -- 0:00:30
483000 -- (-430.004) [-431.856] (-430.481) (-430.611) * (-433.115) [-430.773] (-430.134) (-430.673) -- 0:00:29
483500 -- (-435.010) [-433.598] (-431.066) (-430.180) * (-432.103) (-431.557) (-435.011) [-430.755] -- 0:00:29
484000 -- (-430.949) [-435.218] (-435.038) (-431.615) * (-430.488) [-434.397] (-431.280) (-433.880) -- 0:00:29
484500 -- (-431.265) (-432.900) (-431.770) [-436.298] * (-436.052) (-432.830) (-435.954) [-433.425] -- 0:00:29
485000 -- [-431.051] (-435.993) (-429.941) (-432.808) * [-432.034] (-434.722) (-432.322) (-433.094) -- 0:00:29
Average standard deviation of split frequencies: 0.007189
485500 -- (-431.257) [-433.146] (-430.363) (-429.873) * (-431.788) (-433.176) [-431.003] (-434.425) -- 0:00:29
486000 -- (-431.577) (-431.504) (-433.085) [-430.669] * (-431.090) [-436.501] (-432.420) (-433.341) -- 0:00:29
486500 -- (-432.519) [-431.677] (-432.205) (-432.937) * (-435.709) (-434.553) (-433.280) [-433.248] -- 0:00:29
487000 -- [-431.078] (-432.465) (-432.091) (-432.771) * (-431.090) [-430.569] (-431.003) (-430.296) -- 0:00:29
487500 -- (-432.440) [-432.251] (-432.588) (-432.009) * (-430.743) (-431.698) [-434.791] (-431.665) -- 0:00:29
488000 -- (-431.941) [-436.888] (-433.951) (-431.315) * [-432.046] (-432.746) (-433.921) (-440.000) -- 0:00:29
488500 -- (-431.485) (-435.483) (-432.564) [-434.093] * (-431.011) [-431.904] (-437.873) (-434.477) -- 0:00:29
489000 -- (-432.774) (-431.434) [-434.316] (-434.046) * (-431.010) [-431.585] (-432.927) (-434.914) -- 0:00:29
489500 -- (-431.890) (-432.055) [-431.705] (-432.599) * (-430.235) (-429.883) (-433.884) [-432.092] -- 0:00:29
490000 -- (-431.630) [-432.990] (-432.531) (-432.638) * [-431.667] (-432.128) (-432.743) (-433.922) -- 0:00:29
Average standard deviation of split frequencies: 0.006895
490500 -- (-434.738) (-432.347) [-430.999] (-431.618) * (-431.679) [-431.900] (-430.898) (-434.021) -- 0:00:29
491000 -- (-432.036) (-436.271) (-431.648) [-431.615] * [-434.162] (-432.994) (-433.387) (-437.881) -- 0:00:29
491500 -- (-431.632) (-433.763) [-432.519] (-431.580) * (-434.583) (-433.518) [-432.979] (-432.944) -- 0:00:28
492000 -- (-432.433) (-433.812) [-435.773] (-432.551) * (-430.889) (-431.388) (-434.220) [-432.850] -- 0:00:28
492500 -- (-436.093) [-431.503] (-430.834) (-433.488) * (-434.205) (-431.423) [-434.358] (-436.968) -- 0:00:28
493000 -- [-430.290] (-430.941) (-431.679) (-432.151) * (-432.504) (-430.620) [-432.514] (-433.658) -- 0:00:28
493500 -- [-432.491] (-431.905) (-433.625) (-431.237) * (-431.913) [-430.594] (-430.946) (-432.466) -- 0:00:28
494000 -- [-429.806] (-432.386) (-431.791) (-430.155) * [-430.518] (-432.364) (-433.591) (-430.581) -- 0:00:29
494500 -- [-430.575] (-430.411) (-431.871) (-430.362) * [-431.003] (-430.639) (-430.273) (-432.185) -- 0:00:29
495000 -- [-431.230] (-432.294) (-431.907) (-431.716) * (-431.967) (-433.745) (-433.618) [-432.663] -- 0:00:29
Average standard deviation of split frequencies: 0.006988
495500 -- [-431.231] (-431.673) (-430.963) (-432.496) * (-440.951) (-434.431) (-430.312) [-431.251] -- 0:00:29
496000 -- [-430.243] (-435.214) (-430.137) (-432.111) * (-432.842) (-430.282) [-430.969] (-433.231) -- 0:00:29
496500 -- (-430.883) (-431.671) (-430.413) [-431.083] * [-436.661] (-431.460) (-434.601) (-434.254) -- 0:00:29
497000 -- (-433.329) [-432.277] (-430.549) (-433.078) * (-434.479) [-431.315] (-433.359) (-432.284) -- 0:00:29
497500 -- (-433.139) (-430.857) [-431.150] (-434.363) * (-439.454) [-432.409] (-429.888) (-430.766) -- 0:00:29
498000 -- (-431.722) (-431.632) (-431.616) [-434.121] * (-436.954) (-435.014) [-430.775] (-430.897) -- 0:00:29
498500 -- (-432.790) (-431.816) (-431.992) [-430.962] * (-432.378) (-431.040) [-431.181] (-432.882) -- 0:00:29
499000 -- (-431.847) (-432.762) (-431.363) [-432.276] * (-436.507) (-433.921) (-433.453) [-430.314] -- 0:00:29
499500 -- [-431.963] (-431.771) (-434.209) (-432.517) * (-432.612) (-431.375) (-430.303) [-431.453] -- 0:00:29
500000 -- (-432.232) [-431.336] (-433.299) (-432.152) * (-432.800) [-432.090] (-430.852) (-430.893) -- 0:00:29
Average standard deviation of split frequencies: 0.008265
500500 -- [-430.496] (-435.613) (-431.530) (-434.535) * (-432.213) (-430.778) [-431.049] (-433.115) -- 0:00:28
501000 -- [-434.847] (-433.901) (-434.094) (-431.741) * (-433.280) (-431.547) (-433.451) [-430.869] -- 0:00:28
501500 -- [-430.349] (-433.239) (-438.869) (-430.846) * [-432.706] (-438.164) (-440.447) (-433.461) -- 0:00:28
502000 -- [-431.565] (-432.747) (-432.317) (-431.351) * [-432.246] (-432.591) (-435.176) (-431.377) -- 0:00:28
502500 -- (-432.133) (-433.358) [-430.913] (-431.117) * [-431.077] (-431.203) (-431.224) (-432.540) -- 0:00:28
503000 -- (-432.897) [-430.772] (-431.264) (-431.147) * (-432.204) (-432.038) (-430.053) [-431.335] -- 0:00:28
503500 -- (-431.879) (-431.287) [-434.002] (-435.733) * (-437.476) (-431.628) [-430.763] (-431.525) -- 0:00:28
504000 -- [-433.653] (-436.306) (-434.280) (-438.904) * (-433.851) (-433.084) (-431.835) [-432.267] -- 0:00:28
504500 -- (-433.705) [-435.265] (-441.334) (-435.880) * (-434.246) [-431.737] (-430.377) (-434.841) -- 0:00:28
505000 -- (-435.936) [-431.038] (-437.414) (-432.996) * (-431.491) (-434.245) (-433.220) [-432.339] -- 0:00:28
Average standard deviation of split frequencies: 0.007712
505500 -- (-431.511) (-432.659) (-432.924) [-431.997] * [-430.405] (-433.438) (-433.061) (-432.556) -- 0:00:28
506000 -- [-432.227] (-433.614) (-432.346) (-431.737) * (-433.763) (-431.371) [-431.157] (-432.903) -- 0:00:28
506500 -- (-433.171) (-438.782) [-436.622] (-431.635) * (-432.397) (-433.320) [-431.696] (-430.781) -- 0:00:28
507000 -- [-433.036] (-432.676) (-430.815) (-431.774) * (-431.089) (-430.797) [-430.806] (-430.438) -- 0:00:28
507500 -- (-437.685) (-435.819) (-431.148) [-436.241] * (-430.311) [-438.151] (-437.309) (-431.861) -- 0:00:28
508000 -- [-433.009] (-430.829) (-433.992) (-430.460) * (-430.848) (-430.854) (-432.069) [-431.455] -- 0:00:28
508500 -- [-431.913] (-435.288) (-433.965) (-430.943) * [-433.313] (-434.684) (-431.969) (-434.982) -- 0:00:28
509000 -- (-431.350) [-432.081] (-432.858) (-434.244) * (-431.950) [-431.867] (-432.983) (-430.651) -- 0:00:27
509500 -- [-433.719] (-431.048) (-433.589) (-431.908) * (-435.630) (-433.860) [-430.780] (-430.771) -- 0:00:27
510000 -- [-434.296] (-433.232) (-431.026) (-431.449) * (-432.784) (-431.549) (-432.266) [-432.966] -- 0:00:27
Average standard deviation of split frequencies: 0.008417
510500 -- (-433.486) [-432.733] (-433.590) (-431.537) * (-433.359) (-430.943) [-431.527] (-432.284) -- 0:00:27
511000 -- (-431.053) (-430.227) [-436.855] (-430.805) * (-435.361) (-431.267) (-431.341) [-431.033] -- 0:00:28
511500 -- (-436.030) (-431.472) (-432.921) [-431.578] * [-434.180] (-434.213) (-434.047) (-434.477) -- 0:00:28
512000 -- (-436.558) [-431.096] (-433.430) (-431.424) * (-433.188) (-431.287) [-432.471] (-432.074) -- 0:00:28
512500 -- (-433.802) (-431.988) (-435.796) [-431.753] * (-436.375) [-433.335] (-433.215) (-431.665) -- 0:00:28
513000 -- (-435.527) (-431.728) (-432.346) [-433.569] * (-437.391) (-432.858) [-432.716] (-436.674) -- 0:00:28
513500 -- [-433.261] (-432.317) (-433.736) (-431.016) * (-434.232) [-432.115] (-433.542) (-435.330) -- 0:00:28
514000 -- [-431.766] (-432.838) (-432.360) (-431.154) * [-432.876] (-432.031) (-433.799) (-435.270) -- 0:00:28
514500 -- (-431.632) (-432.992) [-431.658] (-431.810) * (-432.963) [-435.233] (-434.676) (-432.072) -- 0:00:28
515000 -- (-431.616) (-434.316) [-431.514] (-431.876) * (-435.947) (-434.050) [-429.808] (-431.577) -- 0:00:28
Average standard deviation of split frequencies: 0.007201
515500 -- [-430.588] (-433.215) (-434.122) (-432.471) * [-430.818] (-432.795) (-430.403) (-430.929) -- 0:00:28
516000 -- (-432.344) (-433.407) (-435.637) [-431.736] * (-432.481) (-431.187) (-431.228) [-432.057] -- 0:00:28
516500 -- (-431.981) (-433.792) [-431.353] (-433.495) * (-433.803) [-430.971] (-430.591) (-431.249) -- 0:00:28
517000 -- (-430.749) [-433.800] (-431.058) (-432.336) * [-432.322] (-432.080) (-433.748) (-434.339) -- 0:00:28
517500 -- (-432.462) (-433.491) (-435.444) [-431.266] * (-431.517) (-431.389) (-431.801) [-432.395] -- 0:00:27
518000 -- (-431.297) (-432.423) (-430.463) [-431.256] * (-436.399) [-431.868] (-431.504) (-431.737) -- 0:00:27
518500 -- (-430.233) (-433.649) [-432.591] (-431.721) * (-434.850) (-431.917) [-433.756] (-431.656) -- 0:00:27
519000 -- (-434.196) (-433.276) [-431.995] (-431.868) * (-433.365) (-430.438) [-431.274] (-431.377) -- 0:00:27
519500 -- (-434.786) (-432.579) (-434.619) [-432.388] * (-434.785) (-430.181) (-430.354) [-430.732] -- 0:00:27
520000 -- [-432.135] (-434.884) (-433.546) (-431.890) * [-432.137] (-430.144) (-430.706) (-431.823) -- 0:00:27
Average standard deviation of split frequencies: 0.006734
520500 -- (-432.732) [-432.122] (-433.148) (-431.225) * (-430.692) [-431.601] (-431.016) (-430.581) -- 0:00:27
521000 -- (-431.957) (-431.919) [-433.181] (-431.941) * [-433.765] (-431.740) (-431.008) (-433.048) -- 0:00:27
521500 -- [-430.572] (-432.943) (-430.894) (-431.991) * [-432.693] (-433.566) (-432.688) (-441.715) -- 0:00:27
522000 -- [-431.021] (-433.433) (-432.674) (-435.916) * (-434.744) (-435.053) [-431.832] (-431.648) -- 0:00:27
522500 -- (-435.123) [-430.040] (-431.106) (-433.233) * (-433.875) [-431.247] (-434.807) (-435.551) -- 0:00:27
523000 -- (-431.659) (-433.357) [-431.660] (-433.134) * (-434.479) (-432.503) [-433.950] (-431.188) -- 0:00:27
523500 -- [-431.496] (-435.616) (-431.800) (-431.604) * (-432.067) (-431.650) (-432.122) [-432.815] -- 0:00:27
524000 -- (-433.791) [-430.633] (-431.065) (-437.701) * [-433.755] (-432.441) (-434.122) (-432.107) -- 0:00:27
524500 -- (-432.856) (-432.339) (-431.361) [-432.074] * [-433.691] (-431.031) (-434.393) (-431.793) -- 0:00:27
525000 -- (-432.245) (-431.839) (-433.241) [-437.485] * [-430.756] (-431.379) (-432.354) (-431.389) -- 0:00:27
Average standard deviation of split frequencies: 0.006722
525500 -- (-430.126) (-430.534) (-432.464) [-431.357] * [-431.026] (-431.095) (-434.843) (-431.315) -- 0:00:27
526000 -- [-430.700] (-432.480) (-434.405) (-431.083) * (-430.202) (-437.565) (-430.061) [-431.561] -- 0:00:27
526500 -- (-430.385) (-434.838) [-431.419] (-433.310) * [-432.623] (-432.486) (-432.665) (-434.518) -- 0:00:26
527000 -- (-432.334) (-432.149) (-430.253) [-432.645] * [-433.852] (-431.078) (-435.242) (-430.136) -- 0:00:26
527500 -- (-431.975) [-432.412] (-431.082) (-435.990) * (-437.450) (-434.285) [-434.304] (-431.240) -- 0:00:26
528000 -- (-434.877) (-431.258) (-433.825) [-432.762] * (-435.937) [-432.736] (-433.293) (-435.350) -- 0:00:26
528500 -- (-433.645) [-431.686] (-430.953) (-431.770) * (-433.885) (-438.433) (-432.541) [-431.963] -- 0:00:27
529000 -- (-431.714) (-432.966) (-431.386) [-431.301] * [-432.803] (-433.944) (-435.568) (-434.125) -- 0:00:27
529500 -- (-432.831) (-432.802) (-432.886) [-430.440] * (-431.526) (-431.790) (-431.926) [-433.268] -- 0:00:27
530000 -- [-431.808] (-430.486) (-432.383) (-431.838) * [-431.468] (-431.923) (-432.306) (-432.718) -- 0:00:27
Average standard deviation of split frequencies: 0.006940
530500 -- [-433.271] (-431.992) (-432.960) (-430.760) * (-433.241) [-431.061] (-430.668) (-431.998) -- 0:00:27
531000 -- [-431.786] (-431.301) (-435.332) (-432.165) * (-434.805) [-431.465] (-434.794) (-432.778) -- 0:00:27
531500 -- [-430.987] (-439.422) (-434.680) (-430.770) * [-431.610] (-433.486) (-432.864) (-434.835) -- 0:00:27
532000 -- (-429.904) (-431.681) [-431.416] (-435.147) * (-434.175) [-431.264] (-430.939) (-430.310) -- 0:00:27
532500 -- (-433.688) (-436.629) (-430.861) [-435.790] * [-432.809] (-433.996) (-436.501) (-434.601) -- 0:00:27
533000 -- [-431.696] (-436.195) (-434.969) (-431.968) * (-432.808) (-430.342) (-430.414) [-430.449] -- 0:00:27
533500 -- [-429.857] (-435.341) (-437.887) (-433.315) * (-432.119) (-429.977) [-430.601] (-430.962) -- 0:00:27
534000 -- [-429.820] (-431.671) (-433.738) (-430.464) * [-432.618] (-430.684) (-430.657) (-434.009) -- 0:00:27
534500 -- [-430.485] (-431.253) (-430.873) (-435.546) * [-437.819] (-431.468) (-434.127) (-430.821) -- 0:00:26
535000 -- [-432.367] (-434.217) (-435.531) (-433.248) * (-433.008) [-433.033] (-433.194) (-431.500) -- 0:00:26
Average standard deviation of split frequencies: 0.007696
535500 -- (-432.592) [-434.672] (-431.358) (-436.596) * [-430.221] (-433.505) (-431.024) (-431.668) -- 0:00:26
536000 -- (-430.041) (-431.594) [-430.640] (-431.745) * (-431.524) (-430.827) [-432.833] (-431.087) -- 0:00:26
536500 -- [-433.732] (-431.173) (-431.380) (-432.851) * (-435.080) [-433.088] (-432.388) (-436.648) -- 0:00:26
537000 -- (-430.862) (-433.178) (-432.020) [-431.275] * [-431.475] (-430.780) (-431.453) (-431.153) -- 0:00:26
537500 -- [-431.949] (-433.603) (-431.405) (-436.632) * (-435.169) (-432.614) (-431.109) [-431.885] -- 0:00:26
538000 -- (-433.809) (-430.304) [-430.587] (-433.362) * (-432.085) (-434.132) (-431.308) [-432.308] -- 0:00:26
538500 -- [-432.209] (-433.532) (-430.879) (-431.209) * [-430.327] (-431.164) (-436.604) (-434.406) -- 0:00:26
539000 -- (-434.793) (-431.470) (-432.122) [-432.069] * (-434.291) (-433.216) [-434.787] (-439.943) -- 0:00:26
539500 -- [-432.814] (-431.105) (-433.007) (-432.474) * [-432.412] (-432.369) (-432.542) (-435.167) -- 0:00:26
540000 -- (-442.159) (-430.520) (-434.174) [-431.578] * (-432.131) [-432.630] (-432.649) (-437.130) -- 0:00:26
Average standard deviation of split frequencies: 0.007575
540500 -- (-435.907) [-432.685] (-432.059) (-432.291) * (-434.413) [-431.018] (-430.754) (-433.089) -- 0:00:26
541000 -- [-431.059] (-432.634) (-433.246) (-431.848) * (-435.331) (-433.829) [-431.804] (-430.514) -- 0:00:26
541500 -- (-432.120) (-431.771) (-431.683) [-431.643] * (-431.787) (-431.631) [-431.186] (-434.976) -- 0:00:26
542000 -- (-431.258) [-430.783] (-432.703) (-432.024) * (-433.306) (-434.803) [-430.690] (-432.644) -- 0:00:26
542500 -- (-432.942) (-430.502) (-433.862) [-431.503] * (-432.438) (-430.728) (-431.482) [-431.091] -- 0:00:26
543000 -- (-433.982) (-430.885) (-431.823) [-430.922] * (-434.304) (-433.841) (-434.247) [-432.324] -- 0:00:26
543500 -- (-433.941) (-433.160) [-431.847] (-430.586) * [-430.671] (-433.424) (-432.973) (-434.425) -- 0:00:26
544000 -- (-431.981) [-431.014] (-432.420) (-432.239) * [-435.725] (-431.417) (-431.440) (-436.375) -- 0:00:25
544500 -- (-431.372) (-440.866) (-431.550) [-432.730] * (-435.513) (-432.340) (-434.907) [-431.177] -- 0:00:25
545000 -- (-436.434) (-432.943) (-436.783) [-431.911] * [-433.029] (-433.156) (-432.312) (-430.281) -- 0:00:25
Average standard deviation of split frequencies: 0.008288
545500 -- [-431.664] (-431.734) (-432.955) (-433.297) * [-432.788] (-432.274) (-432.771) (-432.233) -- 0:00:26
546000 -- [-430.556] (-435.027) (-430.663) (-433.232) * [-431.286] (-432.750) (-431.953) (-435.393) -- 0:00:26
546500 -- (-430.753) (-433.470) (-431.006) [-431.077] * (-432.187) (-432.739) (-435.810) [-432.461] -- 0:00:26
547000 -- (-434.886) (-432.085) [-432.334] (-432.037) * (-432.221) [-433.643] (-432.388) (-432.946) -- 0:00:26
547500 -- [-433.329] (-433.768) (-432.618) (-432.580) * (-435.105) (-431.730) [-432.784] (-434.444) -- 0:00:26
548000 -- [-431.412] (-434.941) (-430.542) (-437.553) * (-436.497) (-431.604) (-434.336) [-433.409] -- 0:00:26
548500 -- (-430.359) (-433.769) (-436.380) [-432.585] * (-435.286) (-430.422) (-431.709) [-433.231] -- 0:00:26
549000 -- (-431.443) (-432.638) [-430.527] (-432.881) * [-437.369] (-430.927) (-431.070) (-436.677) -- 0:00:26
549500 -- [-432.542] (-431.965) (-430.890) (-433.614) * (-440.184) [-433.165] (-431.713) (-432.666) -- 0:00:26
550000 -- [-430.830] (-434.126) (-431.317) (-432.624) * [-432.639] (-434.622) (-432.586) (-431.843) -- 0:00:26
Average standard deviation of split frequencies: 0.008960
550500 -- (-431.133) (-432.788) [-430.218] (-431.495) * [-430.263] (-433.450) (-431.107) (-433.612) -- 0:00:26
551000 -- (-434.070) (-433.049) (-431.253) [-430.708] * (-431.776) [-432.543] (-431.023) (-434.013) -- 0:00:26
551500 -- (-435.936) (-430.205) [-435.004] (-433.520) * [-432.720] (-430.767) (-433.784) (-440.563) -- 0:00:26
552000 -- (-432.389) (-437.242) [-437.551] (-432.117) * [-436.341] (-431.284) (-432.679) (-437.061) -- 0:00:25
552500 -- (-432.550) (-432.829) [-434.626] (-432.157) * [-431.771] (-431.185) (-431.667) (-432.753) -- 0:00:25
553000 -- (-434.402) (-431.979) (-435.403) [-430.877] * (-431.745) (-434.707) [-431.368] (-432.457) -- 0:00:25
553500 -- (-436.997) (-431.348) [-430.581] (-431.650) * (-430.103) (-436.550) [-430.539] (-435.536) -- 0:00:25
554000 -- [-432.401] (-431.647) (-434.659) (-433.238) * (-430.357) (-434.476) [-431.815] (-434.236) -- 0:00:25
554500 -- (-431.552) (-434.011) [-430.823] (-431.238) * (-434.992) [-430.954] (-431.881) (-431.547) -- 0:00:25
555000 -- (-434.303) (-431.631) (-431.863) [-431.776] * (-435.172) (-432.181) [-432.518] (-433.212) -- 0:00:25
Average standard deviation of split frequencies: 0.009044
555500 -- (-437.225) [-432.572] (-431.724) (-431.386) * [-433.561] (-434.891) (-431.464) (-432.505) -- 0:00:25
556000 -- (-431.911) (-435.481) (-431.684) [-431.153] * (-434.407) [-433.024] (-433.900) (-433.266) -- 0:00:25
556500 -- (-431.751) (-432.566) (-430.910) [-430.582] * (-434.740) [-431.986] (-435.858) (-431.014) -- 0:00:25
557000 -- (-431.745) [-432.609] (-432.427) (-433.119) * [-433.556] (-436.156) (-433.681) (-431.800) -- 0:00:25
557500 -- (-432.684) (-431.930) (-430.183) [-431.016] * [-430.630] (-432.593) (-433.112) (-431.027) -- 0:00:25
558000 -- (-431.139) [-432.674] (-432.002) (-432.221) * (-431.260) [-434.020] (-432.365) (-434.695) -- 0:00:25
558500 -- (-430.498) [-431.807] (-433.826) (-432.976) * (-433.637) [-435.134] (-436.502) (-433.175) -- 0:00:25
559000 -- [-432.077] (-431.375) (-433.497) (-431.482) * (-433.167) [-434.142] (-439.790) (-432.666) -- 0:00:25
559500 -- (-431.895) (-430.613) (-432.913) [-431.887] * [-432.556] (-434.557) (-433.099) (-433.287) -- 0:00:25
560000 -- (-432.981) (-433.962) (-432.939) [-430.974] * (-431.016) (-430.629) (-431.983) [-431.773] -- 0:00:25
Average standard deviation of split frequencies: 0.008800
560500 -- (-431.526) [-431.252] (-431.826) (-431.379) * (-435.118) (-431.029) (-430.676) [-431.311] -- 0:00:25
561000 -- [-431.036] (-433.365) (-431.791) (-430.918) * (-433.973) (-432.654) (-434.636) [-431.817] -- 0:00:25
561500 -- (-435.344) [-431.332] (-430.970) (-430.750) * (-432.134) (-434.942) (-434.403) [-430.937] -- 0:00:24
562000 -- (-431.027) [-433.415] (-434.608) (-430.945) * (-432.172) [-432.889] (-432.751) (-432.106) -- 0:00:24
562500 -- (-432.375) (-430.347) [-431.148] (-432.672) * (-431.044) (-433.245) [-431.826] (-431.767) -- 0:00:24
563000 -- [-431.146] (-433.938) (-431.225) (-436.623) * (-434.804) [-432.585] (-432.603) (-432.781) -- 0:00:25
563500 -- (-430.464) [-431.781] (-437.397) (-432.287) * [-431.715] (-430.673) (-433.932) (-431.468) -- 0:00:25
564000 -- (-430.454) [-430.880] (-438.554) (-430.482) * (-432.193) (-431.966) [-431.360] (-433.097) -- 0:00:25
564500 -- (-431.899) (-432.884) [-434.257] (-431.044) * (-433.004) [-431.872] (-433.131) (-434.447) -- 0:00:25
565000 -- [-436.173] (-431.661) (-432.837) (-432.078) * [-433.298] (-432.736) (-431.391) (-433.999) -- 0:00:25
Average standard deviation of split frequencies: 0.008773
565500 -- (-433.727) (-433.550) (-432.147) [-433.824] * [-435.070] (-430.331) (-431.513) (-433.022) -- 0:00:25
566000 -- (-430.798) (-433.118) (-434.827) [-432.166] * (-432.798) (-432.554) [-432.509] (-431.125) -- 0:00:25
566500 -- (-431.305) (-432.355) (-433.921) [-432.162] * (-434.146) (-431.558) (-434.895) [-432.495] -- 0:00:25
567000 -- (-432.628) (-434.607) [-432.122] (-435.841) * (-434.087) (-430.722) (-434.540) [-430.883] -- 0:00:25
567500 -- [-432.175] (-430.210) (-431.471) (-432.312) * [-435.538] (-430.890) (-431.304) (-430.322) -- 0:00:25
568000 -- (-433.423) (-431.278) (-434.970) [-430.572] * (-434.579) [-432.796] (-432.324) (-431.015) -- 0:00:25
568500 -- (-430.727) [-430.194] (-434.387) (-431.865) * (-432.528) (-434.535) (-431.160) [-435.161] -- 0:00:25
569000 -- (-431.673) [-431.037] (-437.626) (-431.416) * (-432.374) [-434.901] (-432.922) (-434.115) -- 0:00:24
569500 -- [-433.167] (-430.314) (-436.273) (-432.721) * (-432.477) [-431.757] (-431.329) (-434.490) -- 0:00:24
570000 -- (-432.288) [-431.056] (-433.561) (-439.633) * (-432.219) [-432.479] (-431.182) (-431.146) -- 0:00:24
Average standard deviation of split frequencies: 0.008646
570500 -- (-433.471) (-433.861) (-436.520) [-433.485] * (-430.051) (-433.648) [-430.497] (-434.534) -- 0:00:24
571000 -- (-432.086) [-431.761] (-429.953) (-435.615) * [-430.210] (-430.929) (-438.316) (-435.519) -- 0:00:24
571500 -- (-430.451) (-433.580) (-430.220) [-431.465] * (-432.546) [-432.200] (-435.777) (-433.063) -- 0:00:24
572000 -- [-429.916] (-440.248) (-431.798) (-431.321) * [-431.730] (-431.112) (-432.029) (-434.506) -- 0:00:24
572500 -- (-431.386) (-430.699) [-432.024] (-433.349) * [-431.091] (-432.520) (-432.412) (-434.504) -- 0:00:24
573000 -- (-431.499) [-431.034] (-430.508) (-432.979) * (-433.111) (-434.464) (-431.299) [-433.423] -- 0:00:24
573500 -- (-432.555) (-432.997) (-432.872) [-433.667] * (-434.675) [-433.998] (-430.301) (-433.294) -- 0:00:24
574000 -- (-430.321) [-433.026] (-435.609) (-431.895) * (-433.828) (-431.986) (-434.439) [-435.914] -- 0:00:24
574500 -- [-431.406] (-434.052) (-430.679) (-431.188) * [-435.792] (-432.021) (-434.110) (-431.757) -- 0:00:24
575000 -- (-432.617) (-431.028) [-433.610] (-431.523) * (-433.657) (-432.623) (-432.532) [-431.072] -- 0:00:24
Average standard deviation of split frequencies: 0.008948
575500 -- (-439.439) (-430.904) (-430.473) [-431.992] * (-431.050) (-432.174) [-432.146] (-431.515) -- 0:00:24
576000 -- [-431.729] (-434.062) (-430.306) (-431.853) * (-434.625) [-435.758] (-430.888) (-431.737) -- 0:00:24
576500 -- (-432.605) (-430.541) [-430.367] (-432.556) * (-433.908) [-430.623] (-437.114) (-431.314) -- 0:00:24
577000 -- (-431.143) (-432.474) [-433.344] (-436.881) * (-433.204) (-433.866) (-433.267) [-430.874] -- 0:00:24
577500 -- (-434.373) (-434.729) [-432.462] (-433.569) * (-430.863) (-433.853) [-431.891] (-434.814) -- 0:00:24
578000 -- (-430.158) (-436.889) [-431.687] (-435.062) * (-432.705) (-435.642) [-433.967] (-430.872) -- 0:00:24
578500 -- (-433.827) (-432.357) (-431.902) [-431.353] * (-431.854) (-434.773) [-431.587] (-431.130) -- 0:00:24
579000 -- (-431.941) (-434.813) (-434.838) [-436.141] * (-430.519) [-432.688] (-433.744) (-432.252) -- 0:00:23
579500 -- (-433.304) [-431.792] (-434.601) (-432.830) * (-432.949) (-432.076) [-430.931] (-432.845) -- 0:00:23
580000 -- (-430.940) (-438.824) (-437.141) [-431.531] * (-431.491) (-433.456) (-430.951) [-431.806] -- 0:00:24
Average standard deviation of split frequencies: 0.009634
580500 -- [-430.865] (-434.213) (-434.246) (-432.448) * (-432.894) (-434.159) (-431.832) [-431.199] -- 0:00:24
581000 -- (-432.311) (-431.217) [-433.180] (-432.081) * (-433.848) (-432.192) [-432.512] (-434.290) -- 0:00:24
581500 -- (-430.781) (-430.761) (-432.129) [-432.638] * [-430.313] (-432.443) (-432.627) (-435.881) -- 0:00:24
582000 -- (-434.654) [-432.853] (-432.564) (-434.042) * (-433.302) (-432.523) [-432.106] (-434.524) -- 0:00:24
582500 -- [-434.197] (-430.495) (-432.699) (-433.434) * (-437.671) (-432.185) (-431.588) [-431.105] -- 0:00:24
583000 -- (-433.717) (-435.386) (-431.319) [-431.303] * (-433.164) [-430.990] (-432.381) (-432.102) -- 0:00:24
583500 -- [-432.192] (-435.599) (-430.263) (-436.060) * (-431.610) (-432.103) [-433.043] (-431.580) -- 0:00:24
584000 -- (-432.234) (-432.071) (-430.457) [-432.091] * (-432.110) (-436.292) (-432.440) [-431.928] -- 0:00:24
584500 -- (-433.522) (-432.968) [-435.662] (-431.478) * (-431.213) (-433.151) [-431.434] (-431.240) -- 0:00:24
585000 -- (-432.658) [-431.153] (-440.957) (-434.723) * (-431.746) (-430.584) [-432.084] (-434.405) -- 0:00:24
Average standard deviation of split frequencies: 0.009278
585500 -- (-432.287) (-431.475) (-431.727) [-430.823] * [-432.697] (-432.520) (-432.483) (-432.806) -- 0:00:24
586000 -- (-432.853) (-433.362) [-432.184] (-433.183) * (-435.823) (-435.269) (-435.561) [-433.263] -- 0:00:24
586500 -- (-432.029) [-433.152] (-434.367) (-433.052) * (-434.071) (-430.148) (-433.694) [-432.225] -- 0:00:23
587000 -- (-433.422) (-431.268) [-433.154] (-435.751) * (-434.541) [-430.707] (-430.514) (-434.725) -- 0:00:23
587500 -- (-433.481) [-431.372] (-430.806) (-436.575) * (-432.353) (-431.219) (-432.949) [-432.305] -- 0:00:23
588000 -- (-432.108) (-434.612) [-432.095] (-430.458) * (-436.417) (-435.868) [-431.269] (-434.754) -- 0:00:23
588500 -- (-431.808) (-430.602) [-432.452] (-431.278) * (-433.408) [-431.542] (-432.463) (-430.435) -- 0:00:23
589000 -- (-430.857) (-432.715) (-433.176) [-433.429] * (-430.876) (-433.361) [-430.631] (-430.771) -- 0:00:23
589500 -- [-430.831] (-434.153) (-432.479) (-433.821) * [-435.340] (-435.563) (-432.409) (-431.277) -- 0:00:23
590000 -- [-432.256] (-431.488) (-434.307) (-432.773) * (-430.122) (-431.987) [-430.291] (-433.086) -- 0:00:23
Average standard deviation of split frequencies: 0.008832
590500 -- [-432.113] (-431.777) (-431.925) (-431.255) * (-430.814) (-431.947) (-430.332) [-431.376] -- 0:00:23
591000 -- [-433.065] (-431.245) (-432.499) (-433.856) * (-434.224) [-432.772] (-431.914) (-430.341) -- 0:00:23
591500 -- (-433.121) [-430.043] (-432.961) (-430.578) * (-434.168) (-431.258) [-432.280] (-434.349) -- 0:00:23
592000 -- (-432.342) (-430.461) (-432.987) [-431.636] * (-431.847) (-434.674) (-430.750) [-430.835] -- 0:00:23
592500 -- (-431.560) [-431.862] (-436.891) (-431.221) * (-431.387) (-435.655) (-433.156) [-430.289] -- 0:00:23
593000 -- (-433.628) (-439.621) [-430.847] (-431.292) * [-431.855] (-430.711) (-430.088) (-432.891) -- 0:00:23
593500 -- (-437.401) (-437.786) [-430.871] (-435.098) * (-432.247) (-429.998) [-435.902] (-430.733) -- 0:00:23
594000 -- (-431.776) (-432.324) (-430.755) [-430.826] * (-431.585) [-429.966] (-434.277) (-432.496) -- 0:00:23
594500 -- (-432.373) [-431.131] (-432.009) (-431.354) * (-433.507) (-430.911) (-432.678) [-430.245] -- 0:00:23
595000 -- [-431.837] (-433.388) (-433.366) (-434.415) * (-433.263) (-430.078) (-433.691) [-433.207] -- 0:00:23
Average standard deviation of split frequencies: 0.009333
595500 -- (-433.732) (-435.675) (-432.197) [-435.410] * [-431.402] (-430.998) (-430.236) (-434.919) -- 0:00:23
596000 -- (-431.382) [-430.617] (-431.612) (-431.044) * [-430.256] (-431.099) (-432.231) (-432.196) -- 0:00:23
596500 -- (-430.371) [-431.489] (-433.261) (-430.968) * (-431.187) (-431.480) [-430.775] (-431.513) -- 0:00:22
597000 -- [-431.565] (-433.790) (-432.589) (-432.579) * [-432.007] (-434.822) (-429.863) (-435.878) -- 0:00:22
597500 -- (-433.279) (-431.594) (-430.355) [-430.994] * (-433.713) (-432.419) [-429.861] (-432.452) -- 0:00:23
598000 -- (-435.136) (-432.844) (-433.188) [-430.032] * (-430.873) (-435.223) (-433.359) [-431.204] -- 0:00:23
598500 -- [-434.798] (-432.092) (-432.436) (-433.434) * [-432.326] (-434.642) (-431.560) (-430.260) -- 0:00:23
599000 -- (-434.842) (-433.007) [-434.229] (-431.505) * (-430.908) (-433.268) (-433.164) [-431.349] -- 0:00:23
599500 -- (-431.267) (-431.647) (-433.863) [-431.128] * (-432.520) (-431.224) (-431.748) [-430.703] -- 0:00:23
600000 -- (-431.308) [-430.709] (-432.760) (-433.462) * [-430.502] (-435.160) (-432.644) (-433.452) -- 0:00:23
Average standard deviation of split frequencies: 0.008581
600500 -- (-436.726) [-430.085] (-432.066) (-435.361) * (-432.204) (-433.615) [-431.136] (-432.045) -- 0:00:23
601000 -- (-434.656) (-432.016) [-432.354] (-430.573) * (-431.856) (-434.789) (-432.118) [-433.032] -- 0:00:23
601500 -- (-430.680) (-431.745) (-430.507) [-431.334] * [-431.516] (-434.068) (-432.108) (-431.277) -- 0:00:23
602000 -- (-430.347) (-432.711) [-432.162] (-432.575) * (-432.648) [-431.578] (-430.203) (-431.155) -- 0:00:23
602500 -- (-431.837) (-435.019) [-431.116] (-432.452) * (-431.674) (-430.225) (-432.515) [-430.362] -- 0:00:23
603000 -- [-430.650] (-432.185) (-431.741) (-430.706) * (-431.539) [-430.345] (-432.243) (-432.351) -- 0:00:23
603500 -- (-431.070) [-430.890] (-435.746) (-434.206) * [-430.928] (-430.298) (-436.325) (-433.539) -- 0:00:22
604000 -- (-430.629) (-431.369) [-434.936] (-439.005) * (-430.536) (-435.319) (-434.448) [-430.908] -- 0:00:22
604500 -- (-431.387) [-430.515] (-435.502) (-435.072) * [-430.913] (-431.699) (-433.265) (-430.342) -- 0:00:22
605000 -- (-442.119) (-431.974) (-431.939) [-431.160] * (-432.842) [-431.068] (-430.890) (-433.146) -- 0:00:22
Average standard deviation of split frequencies: 0.007986
605500 -- (-430.209) (-432.224) (-431.076) [-430.892] * (-431.276) (-430.040) (-436.384) [-433.007] -- 0:00:22
606000 -- [-432.607] (-432.426) (-431.465) (-438.122) * (-431.321) [-430.607] (-431.487) (-435.305) -- 0:00:22
606500 -- (-433.706) [-430.212] (-430.674) (-434.786) * (-431.459) [-430.824] (-432.632) (-432.286) -- 0:00:22
607000 -- [-435.406] (-431.375) (-432.075) (-433.021) * [-432.148] (-431.990) (-431.927) (-432.933) -- 0:00:22
607500 -- (-434.435) (-433.143) [-430.616] (-433.874) * [-434.494] (-433.966) (-431.834) (-431.057) -- 0:00:22
608000 -- (-434.481) (-433.020) [-430.536] (-435.480) * (-431.608) (-432.292) (-432.570) [-435.034] -- 0:00:22
608500 -- (-437.528) (-430.783) (-432.680) [-433.338] * (-434.470) (-432.752) [-431.650] (-432.980) -- 0:00:22
609000 -- (-437.868) (-431.044) [-431.107] (-432.987) * (-433.103) (-432.191) [-431.178] (-432.119) -- 0:00:22
609500 -- (-437.047) (-436.721) [-432.799] (-432.715) * (-433.870) [-430.251] (-431.219) (-430.799) -- 0:00:22
610000 -- (-430.851) (-431.928) (-432.440) [-437.969] * [-431.463] (-430.400) (-431.249) (-435.791) -- 0:00:22
Average standard deviation of split frequencies: 0.007411
610500 -- (-431.268) [-432.123] (-431.820) (-435.931) * (-430.711) [-431.090] (-432.641) (-430.056) -- 0:00:22
611000 -- (-434.808) [-431.505] (-430.409) (-434.500) * (-434.103) [-430.982] (-431.918) (-431.781) -- 0:00:22
611500 -- (-433.091) (-430.217) [-430.766] (-434.637) * [-430.962] (-431.787) (-430.943) (-430.289) -- 0:00:22
612000 -- (-432.633) [-434.842] (-432.814) (-433.050) * (-432.447) [-431.616] (-433.072) (-434.033) -- 0:00:22
612500 -- (-431.091) (-432.906) (-435.790) [-434.043] * [-430.439] (-433.172) (-433.243) (-432.778) -- 0:00:22
613000 -- (-436.141) [-431.019] (-436.224) (-435.850) * (-430.611) [-430.942] (-431.542) (-430.551) -- 0:00:22
613500 -- [-431.369] (-436.241) (-432.084) (-432.303) * (-432.792) [-431.429] (-435.520) (-430.697) -- 0:00:22
614000 -- (-432.818) (-432.186) [-430.617] (-436.066) * [-431.922] (-431.985) (-432.758) (-431.399) -- 0:00:22
614500 -- (-432.210) (-435.397) [-430.873] (-431.424) * (-432.413) (-432.421) (-432.653) [-434.366] -- 0:00:22
615000 -- (-431.665) (-438.072) (-430.950) [-433.084] * [-433.685] (-433.020) (-430.475) (-434.700) -- 0:00:22
Average standard deviation of split frequencies: 0.007222
615500 -- (-432.015) (-430.193) (-433.043) [-431.009] * (-432.903) [-433.637] (-430.647) (-433.060) -- 0:00:22
616000 -- [-431.818] (-430.161) (-431.932) (-435.890) * (-432.597) [-431.283] (-432.536) (-430.794) -- 0:00:22
616500 -- (-432.694) [-430.186] (-431.306) (-433.215) * [-432.429] (-431.692) (-430.512) (-431.565) -- 0:00:22
617000 -- (-434.821) (-431.353) (-432.686) [-431.715] * (-430.219) [-433.358] (-436.243) (-430.493) -- 0:00:22
617500 -- [-430.279] (-430.257) (-435.817) (-434.183) * (-432.567) [-431.468] (-430.952) (-430.398) -- 0:00:22
618000 -- (-436.312) (-432.779) [-432.764] (-434.225) * [-432.110] (-433.340) (-432.738) (-431.284) -- 0:00:22
618500 -- (-431.004) (-432.960) (-434.462) [-432.805] * (-436.113) (-431.322) [-430.228] (-431.855) -- 0:00:22
619000 -- (-431.366) (-435.479) (-431.492) [-432.672] * [-431.144] (-431.272) (-432.508) (-435.416) -- 0:00:22
619500 -- (-432.749) (-436.370) [-430.744] (-432.805) * (-431.230) [-430.663] (-430.286) (-431.164) -- 0:00:22
620000 -- (-432.214) (-431.653) [-434.063] (-431.212) * (-430.292) [-433.093] (-431.425) (-429.875) -- 0:00:22
Average standard deviation of split frequencies: 0.006836
620500 -- (-431.204) (-433.098) [-430.482] (-431.249) * [-430.381] (-432.371) (-430.557) (-431.916) -- 0:00:22
621000 -- (-432.636) [-430.132] (-431.438) (-433.254) * [-434.709] (-430.795) (-431.550) (-431.653) -- 0:00:21
621500 -- (-434.017) (-430.163) (-430.754) [-433.940] * (-431.730) (-432.452) (-431.125) [-431.846] -- 0:00:21
622000 -- (-431.523) [-432.347] (-432.783) (-435.713) * [-430.363] (-432.967) (-431.671) (-433.772) -- 0:00:21
622500 -- (-432.773) [-434.440] (-431.749) (-433.492) * (-433.923) [-431.701] (-431.930) (-431.936) -- 0:00:21
623000 -- [-430.313] (-430.854) (-435.925) (-430.870) * (-433.336) (-434.400) (-431.971) [-433.969] -- 0:00:21
623500 -- [-430.028] (-434.141) (-431.344) (-430.452) * (-431.590) [-433.558] (-432.788) (-434.409) -- 0:00:21
624000 -- (-431.849) (-434.286) [-431.630] (-431.600) * (-432.345) [-433.292] (-433.374) (-433.327) -- 0:00:21
624500 -- (-430.739) [-431.679] (-432.382) (-433.911) * (-433.068) (-433.003) (-434.151) [-433.819] -- 0:00:21
625000 -- (-431.798) (-436.879) (-434.135) [-431.311] * (-434.395) (-432.251) (-431.393) [-433.403] -- 0:00:21
Average standard deviation of split frequencies: 0.007201
625500 -- (-431.862) [-432.857] (-432.747) (-430.377) * (-431.676) (-431.353) [-430.908] (-432.435) -- 0:00:21
626000 -- (-431.724) (-431.727) (-431.680) [-431.758] * [-431.137] (-433.596) (-430.794) (-431.706) -- 0:00:21
626500 -- (-432.675) (-432.192) (-431.309) [-432.927] * (-433.288) (-433.195) (-430.598) [-432.791] -- 0:00:21
627000 -- (-434.338) (-430.348) (-434.525) [-430.741] * [-433.324] (-434.262) (-436.679) (-431.633) -- 0:00:21
627500 -- [-430.967] (-431.373) (-430.485) (-431.612) * (-430.899) (-433.180) [-432.807] (-433.043) -- 0:00:21
628000 -- (-431.345) [-430.129] (-433.653) (-431.475) * (-435.656) (-431.734) (-432.693) [-430.689] -- 0:00:21
628500 -- [-431.996] (-438.148) (-433.664) (-430.177) * (-432.589) (-431.839) (-433.392) [-431.919] -- 0:00:21
629000 -- (-431.037) (-434.862) [-431.206] (-430.442) * (-430.916) (-432.835) [-436.398] (-435.173) -- 0:00:21
629500 -- [-434.342] (-433.920) (-432.872) (-434.235) * (-436.728) (-431.598) [-435.109] (-431.055) -- 0:00:21
630000 -- (-434.743) (-432.794) [-430.781] (-433.775) * (-434.737) (-431.301) (-432.367) [-430.977] -- 0:00:21
Average standard deviation of split frequencies: 0.007428
630500 -- [-435.609] (-431.571) (-430.869) (-432.750) * (-432.754) [-433.956] (-430.554) (-431.752) -- 0:00:21
631000 -- (-434.778) (-431.894) [-430.819] (-434.569) * [-431.431] (-431.858) (-432.002) (-432.911) -- 0:00:21
631500 -- (-431.495) (-430.299) (-432.067) [-433.398] * (-441.814) (-437.324) (-432.255) [-433.036] -- 0:00:21
632000 -- [-434.769] (-430.259) (-433.934) (-430.623) * (-437.881) [-431.010] (-434.573) (-430.743) -- 0:00:21
632500 -- [-430.587] (-430.021) (-432.311) (-436.675) * (-431.420) (-431.385) (-432.585) [-434.755] -- 0:00:21
633000 -- (-431.490) [-430.781] (-432.272) (-432.187) * (-437.319) [-432.199] (-433.307) (-434.744) -- 0:00:21
633500 -- (-431.786) (-436.763) (-430.702) [-433.875] * [-431.195] (-432.990) (-432.585) (-431.589) -- 0:00:21
634000 -- [-431.917] (-435.108) (-430.888) (-430.002) * (-431.772) [-431.002] (-432.211) (-431.319) -- 0:00:21
634500 -- [-435.767] (-431.558) (-431.754) (-430.331) * (-436.736) [-431.706] (-433.082) (-432.429) -- 0:00:21
635000 -- (-430.290) (-432.306) (-434.865) [-430.032] * (-433.569) (-431.332) [-431.039] (-436.615) -- 0:00:21
Average standard deviation of split frequencies: 0.007807
635500 -- (-430.207) (-431.427) (-435.385) [-430.658] * [-432.277] (-430.831) (-430.981) (-431.983) -- 0:00:21
636000 -- (-436.708) [-431.229] (-429.836) (-429.933) * [-431.189] (-431.507) (-434.082) (-430.366) -- 0:00:21
636500 -- (-432.253) (-431.662) [-430.311] (-435.875) * (-433.159) (-432.982) [-434.988] (-430.355) -- 0:00:21
637000 -- (-432.785) (-435.516) (-431.774) [-432.869] * (-430.633) (-432.511) [-434.591] (-432.297) -- 0:00:21
637500 -- (-432.856) (-433.344) [-430.867] (-433.371) * [-432.517] (-433.314) (-431.611) (-436.587) -- 0:00:21
638000 -- (-432.271) (-431.841) [-433.481] (-435.274) * (-431.239) [-430.609] (-430.901) (-431.208) -- 0:00:20
638500 -- [-433.221] (-432.973) (-431.731) (-432.621) * (-432.884) [-431.028] (-431.317) (-429.803) -- 0:00:20
639000 -- (-432.474) (-432.729) (-432.017) [-431.525] * (-432.861) [-432.114] (-431.235) (-431.080) -- 0:00:20
639500 -- (-434.421) (-433.733) (-434.085) [-434.399] * [-431.673] (-432.160) (-432.162) (-431.146) -- 0:00:20
640000 -- (-434.132) (-431.094) (-435.631) [-430.794] * (-432.013) (-432.508) [-430.782] (-432.708) -- 0:00:20
Average standard deviation of split frequencies: 0.008324
640500 -- (-431.095) (-432.549) (-432.200) [-431.944] * [-430.819] (-433.966) (-432.636) (-434.136) -- 0:00:20
641000 -- (-430.709) (-431.061) [-433.972] (-432.617) * (-432.263) (-433.337) (-434.821) [-430.146] -- 0:00:20
641500 -- (-430.941) [-430.440] (-434.948) (-430.820) * (-432.001) (-432.190) (-431.998) [-430.752] -- 0:00:20
642000 -- (-430.698) (-430.839) (-432.893) [-430.779] * (-433.369) [-433.207] (-435.467) (-432.454) -- 0:00:20
642500 -- (-435.154) (-431.978) (-432.733) [-432.162] * [-432.697] (-436.939) (-437.942) (-433.526) -- 0:00:20
643000 -- (-432.447) [-431.780] (-433.190) (-432.021) * [-430.753] (-432.218) (-436.566) (-434.259) -- 0:00:20
643500 -- (-431.390) [-430.632] (-431.872) (-433.881) * (-433.633) (-435.004) [-433.832] (-435.764) -- 0:00:20
644000 -- (-433.399) (-431.595) (-435.624) [-431.388] * (-430.689) [-430.742] (-430.412) (-432.201) -- 0:00:20
644500 -- (-438.397) (-431.689) [-432.444] (-430.248) * (-433.349) (-432.051) [-431.454] (-431.077) -- 0:00:20
645000 -- [-433.920] (-432.596) (-432.141) (-433.488) * (-431.676) (-436.492) [-430.230] (-431.077) -- 0:00:20
Average standard deviation of split frequencies: 0.007936
645500 -- [-431.954] (-433.100) (-435.064) (-435.044) * (-430.598) (-434.736) (-430.944) [-431.456] -- 0:00:20
646000 -- (-430.229) [-431.928] (-430.367) (-435.489) * (-432.772) (-430.740) (-430.582) [-431.335] -- 0:00:20
646500 -- (-431.258) (-432.366) [-431.353] (-434.634) * (-434.115) (-436.102) (-433.430) [-430.806] -- 0:00:20
647000 -- (-434.597) [-430.560] (-432.337) (-434.371) * (-432.266) (-436.195) (-432.204) [-435.230] -- 0:00:20
647500 -- (-435.013) (-431.942) (-433.068) [-433.971] * (-433.451) (-437.127) (-430.330) [-434.312] -- 0:00:20
648000 -- (-431.694) (-431.779) (-430.606) [-431.557] * (-433.848) (-436.191) (-432.661) [-432.685] -- 0:00:20
648500 -- [-432.087] (-434.889) (-433.066) (-431.488) * (-436.187) [-431.797] (-430.634) (-431.647) -- 0:00:20
649000 -- (-431.412) (-431.573) (-432.642) [-436.908] * (-434.274) (-433.136) [-431.607] (-431.499) -- 0:00:20
649500 -- (-434.647) [-433.772] (-433.148) (-435.852) * (-433.292) [-432.717] (-431.380) (-432.176) -- 0:00:20
650000 -- [-436.682] (-430.176) (-430.768) (-432.671) * [-434.996] (-430.615) (-431.752) (-430.740) -- 0:00:20
Average standard deviation of split frequencies: 0.007969
650500 -- [-431.750] (-431.187) (-430.174) (-432.549) * (-439.739) (-431.385) (-431.994) [-431.044] -- 0:00:20
651000 -- [-432.216] (-432.557) (-432.351) (-431.827) * (-432.509) (-434.930) [-433.520] (-431.061) -- 0:00:20
651500 -- (-431.453) (-431.547) [-432.009] (-435.041) * (-432.183) (-433.926) (-437.828) [-432.907] -- 0:00:20
652000 -- [-432.315] (-432.101) (-433.749) (-433.998) * [-432.793] (-430.224) (-432.772) (-433.726) -- 0:00:20
652500 -- (-432.926) (-430.505) [-431.794] (-431.954) * (-432.723) (-430.998) [-430.114] (-436.653) -- 0:00:20
653000 -- [-429.974] (-432.197) (-435.476) (-435.723) * (-433.072) (-432.931) (-429.971) [-432.282] -- 0:00:20
653500 -- (-432.183) [-433.159] (-432.275) (-431.483) * [-432.582] (-433.315) (-438.958) (-431.970) -- 0:00:20
654000 -- [-430.429] (-433.248) (-432.436) (-432.286) * [-431.733] (-434.529) (-431.653) (-431.518) -- 0:00:20
654500 -- (-431.195) (-431.096) (-433.915) [-430.680] * (-430.282) (-432.888) [-431.499] (-432.260) -- 0:00:20
655000 -- (-436.989) (-430.665) (-431.758) [-431.689] * (-430.399) [-432.515] (-431.865) (-432.475) -- 0:00:20
Average standard deviation of split frequencies: 0.008129
655500 -- (-432.454) (-431.273) (-431.305) [-432.407] * (-436.276) (-432.934) (-431.114) [-433.270] -- 0:00:19
656000 -- (-429.993) [-430.321] (-432.243) (-431.284) * (-434.275) [-431.478] (-430.890) (-430.948) -- 0:00:19
656500 -- (-431.082) [-430.721] (-432.207) (-431.415) * (-433.451) (-433.435) [-432.031] (-430.860) -- 0:00:19
657000 -- (-432.722) (-433.334) (-433.753) [-432.610] * (-435.080) (-432.384) [-431.599] (-436.222) -- 0:00:19
657500 -- (-433.645) (-432.205) (-432.184) [-432.014] * (-433.017) (-432.272) (-436.379) [-431.727] -- 0:00:19
658000 -- (-434.647) (-430.706) (-433.454) [-433.132] * (-431.015) (-433.581) [-434.400] (-434.671) -- 0:00:19
658500 -- (-431.330) (-430.752) [-433.638] (-431.107) * (-432.084) (-432.151) (-430.624) [-431.513] -- 0:00:19
659000 -- (-433.889) [-432.261] (-431.540) (-431.376) * [-432.004] (-430.651) (-433.111) (-432.886) -- 0:00:19
659500 -- (-433.734) (-431.346) (-433.269) [-430.528] * (-432.481) (-431.087) (-432.625) [-430.921] -- 0:00:19
660000 -- (-431.963) (-430.626) (-434.686) [-438.457] * (-433.228) [-432.689] (-431.225) (-430.935) -- 0:00:19
Average standard deviation of split frequencies: 0.007893
660500 -- (-431.336) (-430.643) [-430.258] (-434.053) * [-430.481] (-434.462) (-434.216) (-435.127) -- 0:00:19
661000 -- (-433.940) [-430.528] (-434.731) (-431.179) * (-431.906) (-431.437) (-432.853) [-430.576] -- 0:00:19
661500 -- (-434.780) (-431.225) [-436.109] (-430.115) * (-434.333) (-434.139) (-431.390) [-432.820] -- 0:00:19
662000 -- (-435.641) (-432.421) (-431.341) [-430.361] * (-430.625) (-431.997) [-430.778] (-433.819) -- 0:00:19
662500 -- (-431.043) (-432.358) (-430.179) [-431.905] * (-432.624) (-433.612) (-437.778) [-431.519] -- 0:00:19
663000 -- [-431.225] (-432.869) (-432.369) (-433.719) * [-431.155] (-435.910) (-433.960) (-431.133) -- 0:00:19
663500 -- (-431.831) (-432.185) (-431.914) [-432.493] * [-431.614] (-435.609) (-431.639) (-434.461) -- 0:00:19
664000 -- (-431.839) [-431.183] (-433.843) (-432.245) * (-432.829) (-431.427) (-433.085) [-431.653] -- 0:00:19
664500 -- [-431.923] (-432.862) (-435.114) (-437.986) * (-433.111) (-430.874) (-433.838) [-430.947] -- 0:00:19
665000 -- [-430.969] (-431.778) (-433.618) (-430.079) * (-431.529) [-430.016] (-430.586) (-431.119) -- 0:00:19
Average standard deviation of split frequencies: 0.008179
665500 -- [-431.360] (-431.459) (-434.072) (-431.982) * (-430.345) (-431.786) (-431.129) [-432.877] -- 0:00:19
666000 -- (-434.315) (-431.364) (-431.086) [-431.903] * [-430.513] (-430.116) (-431.077) (-431.867) -- 0:00:19
666500 -- (-433.747) [-431.350] (-431.396) (-431.241) * (-430.697) [-434.501] (-430.897) (-432.995) -- 0:00:19
667000 -- (-431.582) (-431.000) (-433.699) [-431.674] * (-435.093) (-430.565) (-432.566) [-430.464] -- 0:00:19
667500 -- (-437.317) (-431.119) (-432.224) [-430.746] * (-432.405) (-433.604) (-433.288) [-432.770] -- 0:00:19
668000 -- [-432.962] (-432.246) (-432.055) (-430.865) * (-430.417) (-431.181) (-434.526) [-432.682] -- 0:00:19
668500 -- (-435.537) (-432.344) (-432.349) [-430.170] * (-433.015) (-432.092) (-431.060) [-430.570] -- 0:00:19
669000 -- (-435.988) (-432.348) [-431.010] (-434.676) * (-434.379) (-433.257) (-435.844) [-431.110] -- 0:00:19
669500 -- [-431.427] (-434.085) (-432.717) (-433.731) * (-430.692) (-430.569) (-430.692) [-434.321] -- 0:00:19
670000 -- (-432.320) [-433.202] (-432.023) (-434.536) * (-434.045) [-432.351] (-432.101) (-431.842) -- 0:00:19
Average standard deviation of split frequencies: 0.008122
670500 -- (-431.427) [-431.818] (-436.339) (-434.464) * (-434.445) (-433.667) [-430.645] (-437.427) -- 0:00:19
671000 -- [-432.986] (-430.651) (-435.002) (-433.241) * (-431.057) (-436.911) (-434.437) [-431.308] -- 0:00:19
671500 -- (-432.192) (-432.755) [-431.137] (-432.734) * (-432.876) (-437.562) [-430.967] (-435.179) -- 0:00:19
672000 -- (-430.306) [-432.291] (-432.502) (-431.412) * (-436.437) (-435.236) [-430.416] (-434.044) -- 0:00:19
672500 -- (-430.176) [-430.651] (-435.769) (-434.809) * (-433.913) (-431.411) [-432.929] (-431.971) -- 0:00:18
673000 -- (-433.689) (-431.379) (-432.732) [-430.182] * (-431.422) (-433.450) (-437.158) [-433.903] -- 0:00:18
673500 -- (-433.324) (-433.761) [-434.981] (-434.726) * (-430.174) (-434.642) (-433.163) [-430.510] -- 0:00:18
674000 -- [-432.420] (-431.749) (-433.897) (-434.889) * (-431.953) (-431.451) [-431.358] (-431.904) -- 0:00:18
674500 -- (-434.289) [-430.838] (-433.256) (-433.685) * (-433.306) (-432.125) [-431.225] (-432.168) -- 0:00:18
675000 -- (-434.442) [-432.533] (-433.009) (-434.258) * (-434.714) (-434.259) (-430.752) [-433.233] -- 0:00:18
Average standard deviation of split frequencies: 0.007958
675500 -- (-433.738) [-432.275] (-432.397) (-432.456) * (-431.225) [-430.868] (-430.949) (-431.077) -- 0:00:18
676000 -- (-434.485) [-434.425] (-432.127) (-433.369) * (-431.851) [-433.513] (-431.247) (-433.574) -- 0:00:18
676500 -- (-431.968) [-431.343] (-431.945) (-433.230) * [-430.967] (-432.226) (-430.643) (-431.471) -- 0:00:18
677000 -- (-435.500) [-430.777] (-432.175) (-433.804) * (-433.874) (-431.557) (-431.411) [-432.473] -- 0:00:18
677500 -- [-433.973] (-432.206) (-431.545) (-431.609) * (-433.854) [-430.258] (-433.698) (-432.113) -- 0:00:18
678000 -- (-432.954) [-433.450] (-432.199) (-436.479) * (-430.038) [-431.810] (-431.693) (-433.437) -- 0:00:18
678500 -- (-430.758) (-434.165) [-434.783] (-432.639) * (-431.498) [-431.720] (-434.981) (-431.361) -- 0:00:18
679000 -- (-432.990) [-431.224] (-432.074) (-431.359) * (-432.966) [-433.111] (-431.910) (-433.979) -- 0:00:18
679500 -- (-433.245) (-431.713) [-434.936] (-432.901) * (-430.004) (-432.838) [-431.917] (-431.822) -- 0:00:18
680000 -- (-433.941) (-433.929) [-433.597] (-432.230) * (-432.722) (-433.649) [-432.221] (-432.225) -- 0:00:18
Average standard deviation of split frequencies: 0.007903
680500 -- (-435.025) (-430.934) (-433.443) [-430.650] * (-432.073) (-440.205) [-434.489] (-432.208) -- 0:00:18
681000 -- (-430.668) (-431.171) [-431.811] (-430.536) * [-430.937] (-432.835) (-435.009) (-433.940) -- 0:00:18
681500 -- (-431.437) [-430.191] (-434.310) (-434.742) * (-430.246) [-431.541] (-431.401) (-434.027) -- 0:00:18
682000 -- (-434.712) (-432.905) [-431.966] (-431.092) * [-434.747] (-432.644) (-435.783) (-435.180) -- 0:00:18
682500 -- [-432.265] (-438.707) (-432.743) (-431.638) * (-431.570) (-436.884) [-434.431] (-431.079) -- 0:00:18
683000 -- (-430.653) (-432.042) (-435.702) [-431.399] * (-432.002) [-433.321] (-432.145) (-434.138) -- 0:00:18
683500 -- (-430.424) (-431.308) (-434.054) [-433.124] * [-430.647] (-431.186) (-431.454) (-432.448) -- 0:00:18
684000 -- (-431.576) (-431.980) (-433.336) [-431.945] * (-430.716) (-430.801) [-433.046] (-431.829) -- 0:00:18
684500 -- (-431.534) (-434.452) (-435.112) [-430.707] * (-431.111) (-433.322) [-433.760] (-430.793) -- 0:00:18
685000 -- [-430.837] (-435.748) (-437.328) (-431.240) * (-430.772) (-434.529) (-431.863) [-431.449] -- 0:00:18
Average standard deviation of split frequencies: 0.007438
685500 -- (-431.165) (-430.589) [-432.463] (-434.473) * (-433.802) (-435.643) (-430.679) [-431.799] -- 0:00:18
686000 -- (-431.712) [-430.560] (-435.479) (-431.270) * (-434.937) (-433.649) (-430.073) [-431.275] -- 0:00:18
686500 -- (-432.326) [-433.241] (-440.490) (-432.014) * [-432.006] (-431.029) (-434.004) (-431.056) -- 0:00:18
687000 -- (-430.640) (-430.736) (-431.375) [-435.250] * (-433.267) (-430.532) [-431.927] (-432.358) -- 0:00:18
687500 -- (-431.103) (-432.035) [-432.195] (-435.396) * (-433.272) (-431.094) [-430.574] (-431.248) -- 0:00:18
688000 -- (-430.310) [-435.931] (-431.754) (-431.739) * (-431.318) (-437.332) (-430.425) [-435.502] -- 0:00:18
688500 -- (-432.590) (-433.766) [-430.962] (-434.366) * (-433.375) [-432.465] (-431.966) (-437.603) -- 0:00:18
689000 -- (-433.596) [-430.695] (-430.733) (-433.761) * (-434.528) [-430.671] (-430.974) (-435.886) -- 0:00:18
689500 -- [-430.756] (-431.751) (-433.265) (-434.052) * (-435.549) [-430.667] (-430.067) (-433.131) -- 0:00:18
690000 -- (-432.872) [-431.496] (-433.170) (-434.101) * (-430.371) [-432.776] (-433.145) (-432.157) -- 0:00:17
Average standard deviation of split frequencies: 0.007307
690500 -- (-431.469) (-430.401) (-432.970) [-431.571] * (-429.899) (-432.260) [-432.947] (-433.768) -- 0:00:17
691000 -- (-431.849) [-432.090] (-432.300) (-435.373) * (-430.819) (-432.696) [-433.225] (-431.384) -- 0:00:17
691500 -- (-431.015) (-437.249) [-432.465] (-431.525) * (-430.152) [-434.552] (-433.729) (-434.720) -- 0:00:17
692000 -- (-431.119) [-431.914] (-433.514) (-436.604) * [-431.487] (-432.894) (-433.680) (-431.084) -- 0:00:17
692500 -- (-430.874) (-431.251) [-431.672] (-431.513) * (-433.266) [-430.838] (-432.135) (-432.799) -- 0:00:17
693000 -- (-430.288) (-430.912) [-431.628] (-433.986) * (-430.535) (-431.552) [-434.290] (-431.122) -- 0:00:17
693500 -- [-431.852] (-434.029) (-430.684) (-432.786) * (-434.605) [-432.959] (-431.661) (-431.503) -- 0:00:17
694000 -- (-433.668) (-432.786) (-431.019) [-431.073] * (-434.953) [-431.599] (-433.497) (-431.546) -- 0:00:17
694500 -- [-432.033] (-432.262) (-434.193) (-436.870) * (-435.191) (-433.165) [-432.380] (-434.917) -- 0:00:17
695000 -- (-431.632) (-443.171) [-431.750] (-430.633) * (-433.507) (-431.369) [-433.096] (-434.961) -- 0:00:17
Average standard deviation of split frequencies: 0.007831
695500 -- (-431.358) (-431.459) [-430.961] (-432.024) * [-431.545] (-431.880) (-439.986) (-431.537) -- 0:00:17
696000 -- (-432.266) (-433.949) (-430.712) [-432.341] * (-436.480) (-437.562) [-430.844] (-430.858) -- 0:00:17
696500 -- (-433.000) (-430.421) [-432.484] (-432.249) * (-436.230) (-441.168) [-432.802] (-431.687) -- 0:00:17
697000 -- (-432.812) [-430.668] (-431.829) (-432.992) * (-431.274) (-431.911) (-431.448) [-432.591] -- 0:00:17
697500 -- [-431.962] (-431.745) (-431.748) (-431.230) * (-431.003) (-431.393) [-433.139] (-433.541) -- 0:00:17
698000 -- (-432.544) (-433.289) (-432.786) [-434.121] * (-436.142) (-432.070) (-432.381) [-431.475] -- 0:00:17
698500 -- (-431.063) (-430.113) [-432.368] (-435.967) * (-431.662) [-436.539] (-437.434) (-438.287) -- 0:00:17
699000 -- (-434.232) (-430.706) (-431.377) [-432.196] * (-436.887) (-431.474) (-434.054) [-431.963] -- 0:00:17
699500 -- [-432.705] (-432.841) (-432.303) (-431.947) * (-432.219) (-431.079) (-433.881) [-431.533] -- 0:00:17
700000 -- (-430.221) (-434.409) [-430.535] (-432.822) * (-432.764) [-431.214] (-431.853) (-431.540) -- 0:00:17
Average standard deviation of split frequencies: 0.008284
700500 -- (-432.627) (-432.563) [-434.377] (-435.000) * [-432.061] (-430.714) (-431.812) (-431.711) -- 0:00:17
701000 -- (-432.987) (-430.441) [-431.989] (-433.321) * [-430.448] (-433.032) (-431.903) (-432.900) -- 0:00:17
701500 -- (-434.053) [-432.320] (-432.447) (-432.242) * (-434.221) (-432.697) (-433.416) [-433.470] -- 0:00:17
702000 -- (-434.406) [-430.802] (-434.829) (-429.821) * (-432.131) [-432.277] (-433.167) (-433.868) -- 0:00:17
702500 -- [-431.829] (-431.358) (-432.460) (-431.404) * (-431.423) [-431.634] (-432.560) (-433.903) -- 0:00:17
703000 -- (-432.817) (-432.744) (-433.501) [-433.396] * [-433.344] (-429.787) (-430.940) (-431.297) -- 0:00:17
703500 -- (-430.740) (-432.136) (-431.246) [-432.210] * (-432.198) (-430.907) [-431.499] (-431.107) -- 0:00:17
704000 -- [-435.879] (-431.854) (-432.646) (-431.487) * (-433.024) (-436.520) [-430.435] (-436.913) -- 0:00:17
704500 -- (-431.168) (-430.465) [-436.816] (-434.271) * [-435.185] (-431.588) (-436.325) (-432.502) -- 0:00:17
705000 -- (-433.735) (-437.660) [-432.457] (-431.530) * [-431.839] (-431.886) (-431.706) (-432.855) -- 0:00:17
Average standard deviation of split frequencies: 0.008221
705500 -- (-431.803) [-431.516] (-433.079) (-432.886) * (-431.889) (-435.266) [-433.116] (-432.432) -- 0:00:17
706000 -- [-436.194] (-437.012) (-433.209) (-432.098) * (-431.618) (-430.953) (-431.458) [-432.017] -- 0:00:17
706500 -- (-431.902) [-434.599] (-433.655) (-431.565) * (-432.015) (-431.465) (-431.760) [-430.924] -- 0:00:17
707000 -- [-430.853] (-430.369) (-431.491) (-440.283) * (-433.967) [-431.485] (-431.859) (-431.536) -- 0:00:16
707500 -- (-433.674) [-429.910] (-431.470) (-432.661) * (-433.297) [-431.242] (-431.331) (-434.456) -- 0:00:16
708000 -- (-431.933) [-430.801] (-430.834) (-434.792) * [-434.381] (-432.493) (-436.364) (-434.475) -- 0:00:16
708500 -- [-435.463] (-432.498) (-431.178) (-431.307) * [-432.098] (-431.324) (-433.870) (-432.312) -- 0:00:16
709000 -- (-431.884) (-432.853) [-431.466] (-431.331) * (-431.932) [-430.755] (-431.999) (-431.077) -- 0:00:16
709500 -- [-430.642] (-434.732) (-430.934) (-432.121) * (-431.545) [-435.469] (-431.031) (-431.449) -- 0:00:16
710000 -- (-430.723) [-432.738] (-431.511) (-431.961) * [-431.679] (-435.091) (-432.100) (-431.791) -- 0:00:16
Average standard deviation of split frequencies: 0.008457
710500 -- [-430.464] (-438.831) (-431.362) (-431.838) * (-432.266) [-431.174] (-436.184) (-430.755) -- 0:00:16
711000 -- (-436.572) (-433.888) [-433.113] (-436.145) * (-431.742) (-430.515) (-433.989) [-430.713] -- 0:00:16
711500 -- (-435.939) (-435.442) [-430.485] (-432.781) * [-434.768] (-430.451) (-434.872) (-432.926) -- 0:00:16
712000 -- (-434.924) [-432.614] (-429.942) (-432.792) * (-432.986) [-433.658] (-434.342) (-434.902) -- 0:00:16
712500 -- (-431.907) (-433.728) [-431.762] (-430.543) * (-433.277) (-434.982) [-435.499] (-435.954) -- 0:00:16
713000 -- (-431.709) (-430.932) (-431.450) [-432.787] * (-432.929) (-432.848) [-430.653] (-433.038) -- 0:00:16
713500 -- [-431.114] (-430.955) (-431.930) (-435.138) * (-433.311) (-433.106) (-432.119) [-432.447] -- 0:00:16
714000 -- (-433.545) [-435.335] (-430.927) (-440.634) * (-432.880) (-434.342) [-431.476] (-432.311) -- 0:00:16
714500 -- (-432.845) (-432.937) [-430.898] (-433.911) * (-434.220) (-436.407) [-431.041] (-432.693) -- 0:00:16
715000 -- (-431.386) (-433.516) (-430.825) [-432.824] * [-432.158] (-441.119) (-431.694) (-432.239) -- 0:00:16
Average standard deviation of split frequencies: 0.008806
715500 -- (-433.346) [-431.986] (-431.120) (-433.797) * (-433.867) [-439.071] (-434.444) (-430.849) -- 0:00:16
716000 -- (-436.542) (-432.355) [-431.343] (-431.508) * (-431.628) (-432.145) [-431.561] (-431.876) -- 0:00:16
716500 -- (-433.761) (-431.630) (-430.576) [-431.265] * (-434.427) (-432.911) [-430.027] (-430.954) -- 0:00:16
717000 -- (-435.235) (-432.031) (-433.037) [-431.629] * [-433.934] (-433.280) (-429.987) (-430.156) -- 0:00:16
717500 -- (-439.909) (-433.308) (-431.960) [-431.562] * (-432.445) [-431.377] (-430.069) (-431.794) -- 0:00:16
718000 -- (-434.640) (-431.194) [-431.317] (-432.420) * (-431.873) (-431.926) [-434.682] (-434.230) -- 0:00:16
718500 -- (-430.634) [-430.481] (-433.410) (-432.646) * (-431.609) (-431.690) [-434.466] (-436.275) -- 0:00:16
719000 -- (-432.025) (-431.122) [-430.610] (-434.381) * (-432.111) [-430.444] (-433.279) (-430.670) -- 0:00:16
719500 -- (-432.330) (-431.194) (-430.610) [-433.217] * (-430.453) (-430.369) (-433.278) [-430.349] -- 0:00:16
720000 -- (-441.943) (-431.327) (-432.301) [-431.662] * (-433.286) (-431.792) (-431.796) [-431.582] -- 0:00:16
Average standard deviation of split frequencies: 0.008773
720500 -- [-431.981] (-431.001) (-433.342) (-430.984) * (-431.680) (-436.506) (-433.031) [-431.003] -- 0:00:16
721000 -- [-431.576] (-434.952) (-433.370) (-431.758) * (-430.769) [-432.241] (-431.861) (-433.583) -- 0:00:16
721500 -- (-433.751) (-434.405) (-432.058) [-433.860] * [-430.900] (-431.248) (-430.217) (-433.131) -- 0:00:16
722000 -- [-430.411] (-433.268) (-433.683) (-432.524) * (-430.378) (-431.104) [-431.201] (-434.135) -- 0:00:16
722500 -- (-430.703) (-430.938) [-431.887] (-432.064) * (-440.211) (-431.679) [-433.874] (-434.015) -- 0:00:16
723000 -- [-432.876] (-434.817) (-433.052) (-436.700) * (-431.518) [-431.998] (-432.959) (-432.435) -- 0:00:16
723500 -- (-432.718) [-429.997] (-430.544) (-433.486) * (-432.349) (-434.124) (-433.283) [-432.053] -- 0:00:16
724000 -- (-431.190) [-432.851] (-432.555) (-436.032) * (-431.859) (-435.805) (-431.222) [-431.056] -- 0:00:16
724500 -- (-432.654) (-430.471) (-431.461) [-432.973] * (-430.339) (-432.671) (-434.125) [-430.583] -- 0:00:15
725000 -- (-433.556) (-432.370) [-433.377] (-433.770) * (-432.276) [-432.659] (-430.792) (-431.333) -- 0:00:15
Average standard deviation of split frequencies: 0.008823
725500 -- [-433.752] (-432.941) (-433.237) (-433.449) * (-432.188) [-431.788] (-431.619) (-430.733) -- 0:00:15
726000 -- (-437.592) (-432.031) (-431.671) [-430.152] * (-431.031) [-432.312] (-430.794) (-431.080) -- 0:00:15
726500 -- (-436.415) (-431.739) (-430.497) [-432.262] * (-430.774) (-432.956) (-433.697) [-430.872] -- 0:00:15
727000 -- [-430.472] (-434.976) (-432.105) (-431.837) * [-432.374] (-432.672) (-438.327) (-432.417) -- 0:00:15
727500 -- (-433.829) (-434.957) (-433.998) [-431.333] * (-432.253) (-433.649) [-432.796] (-440.414) -- 0:00:15
728000 -- [-432.174] (-432.923) (-432.891) (-431.107) * (-430.133) (-434.114) (-432.498) [-433.232] -- 0:00:15
728500 -- (-435.007) [-432.854] (-431.611) (-431.908) * (-431.192) [-434.873] (-431.048) (-432.111) -- 0:00:15
729000 -- (-431.155) (-432.097) [-429.938] (-434.552) * [-434.936] (-433.586) (-434.138) (-432.160) -- 0:00:15
729500 -- (-432.102) (-430.601) [-430.506] (-433.619) * (-432.406) (-433.395) (-431.954) [-430.211] -- 0:00:15
730000 -- [-431.702] (-433.020) (-432.152) (-431.888) * [-430.349] (-433.268) (-431.055) (-431.453) -- 0:00:15
Average standard deviation of split frequencies: 0.008729
730500 -- [-432.781] (-436.870) (-432.461) (-431.376) * (-431.457) (-432.357) (-430.531) [-433.159] -- 0:00:15
731000 -- (-432.680) (-431.390) (-432.858) [-430.740] * (-430.812) (-432.902) [-433.045] (-439.136) -- 0:00:15
731500 -- (-432.378) (-431.882) [-433.392] (-433.082) * (-430.917) (-433.912) [-430.380] (-431.879) -- 0:00:15
732000 -- [-431.104] (-430.887) (-431.633) (-431.546) * [-430.868] (-434.310) (-430.410) (-433.967) -- 0:00:15
732500 -- (-434.444) (-433.919) (-431.607) [-430.955] * (-431.327) (-432.377) (-431.560) [-433.338] -- 0:00:15
733000 -- (-433.622) [-430.774] (-431.694) (-431.414) * (-432.794) [-432.811] (-433.015) (-430.883) -- 0:00:15
733500 -- [-431.755] (-434.437) (-434.459) (-432.757) * (-432.746) (-433.182) [-431.618] (-435.362) -- 0:00:15
734000 -- (-435.040) (-439.656) (-431.873) [-432.132] * (-434.066) (-434.815) (-432.833) [-431.916] -- 0:00:15
734500 -- (-432.142) [-431.574] (-431.740) (-435.929) * (-430.806) [-433.907] (-435.530) (-434.651) -- 0:00:15
735000 -- (-432.525) (-432.020) (-432.379) [-430.390] * [-430.862] (-439.630) (-434.985) (-437.841) -- 0:00:15
Average standard deviation of split frequencies: 0.008854
735500 -- (-432.986) (-432.228) (-430.086) [-429.951] * (-432.856) (-432.109) (-435.695) [-433.923] -- 0:00:15
736000 -- (-436.486) (-432.004) [-432.010] (-432.494) * (-432.239) (-433.925) (-430.957) [-434.456] -- 0:00:15
736500 -- (-430.624) (-433.056) [-431.382] (-437.467) * (-434.024) (-434.405) (-431.280) [-430.529] -- 0:00:15
737000 -- [-432.294] (-437.258) (-432.646) (-432.400) * [-431.281] (-433.044) (-432.598) (-435.619) -- 0:00:15
737500 -- (-430.344) (-437.829) (-432.006) [-431.322] * (-430.249) (-431.355) [-431.892] (-431.873) -- 0:00:15
738000 -- [-432.514] (-434.707) (-430.642) (-435.647) * (-431.942) (-432.291) [-431.157] (-436.254) -- 0:00:15
738500 -- (-431.343) [-432.836] (-431.625) (-432.063) * [-433.042] (-431.788) (-431.684) (-435.103) -- 0:00:15
739000 -- (-432.685) [-434.891] (-430.648) (-433.133) * (-433.360) [-433.170] (-431.041) (-431.259) -- 0:00:15
739500 -- (-436.001) (-442.208) [-432.756] (-433.474) * (-437.029) [-432.026] (-434.081) (-436.586) -- 0:00:15
740000 -- [-431.953] (-433.979) (-431.554) (-432.117) * (-439.447) [-432.490] (-434.092) (-438.196) -- 0:00:15
Average standard deviation of split frequencies: 0.008831
740500 -- [-431.101] (-433.905) (-432.796) (-431.524) * (-431.611) (-432.476) [-432.013] (-436.955) -- 0:00:15
741000 -- (-431.021) [-432.743] (-430.812) (-432.816) * (-431.565) (-433.987) [-430.711] (-432.894) -- 0:00:15
741500 -- (-431.226) (-432.051) (-435.247) [-430.142] * (-431.759) [-432.547] (-431.114) (-431.765) -- 0:00:14
742000 -- (-432.793) (-431.914) (-441.140) [-430.919] * (-441.692) (-430.816) [-431.321] (-434.432) -- 0:00:14
742500 -- (-430.580) (-433.898) (-430.475) [-430.757] * (-432.735) (-430.369) (-432.719) [-433.208] -- 0:00:14
743000 -- [-432.962] (-431.344) (-434.912) (-435.569) * [-431.114] (-431.308) (-438.015) (-433.584) -- 0:00:14
743500 -- (-431.768) (-431.280) [-434.703] (-437.014) * (-434.405) (-430.308) (-433.869) [-430.961] -- 0:00:14
744000 -- [-431.599] (-435.515) (-435.161) (-432.832) * (-431.479) [-433.906] (-431.678) (-431.825) -- 0:00:14
744500 -- (-432.660) (-432.264) [-431.005] (-433.411) * (-431.395) (-430.895) [-433.843] (-431.379) -- 0:00:14
745000 -- (-431.890) (-431.460) (-431.434) [-431.784] * (-430.261) [-432.276] (-435.690) (-434.214) -- 0:00:14
Average standard deviation of split frequencies: 0.009107
745500 -- (-434.826) [-431.089] (-431.642) (-434.130) * (-430.767) [-432.398] (-430.936) (-429.937) -- 0:00:14
746000 -- (-431.749) [-432.540] (-431.175) (-435.540) * (-432.185) (-431.755) (-433.295) [-432.255] -- 0:00:14
746500 -- (-430.670) [-431.342] (-433.162) (-431.413) * (-433.312) (-437.306) (-434.764) [-431.527] -- 0:00:14
747000 -- (-435.959) (-431.091) (-433.380) [-432.789] * (-432.615) (-431.303) (-436.873) [-431.947] -- 0:00:14
747500 -- [-434.187] (-433.888) (-433.460) (-432.605) * (-432.805) (-433.496) (-434.118) [-433.571] -- 0:00:14
748000 -- (-433.133) [-432.121] (-435.508) (-431.056) * (-432.858) (-435.081) [-432.170] (-432.990) -- 0:00:14
748500 -- (-432.144) [-431.602] (-433.519) (-434.084) * (-434.873) (-432.430) (-430.307) [-434.846] -- 0:00:14
749000 -- (-431.842) (-431.454) [-430.425] (-430.347) * (-435.619) (-431.589) (-430.588) [-432.998] -- 0:00:14
749500 -- (-433.855) (-434.095) [-432.481] (-430.981) * (-433.388) (-431.917) (-430.261) [-430.642] -- 0:00:14
750000 -- (-432.829) (-436.034) (-430.751) [-435.016] * (-433.203) (-432.612) (-432.331) [-431.844] -- 0:00:14
Average standard deviation of split frequencies: 0.009826
750500 -- (-431.459) (-435.610) [-433.604] (-436.550) * (-432.829) (-432.543) (-434.763) [-431.241] -- 0:00:14
751000 -- (-432.511) [-435.281] (-432.947) (-431.969) * (-430.964) [-430.635] (-434.134) (-430.651) -- 0:00:14
751500 -- (-435.314) [-431.016] (-432.136) (-431.924) * [-430.964] (-430.943) (-434.305) (-432.396) -- 0:00:14
752000 -- (-432.462) (-430.875) [-430.352] (-432.540) * (-432.316) (-431.342) [-432.261] (-433.132) -- 0:00:14
752500 -- (-432.752) (-432.099) (-432.126) [-431.080] * (-431.313) (-430.409) (-431.621) [-431.926] -- 0:00:14
753000 -- (-431.135) (-432.586) (-432.365) [-432.883] * (-430.234) [-430.548] (-431.736) (-430.878) -- 0:00:14
753500 -- (-434.254) [-432.168] (-433.094) (-432.373) * [-431.679] (-431.511) (-435.011) (-430.864) -- 0:00:14
754000 -- (-432.494) [-434.010] (-435.893) (-431.866) * (-433.194) (-437.429) (-433.262) [-431.236] -- 0:00:14
754500 -- (-440.270) (-435.697) (-432.246) [-431.633] * [-432.624] (-433.508) (-432.113) (-431.377) -- 0:00:14
755000 -- [-432.039] (-433.576) (-433.189) (-430.346) * (-431.558) [-432.495] (-435.390) (-431.324) -- 0:00:14
Average standard deviation of split frequencies: 0.010011
755500 -- [-434.141] (-433.295) (-433.822) (-431.010) * (-431.372) [-430.835] (-432.955) (-435.208) -- 0:00:14
756000 -- (-433.477) (-431.323) [-434.778] (-432.390) * (-430.800) (-432.996) (-431.990) [-430.464] -- 0:00:14
756500 -- (-433.111) (-432.601) [-431.553] (-431.669) * (-431.987) (-431.527) (-432.159) [-430.916] -- 0:00:14
757000 -- [-430.609] (-434.165) (-431.555) (-433.007) * (-430.668) (-432.189) [-430.500] (-432.340) -- 0:00:14
757500 -- (-430.978) [-432.956] (-431.867) (-432.682) * (-431.348) (-431.017) (-431.431) [-430.894] -- 0:00:14
758000 -- (-433.372) (-431.496) (-433.241) [-431.134] * (-434.644) (-430.952) [-430.431] (-431.639) -- 0:00:14
758500 -- (-431.890) (-432.343) (-434.898) [-430.427] * (-436.740) (-437.110) [-435.827] (-434.877) -- 0:00:14
759000 -- (-431.994) (-433.838) (-432.614) [-432.433] * (-431.825) (-433.396) [-432.189] (-434.878) -- 0:00:13
759500 -- (-431.776) [-430.384] (-432.156) (-433.855) * (-430.651) (-433.042) [-434.077] (-432.860) -- 0:00:13
760000 -- (-430.725) (-430.752) [-436.364] (-433.099) * [-432.750] (-430.005) (-431.955) (-432.799) -- 0:00:13
Average standard deviation of split frequencies: 0.009950
760500 -- [-432.217] (-430.672) (-434.146) (-432.128) * [-435.534] (-434.959) (-432.862) (-433.042) -- 0:00:13
761000 -- (-432.323) (-430.269) (-429.865) [-434.110] * (-434.075) (-430.039) [-431.464] (-432.438) -- 0:00:13
761500 -- (-432.457) (-431.468) [-431.215] (-430.346) * [-432.337] (-431.961) (-434.597) (-434.513) -- 0:00:13
762000 -- [-433.828] (-431.932) (-430.740) (-432.904) * (-437.711) (-432.249) (-431.153) [-431.337] -- 0:00:13
762500 -- (-432.912) [-433.099] (-432.933) (-434.660) * (-433.185) (-430.856) [-431.298] (-434.141) -- 0:00:13
763000 -- (-436.647) (-431.856) (-433.462) [-434.322] * [-431.614] (-431.028) (-431.872) (-434.058) -- 0:00:13
763500 -- [-434.085] (-432.917) (-433.513) (-430.432) * (-430.631) [-434.206] (-431.817) (-434.886) -- 0:00:13
764000 -- [-430.454] (-432.887) (-432.556) (-433.257) * (-430.348) (-430.579) [-431.204] (-433.771) -- 0:00:13
764500 -- [-431.189] (-435.014) (-432.023) (-434.130) * (-431.763) (-432.854) [-433.141] (-432.202) -- 0:00:13
765000 -- (-433.408) [-432.108] (-433.841) (-431.985) * (-431.370) (-435.650) [-433.375] (-433.518) -- 0:00:13
Average standard deviation of split frequencies: 0.009539
765500 -- (-432.911) (-432.932) [-432.929] (-430.380) * [-433.042] (-437.363) (-430.505) (-433.702) -- 0:00:13
766000 -- (-436.878) (-434.495) [-434.053] (-431.043) * (-436.590) (-431.243) (-430.468) [-431.910] -- 0:00:13
766500 -- (-433.052) (-432.075) [-435.419] (-432.558) * (-431.965) (-434.249) [-431.209] (-432.416) -- 0:00:13
767000 -- (-432.516) (-432.981) (-436.398) [-430.801] * (-434.458) (-434.212) [-430.065] (-431.595) -- 0:00:13
767500 -- (-432.612) (-431.437) (-436.456) [-433.154] * (-432.842) [-432.605] (-431.314) (-432.243) -- 0:00:13
768000 -- [-434.778] (-431.949) (-433.084) (-432.077) * (-432.595) [-431.460] (-430.987) (-432.049) -- 0:00:13
768500 -- [-432.608] (-432.169) (-431.292) (-433.172) * [-435.384] (-434.440) (-431.602) (-430.698) -- 0:00:13
769000 -- (-431.994) (-434.941) (-442.206) [-430.634] * (-434.371) [-435.506] (-431.438) (-431.508) -- 0:00:13
769500 -- (-432.095) (-432.146) (-436.604) [-430.393] * [-432.762] (-434.666) (-433.771) (-431.012) -- 0:00:13
770000 -- [-431.431] (-434.602) (-436.783) (-431.352) * (-434.447) (-431.783) [-432.061] (-432.262) -- 0:00:13
Average standard deviation of split frequencies: 0.009719
770500 -- (-433.700) (-431.124) (-434.668) [-430.438] * (-431.294) [-430.324] (-433.793) (-433.021) -- 0:00:13
771000 -- [-431.636] (-434.215) (-437.610) (-431.980) * (-435.144) (-436.575) [-432.532] (-432.262) -- 0:00:13
771500 -- (-432.552) (-433.278) [-433.367] (-430.865) * [-431.649] (-438.734) (-432.898) (-434.708) -- 0:00:13
772000 -- (-432.867) (-431.806) (-432.688) [-435.280] * [-430.703] (-432.470) (-431.611) (-431.305) -- 0:00:13
772500 -- (-431.264) [-430.855] (-432.622) (-432.617) * [-432.507] (-437.468) (-432.060) (-431.931) -- 0:00:13
773000 -- (-434.308) [-433.114] (-432.159) (-434.308) * [-433.098] (-433.802) (-431.347) (-432.418) -- 0:00:13
773500 -- (-433.522) (-431.250) (-429.868) [-436.628] * [-430.309] (-435.482) (-434.087) (-432.199) -- 0:00:13
774000 -- (-431.657) (-431.140) [-432.585] (-436.735) * [-430.533] (-432.494) (-433.805) (-432.466) -- 0:00:13
774500 -- (-434.424) (-433.115) (-431.022) [-432.080] * (-434.385) [-432.727] (-434.815) (-431.113) -- 0:00:13
775000 -- (-434.011) [-431.266] (-430.634) (-433.995) * [-433.031] (-434.111) (-433.439) (-432.047) -- 0:00:13
Average standard deviation of split frequencies: 0.009821
775500 -- (-434.409) (-431.135) (-430.365) [-431.893] * (-437.491) (-432.929) (-432.661) [-430.409] -- 0:00:13
776000 -- [-432.495] (-433.288) (-431.925) (-431.374) * (-432.607) (-433.014) [-431.950] (-431.518) -- 0:00:12
776500 -- [-435.325] (-432.691) (-430.642) (-431.080) * [-432.842] (-435.647) (-431.771) (-434.333) -- 0:00:12
777000 -- (-430.430) (-430.534) (-431.396) [-433.087] * [-431.644] (-432.544) (-433.076) (-434.004) -- 0:00:12
777500 -- (-430.946) (-432.616) [-433.516] (-433.170) * (-430.891) (-433.922) (-435.105) [-430.627] -- 0:00:12
778000 -- (-432.340) [-431.715] (-431.380) (-430.909) * (-432.791) [-432.560] (-433.572) (-430.821) -- 0:00:12
778500 -- [-432.120] (-434.440) (-430.504) (-431.389) * (-431.323) (-435.915) [-439.795] (-430.806) -- 0:00:12
779000 -- (-430.930) (-431.649) (-432.445) [-432.212] * [-430.725] (-439.534) (-431.860) (-432.343) -- 0:00:12
779500 -- (-434.601) (-430.371) (-433.626) [-430.606] * (-430.433) (-433.468) [-432.027] (-432.857) -- 0:00:12
780000 -- (-431.126) (-430.039) (-435.287) [-435.673] * (-433.349) (-434.114) [-431.363] (-432.195) -- 0:00:12
Average standard deviation of split frequencies: 0.009804
780500 -- (-433.342) [-430.901] (-431.848) (-432.020) * [-431.012] (-432.416) (-432.629) (-434.083) -- 0:00:12
781000 -- (-430.398) [-432.484] (-430.131) (-432.718) * (-437.128) (-430.530) [-433.396] (-435.696) -- 0:00:12
781500 -- (-430.552) [-431.024] (-430.323) (-431.616) * (-431.548) [-432.427] (-431.603) (-432.069) -- 0:00:12
782000 -- (-433.516) [-434.476] (-431.923) (-431.164) * (-434.286) (-435.712) [-432.353] (-432.032) -- 0:00:12
782500 -- (-431.613) (-434.680) (-437.434) [-433.318] * (-434.024) [-434.382] (-432.364) (-431.760) -- 0:00:12
783000 -- (-433.466) (-432.199) [-431.006] (-430.413) * [-431.841] (-432.475) (-433.842) (-430.939) -- 0:00:12
783500 -- (-432.732) (-431.549) [-430.706] (-433.441) * [-431.454] (-432.658) (-432.851) (-431.040) -- 0:00:12
784000 -- (-431.592) [-430.897] (-431.619) (-435.161) * (-431.886) [-430.240] (-432.167) (-431.328) -- 0:00:12
784500 -- (-431.540) [-431.120] (-437.804) (-430.763) * (-431.428) [-432.331] (-430.380) (-430.325) -- 0:00:12
785000 -- (-434.512) [-432.961] (-437.483) (-431.869) * (-431.868) [-437.497] (-431.315) (-431.458) -- 0:00:12
Average standard deviation of split frequencies: 0.009696
785500 -- (-431.525) (-435.665) [-436.657] (-431.058) * (-432.179) [-431.644] (-431.820) (-433.063) -- 0:00:12
786000 -- [-431.224] (-434.437) (-437.461) (-433.056) * (-430.982) (-433.090) (-437.535) [-435.118] -- 0:00:12
786500 -- [-430.785] (-433.890) (-432.111) (-435.901) * (-435.615) [-434.880] (-432.249) (-431.629) -- 0:00:12
787000 -- [-430.690] (-430.752) (-430.267) (-434.896) * (-436.002) (-435.730) [-432.149] (-432.896) -- 0:00:12
787500 -- (-433.565) (-433.689) (-431.507) [-430.455] * (-432.316) (-433.610) [-432.503] (-435.584) -- 0:00:12
788000 -- (-434.045) (-431.002) (-430.443) [-432.707] * (-431.173) (-433.310) [-431.405] (-431.443) -- 0:00:12
788500 -- (-431.660) (-432.144) (-431.481) [-430.402] * [-432.052] (-430.998) (-433.062) (-430.738) -- 0:00:12
789000 -- [-436.452] (-436.538) (-431.416) (-432.739) * (-430.319) (-432.646) (-431.943) [-431.264] -- 0:00:12
789500 -- (-432.469) (-433.216) (-432.373) [-435.419] * [-431.739] (-433.927) (-432.366) (-433.490) -- 0:00:12
790000 -- (-430.444) [-432.720] (-436.169) (-434.310) * (-438.122) (-432.650) (-431.289) [-432.864] -- 0:00:12
Average standard deviation of split frequencies: 0.010136
790500 -- (-433.158) (-432.498) (-433.489) [-431.543] * [-432.981] (-430.501) (-435.822) (-433.575) -- 0:00:12
791000 -- (-433.907) (-431.405) [-434.707] (-434.261) * (-430.358) (-430.984) (-434.947) [-431.901] -- 0:00:12
791500 -- (-432.452) [-431.365] (-439.959) (-431.174) * (-433.123) [-437.669] (-431.950) (-433.184) -- 0:00:12
792000 -- [-431.357] (-430.943) (-437.163) (-430.435) * (-430.633) (-433.989) [-433.266] (-430.817) -- 0:00:12
792500 -- (-431.478) [-431.630] (-437.724) (-431.093) * (-430.254) [-430.898] (-431.975) (-432.081) -- 0:00:12
793000 -- (-433.255) [-432.105] (-437.376) (-430.851) * [-431.751] (-434.494) (-434.013) (-431.658) -- 0:00:12
793500 -- (-431.754) (-429.820) (-430.496) [-431.383] * [-430.797] (-433.605) (-432.306) (-431.299) -- 0:00:11
794000 -- (-431.174) (-432.185) [-433.403] (-433.425) * (-434.800) (-437.377) [-432.102] (-433.599) -- 0:00:11
794500 -- (-432.001) [-431.262] (-432.365) (-430.339) * (-433.829) (-433.464) [-431.222] (-434.630) -- 0:00:11
795000 -- (-435.280) (-434.868) [-431.701] (-430.405) * (-434.679) (-431.805) (-435.963) [-432.454] -- 0:00:11
Average standard deviation of split frequencies: 0.010331
795500 -- (-434.025) (-437.168) (-431.842) [-433.004] * (-433.127) (-432.027) (-431.721) [-433.068] -- 0:00:11
796000 -- [-432.264] (-433.849) (-432.166) (-435.841) * (-434.776) (-431.370) (-431.298) [-432.588] -- 0:00:11
796500 -- [-431.147] (-433.357) (-430.475) (-433.855) * (-431.530) (-435.927) [-431.864] (-432.032) -- 0:00:11
797000 -- (-431.815) [-434.477] (-431.541) (-430.324) * (-432.134) (-432.811) [-432.918] (-432.790) -- 0:00:11
797500 -- (-431.451) (-431.441) (-430.217) [-430.064] * (-433.632) (-431.918) [-431.895] (-431.588) -- 0:00:11
798000 -- (-434.165) (-431.887) (-430.294) [-430.583] * (-433.153) [-430.925] (-431.022) (-434.667) -- 0:00:11
798500 -- (-432.148) (-433.104) (-431.157) [-431.549] * (-434.044) (-430.983) [-432.510] (-433.375) -- 0:00:11
799000 -- (-439.219) [-432.040] (-432.803) (-431.202) * (-437.492) (-432.166) (-433.252) [-433.371] -- 0:00:11
799500 -- [-437.413] (-432.849) (-431.638) (-432.767) * (-432.196) [-432.802] (-431.500) (-438.587) -- 0:00:11
800000 -- [-430.200] (-433.283) (-435.789) (-430.221) * (-433.402) (-434.128) [-431.081] (-431.318) -- 0:00:11
Average standard deviation of split frequencies: 0.009870
800500 -- (-431.493) (-434.846) (-433.794) [-431.968] * (-435.287) (-431.225) [-430.766] (-431.257) -- 0:00:11
801000 -- [-431.089] (-430.720) (-432.544) (-436.693) * (-431.814) (-430.695) [-433.452] (-431.478) -- 0:00:11
801500 -- (-431.858) [-435.768] (-434.350) (-432.021) * (-432.061) (-433.391) [-432.562] (-432.967) -- 0:00:11
802000 -- (-434.595) (-436.720) (-433.136) [-432.913] * (-433.624) (-432.871) [-430.723] (-431.446) -- 0:00:11
802500 -- (-430.909) (-431.755) (-431.767) [-434.084] * (-433.284) [-433.606] (-432.481) (-433.625) -- 0:00:11
803000 -- (-430.213) (-432.102) (-432.776) [-432.185] * (-434.111) [-431.901] (-432.097) (-430.586) -- 0:00:11
803500 -- [-430.479] (-436.832) (-430.988) (-432.386) * (-433.851) (-431.804) [-430.808] (-433.442) -- 0:00:11
804000 -- (-435.442) (-434.513) (-430.961) [-433.505] * [-429.808] (-430.288) (-431.445) (-435.739) -- 0:00:11
804500 -- (-433.223) [-436.219] (-431.766) (-431.992) * [-430.282] (-430.115) (-430.594) (-431.749) -- 0:00:11
805000 -- (-432.476) [-430.813] (-431.567) (-431.007) * (-430.769) (-433.423) [-431.169] (-430.760) -- 0:00:11
Average standard deviation of split frequencies: 0.009633
805500 -- (-433.471) (-430.544) (-431.133) [-430.334] * [-431.661] (-435.941) (-431.767) (-431.282) -- 0:00:11
806000 -- (-432.306) (-431.852) [-433.224] (-432.141) * (-435.636) (-434.319) [-430.798] (-433.171) -- 0:00:11
806500 -- [-433.022] (-432.021) (-431.010) (-432.582) * (-431.140) [-433.315] (-432.138) (-435.681) -- 0:00:11
807000 -- [-431.693] (-434.103) (-430.433) (-431.357) * (-432.114) (-435.168) (-432.065) [-432.834] -- 0:00:11
807500 -- (-430.877) (-431.660) [-430.372] (-430.963) * (-432.702) (-432.986) [-434.403] (-432.487) -- 0:00:11
808000 -- (-432.115) (-433.365) [-431.263] (-431.107) * (-430.452) (-432.124) (-431.434) [-436.916] -- 0:00:11
808500 -- [-432.797] (-431.660) (-433.340) (-434.015) * [-431.372] (-431.666) (-430.876) (-433.627) -- 0:00:11
809000 -- (-431.326) (-434.228) (-432.883) [-432.804] * (-433.725) (-431.114) (-431.137) [-435.815] -- 0:00:11
809500 -- (-433.573) [-432.312] (-433.559) (-431.635) * (-433.858) (-436.774) [-433.407] (-431.225) -- 0:00:11
810000 -- (-434.533) (-431.566) (-432.039) [-431.069] * (-430.847) [-430.891] (-432.273) (-430.471) -- 0:00:11
Average standard deviation of split frequencies: 0.009338
810500 -- (-433.267) [-431.733] (-433.309) (-431.340) * (-433.118) (-437.496) (-431.584) [-431.431] -- 0:00:10
811000 -- [-431.333] (-430.626) (-430.684) (-430.721) * (-431.932) (-431.229) (-430.594) [-430.417] -- 0:00:10
811500 -- [-430.224] (-430.820) (-434.120) (-431.970) * (-432.840) [-432.404] (-433.144) (-431.389) -- 0:00:10
812000 -- (-434.949) (-433.672) [-431.885] (-436.837) * (-433.446) [-434.583] (-435.797) (-432.072) -- 0:00:10
812500 -- [-433.272] (-432.204) (-432.120) (-436.596) * (-434.707) (-434.231) (-433.820) [-432.230] -- 0:00:10
813000 -- (-432.367) (-431.872) [-431.475] (-432.694) * (-433.642) (-431.219) (-431.922) [-431.636] -- 0:00:10
813500 -- (-434.147) (-434.052) [-432.222] (-433.030) * [-435.115] (-433.752) (-430.453) (-431.877) -- 0:00:10
814000 -- (-433.171) (-434.023) [-432.007] (-433.462) * (-433.564) [-429.742] (-436.433) (-429.837) -- 0:00:10
814500 -- (-435.238) (-437.096) [-431.866] (-432.727) * (-435.090) (-430.266) [-434.144] (-432.305) -- 0:00:10
815000 -- [-432.342] (-437.409) (-430.649) (-431.892) * (-431.267) (-430.498) (-434.762) [-430.333] -- 0:00:10
Average standard deviation of split frequencies: 0.009275
815500 -- [-432.009] (-433.391) (-433.301) (-430.909) * (-431.259) (-431.285) [-432.085] (-433.981) -- 0:00:10
816000 -- [-433.876] (-430.217) (-436.753) (-431.603) * (-430.930) (-431.157) (-433.457) [-430.681] -- 0:00:10
816500 -- (-431.301) [-431.095] (-436.588) (-431.361) * [-430.991] (-431.905) (-433.022) (-434.050) -- 0:00:10
817000 -- (-432.704) (-432.597) (-434.788) [-430.583] * (-431.297) [-430.901] (-430.025) (-433.146) -- 0:00:10
817500 -- (-432.070) (-433.612) (-432.006) [-434.772] * (-431.045) [-430.916] (-431.051) (-432.423) -- 0:00:10
818000 -- (-432.021) (-436.933) [-430.477] (-430.057) * (-431.121) (-432.510) (-433.993) [-431.530] -- 0:00:10
818500 -- (-432.600) [-434.054] (-433.161) (-430.661) * (-429.729) (-431.027) [-431.479] (-431.909) -- 0:00:10
819000 -- (-431.474) (-431.134) (-431.214) [-431.381] * [-432.373] (-431.374) (-431.382) (-431.711) -- 0:00:10
819500 -- [-430.036] (-431.109) (-433.200) (-433.228) * (-430.692) [-431.589] (-433.163) (-431.648) -- 0:00:10
820000 -- (-430.666) (-433.118) (-430.413) [-436.431] * [-431.664] (-431.133) (-435.194) (-431.479) -- 0:00:10
Average standard deviation of split frequencies: 0.008967
820500 -- (-433.151) (-434.623) (-431.825) [-432.572] * [-431.096] (-432.998) (-439.843) (-431.266) -- 0:00:10
821000 -- (-435.330) (-432.031) (-432.388) [-432.125] * (-431.100) [-430.484] (-435.549) (-432.887) -- 0:00:10
821500 -- (-434.940) [-432.708] (-435.169) (-430.715) * (-431.248) (-431.265) [-430.700] (-430.729) -- 0:00:10
822000 -- (-433.646) (-431.449) (-430.259) [-430.826] * (-432.205) (-430.506) [-431.359] (-431.407) -- 0:00:10
822500 -- (-434.506) (-430.843) [-431.226] (-430.413) * (-435.331) [-430.815] (-433.440) (-430.860) -- 0:00:10
823000 -- [-438.827] (-432.033) (-431.405) (-434.217) * (-431.769) [-431.349] (-430.627) (-431.552) -- 0:00:10
823500 -- (-433.428) (-431.375) [-430.555] (-440.161) * [-431.633] (-431.766) (-429.873) (-433.889) -- 0:00:10
824000 -- [-432.799] (-431.828) (-433.336) (-432.689) * [-431.111] (-433.881) (-433.202) (-433.789) -- 0:00:10
824500 -- (-430.846) (-432.774) [-430.486] (-432.217) * [-430.899] (-431.327) (-432.191) (-434.490) -- 0:00:10
825000 -- (-431.062) (-431.043) (-431.475) [-431.090] * [-430.534] (-433.140) (-431.552) (-434.842) -- 0:00:10
Average standard deviation of split frequencies: 0.009100
825500 -- (-430.970) [-432.708] (-433.681) (-434.008) * (-431.515) [-433.387] (-430.876) (-433.400) -- 0:00:10
826000 -- (-437.483) (-434.957) [-430.970] (-430.104) * (-430.649) (-434.074) (-435.777) [-433.393] -- 0:00:10
826500 -- (-433.941) (-431.401) (-432.478) [-435.023] * [-430.923] (-437.241) (-434.168) (-436.227) -- 0:00:10
827000 -- (-434.807) [-431.506] (-432.529) (-431.715) * (-430.787) [-432.330] (-434.452) (-431.964) -- 0:00:10
827500 -- (-432.615) (-431.180) [-431.882] (-432.343) * [-432.959] (-433.039) (-434.372) (-431.616) -- 0:00:10
828000 -- (-437.183) (-431.650) [-432.238] (-434.735) * (-433.061) [-430.971] (-435.009) (-430.093) -- 0:00:09
828500 -- (-432.500) [-431.924] (-433.747) (-430.573) * [-431.599] (-431.534) (-432.515) (-432.256) -- 0:00:09
829000 -- [-431.101] (-432.009) (-438.300) (-430.929) * (-433.001) (-430.919) [-431.366] (-434.573) -- 0:00:09
829500 -- (-431.055) (-432.646) [-435.113] (-432.792) * (-437.356) (-432.607) (-438.646) [-433.065] -- 0:00:09
830000 -- (-431.506) [-430.648] (-436.016) (-437.819) * (-431.453) [-436.199] (-432.947) (-432.109) -- 0:00:09
Average standard deviation of split frequencies: 0.008828
830500 -- (-430.943) (-431.051) [-430.416] (-430.776) * (-432.059) [-434.695] (-431.622) (-430.444) -- 0:00:09
831000 -- (-431.210) [-432.602] (-431.821) (-432.201) * (-432.017) (-432.126) (-432.709) [-432.145] -- 0:00:09
831500 -- [-431.868] (-432.189) (-435.634) (-431.639) * (-431.414) (-430.430) (-435.807) [-431.657] -- 0:00:09
832000 -- (-433.515) (-432.348) [-430.514] (-431.883) * (-431.405) (-431.056) (-434.885) [-432.537] -- 0:00:09
832500 -- (-432.440) (-430.258) (-433.270) [-433.684] * (-430.278) [-432.962] (-432.276) (-433.829) -- 0:00:09
833000 -- [-431.490] (-436.475) (-432.270) (-432.874) * (-430.865) [-433.098] (-431.140) (-433.858) -- 0:00:09
833500 -- (-433.626) (-435.489) (-430.776) [-431.406] * (-430.538) [-432.936] (-432.766) (-430.648) -- 0:00:09
834000 -- (-430.693) (-431.161) [-430.771] (-431.179) * [-434.255] (-433.024) (-431.245) (-432.106) -- 0:00:09
834500 -- (-433.729) [-432.697] (-431.193) (-441.570) * [-435.382] (-432.118) (-431.072) (-433.164) -- 0:00:09
835000 -- [-432.464] (-430.587) (-430.444) (-433.060) * (-433.923) (-431.172) (-430.513) [-433.494] -- 0:00:09
Average standard deviation of split frequencies: 0.008584
835500 -- (-433.210) [-431.060] (-431.407) (-433.686) * (-437.275) (-432.441) [-433.374] (-432.484) -- 0:00:09
836000 -- (-435.654) [-431.079] (-434.276) (-433.467) * [-433.157] (-431.036) (-432.856) (-431.453) -- 0:00:09
836500 -- (-434.171) [-432.690] (-433.789) (-431.554) * (-433.209) [-431.442] (-437.076) (-434.390) -- 0:00:09
837000 -- [-433.283] (-441.949) (-434.567) (-431.726) * (-433.308) [-432.113] (-431.297) (-431.567) -- 0:00:09
837500 -- (-431.399) (-432.087) [-430.086] (-435.455) * (-436.705) (-432.284) (-431.837) [-432.729] -- 0:00:09
838000 -- (-433.190) (-430.747) (-432.461) [-433.536] * (-434.148) [-430.919] (-431.576) (-431.154) -- 0:00:09
838500 -- (-430.784) (-432.397) (-430.718) [-431.212] * [-433.885] (-432.375) (-431.171) (-433.387) -- 0:00:09
839000 -- (-433.905) (-433.040) (-432.986) [-433.180] * (-434.515) [-433.153] (-431.352) (-431.241) -- 0:00:09
839500 -- (-435.394) (-432.180) [-432.997] (-431.348) * (-433.534) (-431.830) [-431.983] (-432.138) -- 0:00:09
840000 -- (-433.008) (-431.130) [-431.715] (-431.477) * [-432.610] (-431.141) (-430.864) (-430.354) -- 0:00:09
Average standard deviation of split frequencies: 0.008551
840500 -- (-432.653) (-431.930) [-431.814] (-430.580) * [-432.059] (-432.162) (-434.883) (-437.623) -- 0:00:09
841000 -- (-431.794) (-432.071) (-430.801) [-432.503] * (-433.294) (-431.943) [-431.534] (-433.418) -- 0:00:09
841500 -- (-432.788) (-433.051) [-432.592] (-432.317) * (-431.930) [-433.532] (-430.917) (-431.945) -- 0:00:09
842000 -- (-434.595) (-432.752) (-433.513) [-430.564] * [-431.356] (-432.415) (-433.271) (-433.597) -- 0:00:09
842500 -- (-434.962) (-432.720) [-432.733] (-433.726) * (-431.530) [-432.251] (-431.675) (-432.353) -- 0:00:09
843000 -- (-431.809) (-431.903) (-432.050) [-431.329] * (-430.392) (-435.105) (-433.050) [-431.878] -- 0:00:09
843500 -- (-431.940) (-430.604) [-432.277] (-431.114) * (-430.373) (-434.619) [-432.761] (-430.965) -- 0:00:09
844000 -- (-430.680) (-431.970) [-437.957] (-431.317) * [-432.484] (-433.628) (-432.849) (-432.691) -- 0:00:09
844500 -- (-431.999) (-434.083) [-431.082] (-432.583) * [-430.790] (-433.034) (-436.221) (-433.553) -- 0:00:09
845000 -- [-433.453] (-436.290) (-432.037) (-431.543) * (-432.126) (-430.734) [-432.981] (-432.311) -- 0:00:08
Average standard deviation of split frequencies: 0.009225
845500 -- (-437.094) [-431.788] (-433.772) (-432.501) * (-433.934) (-430.438) [-430.424] (-432.258) -- 0:00:08
846000 -- [-433.961] (-434.749) (-435.521) (-431.155) * (-431.302) (-430.912) [-432.731] (-437.730) -- 0:00:08
846500 -- (-431.459) (-432.977) [-431.176] (-432.874) * (-436.102) (-433.186) [-431.424] (-430.855) -- 0:00:08
847000 -- (-433.838) (-433.600) [-430.820] (-432.110) * (-431.658) (-433.798) (-432.640) [-430.596] -- 0:00:08
847500 -- (-432.214) (-433.445) (-430.821) [-432.398] * (-432.894) (-435.682) [-431.617] (-432.663) -- 0:00:08
848000 -- (-432.797) [-431.099] (-433.415) (-431.844) * (-431.962) (-433.912) [-430.341] (-431.630) -- 0:00:08
848500 -- (-430.967) (-432.823) (-431.459) [-430.432] * [-431.741] (-432.359) (-430.338) (-431.510) -- 0:00:08
849000 -- (-436.733) [-431.043] (-431.967) (-429.826) * (-432.132) (-431.570) (-432.789) [-432.171] -- 0:00:08
849500 -- (-438.635) [-430.698] (-431.807) (-431.456) * (-435.473) (-433.432) (-431.704) [-430.252] -- 0:00:08
850000 -- (-431.053) [-433.308] (-431.484) (-431.969) * (-433.118) (-430.935) (-431.205) [-431.249] -- 0:00:08
Average standard deviation of split frequencies: 0.009205
850500 -- [-430.489] (-431.590) (-431.689) (-431.259) * [-433.150] (-435.667) (-431.044) (-434.987) -- 0:00:08
851000 -- (-430.414) [-430.716] (-432.056) (-430.747) * (-435.424) (-433.062) [-434.288] (-434.860) -- 0:00:08
851500 -- [-434.290] (-431.118) (-431.571) (-432.777) * (-437.915) (-431.838) (-435.183) [-433.809] -- 0:00:08
852000 -- (-431.527) [-432.215] (-434.553) (-433.246) * (-433.474) (-431.612) (-433.882) [-434.341] -- 0:00:08
852500 -- (-432.526) (-431.946) (-430.943) [-431.136] * (-430.450) (-432.397) [-430.733] (-434.424) -- 0:00:08
853000 -- (-433.153) [-430.899] (-433.192) (-431.610) * (-432.105) (-432.263) (-430.151) [-431.263] -- 0:00:08
853500 -- (-431.515) [-430.184] (-433.625) (-432.236) * [-431.346] (-433.341) (-431.780) (-432.042) -- 0:00:08
854000 -- (-431.288) (-435.168) [-431.399] (-432.507) * (-431.846) (-431.762) (-434.512) [-430.929] -- 0:00:08
854500 -- (-436.555) (-433.684) (-433.288) [-431.719] * [-431.661] (-432.335) (-430.695) (-429.784) -- 0:00:08
855000 -- (-436.659) [-430.874] (-431.068) (-430.246) * (-431.434) (-431.031) (-432.755) [-431.546] -- 0:00:08
Average standard deviation of split frequencies: 0.008934
855500 -- (-431.018) (-432.581) [-434.557] (-433.858) * (-432.613) (-433.436) (-432.479) [-430.904] -- 0:00:08
856000 -- [-431.161] (-439.323) (-432.546) (-432.714) * (-433.564) [-430.218] (-432.571) (-432.507) -- 0:00:08
856500 -- (-433.963) [-435.068] (-432.927) (-432.726) * (-432.064) (-434.566) [-435.795] (-432.075) -- 0:00:08
857000 -- (-430.593) (-431.789) [-430.570] (-432.637) * [-430.311] (-433.650) (-431.532) (-431.458) -- 0:00:08
857500 -- (-431.268) (-431.562) [-432.248] (-435.026) * [-430.327] (-432.685) (-430.566) (-431.068) -- 0:00:08
858000 -- (-431.168) (-435.449) (-432.402) [-437.311] * [-431.109] (-435.843) (-431.999) (-432.426) -- 0:00:08
858500 -- (-431.028) (-433.098) [-433.010] (-436.895) * (-433.919) (-433.256) [-432.292] (-434.183) -- 0:00:08
859000 -- [-431.596] (-432.571) (-431.460) (-430.981) * (-433.920) [-433.300] (-431.804) (-431.491) -- 0:00:08
859500 -- [-432.669] (-434.602) (-431.126) (-434.898) * [-432.212] (-431.434) (-433.105) (-432.201) -- 0:00:08
860000 -- [-434.158] (-432.459) (-433.989) (-431.251) * (-432.465) (-430.456) [-430.586] (-430.698) -- 0:00:08
Average standard deviation of split frequencies: 0.008892
860500 -- (-432.556) [-432.416] (-433.093) (-430.571) * (-432.759) (-434.040) (-431.356) [-431.431] -- 0:00:08
861000 -- (-430.610) (-436.865) [-436.164] (-431.602) * [-432.946] (-433.429) (-434.332) (-431.049) -- 0:00:08
861500 -- (-431.154) (-433.810) [-432.468] (-432.111) * (-432.524) [-430.314] (-431.553) (-433.872) -- 0:00:08
862000 -- [-431.246] (-440.787) (-438.374) (-435.595) * (-435.476) (-430.214) (-434.237) [-433.412] -- 0:00:08
862500 -- (-430.582) [-430.073] (-433.281) (-432.082) * [-430.672] (-434.299) (-436.080) (-434.240) -- 0:00:07
863000 -- (-433.118) (-430.295) (-432.988) [-432.636] * [-432.802] (-431.950) (-430.654) (-430.346) -- 0:00:07
863500 -- (-432.216) (-434.687) [-433.577] (-430.783) * (-435.294) (-434.221) (-430.470) [-430.834] -- 0:00:07
864000 -- [-430.737] (-434.373) (-433.186) (-431.216) * (-431.506) [-431.056] (-433.474) (-430.689) -- 0:00:07
864500 -- (-432.573) (-432.608) [-432.740] (-431.329) * [-431.046] (-437.048) (-434.079) (-432.593) -- 0:00:07
865000 -- (-433.472) (-434.541) [-431.206] (-431.110) * (-432.550) (-430.890) [-432.293] (-432.486) -- 0:00:07
Average standard deviation of split frequencies: 0.008646
865500 -- (-434.324) [-431.090] (-430.919) (-430.888) * (-432.409) [-432.673] (-431.744) (-431.589) -- 0:00:07
866000 -- (-433.299) (-432.053) (-430.094) [-431.407] * [-431.581] (-431.987) (-430.689) (-431.581) -- 0:00:07
866500 -- (-430.887) [-431.011] (-430.429) (-431.983) * (-436.145) [-430.708] (-431.135) (-435.466) -- 0:00:07
867000 -- [-432.253] (-433.138) (-437.898) (-432.074) * [-432.873] (-430.596) (-431.453) (-431.962) -- 0:00:07
867500 -- (-434.559) (-433.152) [-434.158] (-432.765) * (-431.169) (-433.075) (-432.631) [-430.490] -- 0:00:07
868000 -- (-430.136) (-430.452) [-435.302] (-432.480) * (-433.048) (-431.172) [-433.424] (-430.477) -- 0:00:07
868500 -- (-433.907) (-435.328) (-431.615) [-431.478] * (-431.057) [-430.594] (-432.664) (-432.860) -- 0:00:07
869000 -- (-432.000) (-432.765) (-430.865) [-431.628] * (-431.048) (-432.586) (-430.718) [-432.127] -- 0:00:07
869500 -- (-431.439) [-435.466] (-431.854) (-432.738) * (-434.201) (-432.459) [-430.560] (-435.670) -- 0:00:07
870000 -- (-431.532) (-437.509) [-432.004] (-431.001) * (-431.236) [-430.924] (-439.040) (-432.595) -- 0:00:07
Average standard deviation of split frequencies: 0.008790
870500 -- (-432.567) (-436.159) (-430.394) [-432.844] * [-435.383] (-431.040) (-435.686) (-433.633) -- 0:00:07
871000 -- (-433.393) (-435.527) (-430.348) [-434.011] * [-431.531] (-429.985) (-432.940) (-433.449) -- 0:00:07
871500 -- (-431.527) (-434.221) [-431.252] (-433.195) * (-432.861) (-432.251) [-430.517] (-433.631) -- 0:00:07
872000 -- (-432.284) (-433.317) [-432.117] (-433.018) * (-433.703) [-434.063] (-434.471) (-435.223) -- 0:00:07
872500 -- (-434.616) (-438.156) (-431.640) [-430.380] * [-434.004] (-434.008) (-432.208) (-433.385) -- 0:00:07
873000 -- [-434.783] (-433.389) (-435.713) (-430.818) * [-434.305] (-432.481) (-432.162) (-431.849) -- 0:00:07
873500 -- (-435.887) (-434.501) (-434.645) [-433.082] * (-440.429) (-431.101) [-431.654] (-434.789) -- 0:00:07
874000 -- [-430.367] (-433.712) (-437.066) (-432.875) * (-433.771) (-431.443) [-431.389] (-434.687) -- 0:00:07
874500 -- (-431.574) (-435.653) (-431.761) [-436.995] * (-436.327) [-431.495] (-431.255) (-431.469) -- 0:00:07
875000 -- (-432.621) (-434.878) [-432.079] (-435.950) * (-432.626) [-431.468] (-431.684) (-431.745) -- 0:00:07
Average standard deviation of split frequencies: 0.008610
875500 -- (-434.153) (-431.810) (-433.658) [-431.756] * [-433.304] (-432.434) (-431.231) (-431.016) -- 0:00:07
876000 -- (-430.941) (-436.278) (-432.962) [-431.462] * [-432.440] (-432.133) (-434.567) (-432.158) -- 0:00:07
876500 -- (-433.112) (-431.391) [-434.658] (-431.988) * (-432.448) (-431.253) [-431.351] (-431.343) -- 0:00:07
877000 -- (-431.744) (-431.220) [-431.506] (-433.064) * (-431.123) (-433.929) [-430.573] (-434.409) -- 0:00:07
877500 -- (-434.914) (-432.446) [-434.227] (-432.028) * (-431.585) (-435.558) [-434.548] (-430.623) -- 0:00:07
878000 -- (-434.302) (-432.844) [-430.076] (-431.242) * (-435.935) (-433.407) (-432.472) [-430.547] -- 0:00:07
878500 -- (-433.425) (-431.559) [-430.166] (-435.207) * (-432.373) (-432.264) [-431.603] (-431.513) -- 0:00:07
879000 -- (-434.309) (-433.614) [-432.212] (-434.168) * (-431.858) (-431.602) [-431.796] (-430.220) -- 0:00:07
879500 -- (-431.414) (-430.643) [-431.748] (-433.972) * [-431.057] (-431.105) (-431.076) (-430.927) -- 0:00:06
880000 -- (-432.471) (-430.619) (-431.986) [-431.090] * [-430.103] (-431.422) (-430.307) (-431.712) -- 0:00:06
Average standard deviation of split frequencies: 0.008698
880500 -- (-432.717) (-431.461) (-430.791) [-434.658] * (-431.477) (-430.791) (-431.143) [-430.879] -- 0:00:06
881000 -- (-432.205) (-433.617) [-432.485] (-434.654) * [-437.567] (-431.673) (-430.482) (-431.304) -- 0:00:06
881500 -- (-430.827) [-433.957] (-432.960) (-431.136) * (-441.388) (-432.849) (-430.866) [-433.427] -- 0:00:06
882000 -- (-432.697) [-434.936] (-434.007) (-429.951) * (-437.641) [-430.595] (-430.985) (-431.647) -- 0:00:06
882500 -- (-433.967) (-431.072) [-434.595] (-432.252) * (-430.897) [-434.367] (-431.558) (-431.493) -- 0:00:06
883000 -- [-432.973] (-430.524) (-434.743) (-435.430) * [-431.148] (-432.174) (-430.044) (-433.498) -- 0:00:06
883500 -- (-434.256) [-433.625] (-434.224) (-431.505) * (-434.433) [-431.237] (-434.270) (-434.647) -- 0:00:06
884000 -- (-433.394) (-431.396) (-431.803) [-432.476] * (-431.060) (-433.033) [-431.586] (-432.699) -- 0:00:06
884500 -- (-432.597) (-432.914) (-432.993) [-433.366] * (-432.986) (-432.979) [-432.256] (-430.921) -- 0:00:06
885000 -- (-433.866) (-432.778) (-433.139) [-430.491] * (-432.117) (-432.844) [-432.165] (-430.778) -- 0:00:06
Average standard deviation of split frequencies: 0.008746
885500 -- [-431.285] (-432.885) (-437.322) (-430.772) * (-435.555) [-430.187] (-433.882) (-431.494) -- 0:00:06
886000 -- (-431.485) (-433.944) [-434.351] (-433.694) * (-435.626) [-430.388] (-432.473) (-432.245) -- 0:00:06
886500 -- (-432.673) [-430.175] (-431.588) (-432.147) * (-433.288) (-432.988) (-433.564) [-431.006] -- 0:00:06
887000 -- [-433.354] (-430.289) (-430.570) (-433.468) * (-430.555) (-432.379) [-430.945] (-432.470) -- 0:00:06
887500 -- (-432.860) (-431.191) (-431.730) [-431.180] * (-431.945) (-434.373) [-432.460] (-431.074) -- 0:00:06
888000 -- (-433.182) (-435.804) [-430.469] (-432.465) * (-432.559) (-430.492) (-434.167) [-431.116] -- 0:00:06
888500 -- (-432.493) [-430.412] (-432.593) (-430.740) * (-433.484) (-432.354) (-432.901) [-431.008] -- 0:00:06
889000 -- (-432.042) (-434.583) (-431.789) [-433.711] * [-433.745] (-433.787) (-434.266) (-434.908) -- 0:00:06
889500 -- (-430.840) (-435.093) (-431.424) [-430.869] * (-435.600) (-432.701) (-431.185) [-433.155] -- 0:00:06
890000 -- (-430.278) [-430.403] (-431.922) (-433.737) * (-432.309) (-430.296) (-431.308) [-432.513] -- 0:00:06
Average standard deviation of split frequencies: 0.008501
890500 -- (-432.312) (-432.858) [-430.892] (-430.654) * (-430.596) (-431.406) (-435.574) [-430.340] -- 0:00:06
891000 -- [-430.320] (-432.955) (-429.825) (-432.198) * (-431.234) (-431.599) (-432.622) [-434.004] -- 0:00:06
891500 -- (-434.031) (-431.979) (-429.825) [-434.467] * (-432.722) (-433.482) [-431.733] (-436.636) -- 0:00:06
892000 -- [-435.125] (-432.403) (-433.342) (-430.081) * (-435.260) (-433.143) (-433.023) [-433.388] -- 0:00:06
892500 -- (-438.816) (-431.175) (-431.069) [-430.310] * (-433.432) (-434.944) (-430.811) [-430.477] -- 0:00:06
893000 -- (-433.412) (-431.237) [-432.843] (-431.243) * (-433.684) (-435.079) [-431.775] (-431.162) -- 0:00:06
893500 -- [-431.229] (-431.916) (-437.731) (-434.621) * [-431.365] (-434.357) (-432.176) (-433.689) -- 0:00:06
894000 -- (-432.309) (-433.343) (-433.661) [-433.278] * (-436.657) (-431.602) (-430.763) [-431.503] -- 0:00:06
894500 -- (-431.075) [-432.857] (-435.839) (-433.468) * (-433.744) (-432.804) [-432.862] (-431.237) -- 0:00:06
895000 -- (-431.963) (-432.603) (-432.208) [-432.807] * (-432.390) (-438.108) (-432.824) [-431.204] -- 0:00:06
Average standard deviation of split frequencies: 0.008319
895500 -- (-432.012) (-433.646) [-431.245] (-431.010) * [-430.371] (-433.970) (-430.349) (-430.889) -- 0:00:06
896000 -- (-431.411) (-434.207) (-435.155) [-432.926] * [-431.959] (-431.001) (-430.591) (-430.375) -- 0:00:06
896500 -- [-430.919] (-430.412) (-434.125) (-432.681) * (-432.656) [-435.049] (-435.529) (-433.239) -- 0:00:06
897000 -- (-430.948) [-431.404] (-434.150) (-430.856) * (-432.476) (-434.216) [-435.097] (-433.270) -- 0:00:05
897500 -- (-431.945) (-434.175) [-431.736] (-431.347) * (-434.722) (-431.867) (-430.904) [-432.669] -- 0:00:05
898000 -- [-431.266] (-430.861) (-432.652) (-431.526) * (-434.329) (-431.147) [-430.533] (-430.073) -- 0:00:05
898500 -- [-429.896] (-433.510) (-434.063) (-431.906) * [-433.197] (-431.854) (-432.810) (-437.402) -- 0:00:05
899000 -- (-431.206) (-432.151) (-432.250) [-435.333] * (-432.993) (-434.119) (-432.324) [-430.548] -- 0:00:05
899500 -- [-433.598] (-431.487) (-432.930) (-431.216) * (-433.665) (-434.992) (-430.263) [-431.885] -- 0:00:05
900000 -- (-432.268) (-433.991) (-434.163) [-432.427] * (-432.715) (-433.496) (-431.339) [-433.207] -- 0:00:05
Average standard deviation of split frequencies: 0.008276
900500 -- (-432.370) (-431.654) (-434.305) [-432.971] * [-430.245] (-433.607) (-432.118) (-430.897) -- 0:00:05
901000 -- (-431.038) [-431.269] (-430.653) (-435.420) * (-431.405) (-430.634) (-432.332) [-432.272] -- 0:00:05
901500 -- (-433.580) [-431.220] (-432.131) (-437.874) * [-430.813] (-431.091) (-436.661) (-436.604) -- 0:00:05
902000 -- (-430.954) (-431.671) [-431.183] (-431.772) * (-432.081) (-433.318) (-430.988) [-432.699] -- 0:00:05
902500 -- (-430.261) (-437.417) (-431.316) [-431.942] * [-430.666] (-433.774) (-430.648) (-431.561) -- 0:00:05
903000 -- (-432.121) (-442.030) [-433.304] (-431.517) * [-430.490] (-433.218) (-431.440) (-436.168) -- 0:00:05
903500 -- [-431.654] (-431.095) (-434.490) (-430.854) * [-430.357] (-435.876) (-432.852) (-431.008) -- 0:00:05
904000 -- (-433.476) [-430.734] (-437.939) (-431.694) * (-430.748) (-433.424) [-430.761] (-433.238) -- 0:00:05
904500 -- (-431.815) (-431.765) (-431.427) [-431.132] * (-433.719) (-432.833) [-431.200] (-434.429) -- 0:00:05
905000 -- (-431.646) (-432.307) (-432.824) [-431.268] * (-439.281) [-434.275] (-432.841) (-432.570) -- 0:00:05
Average standard deviation of split frequencies: 0.008325
905500 -- (-434.208) [-432.399] (-431.298) (-432.435) * (-430.764) [-430.693] (-430.845) (-432.876) -- 0:00:05
906000 -- (-431.045) [-430.161] (-432.479) (-432.555) * (-433.002) (-432.222) [-433.041] (-432.878) -- 0:00:05
906500 -- (-433.878) [-430.130] (-435.845) (-430.827) * (-434.777) (-433.102) (-431.545) [-430.374] -- 0:00:05
907000 -- [-431.564] (-432.266) (-434.070) (-430.163) * (-434.298) [-430.085] (-430.446) (-435.032) -- 0:00:05
907500 -- (-431.250) (-430.331) [-431.985] (-430.035) * (-435.448) [-430.809] (-429.762) (-432.212) -- 0:00:05
908000 -- (-432.643) (-432.118) [-430.349] (-433.505) * (-433.173) (-433.525) (-432.124) [-434.013] -- 0:00:05
908500 -- (-435.587) (-436.718) (-430.859) [-430.515] * (-433.198) [-435.922] (-434.776) (-431.565) -- 0:00:05
909000 -- (-432.480) (-431.156) [-430.195] (-433.345) * [-431.310] (-432.297) (-432.239) (-430.850) -- 0:00:05
909500 -- (-430.301) (-432.640) [-430.601] (-433.917) * (-433.109) (-432.979) [-432.017] (-434.434) -- 0:00:05
910000 -- (-430.499) (-432.805) [-429.976] (-434.189) * (-432.000) (-431.578) (-432.742) [-433.169] -- 0:00:05
Average standard deviation of split frequencies: 0.008121
910500 -- (-431.161) (-430.508) (-431.717) [-432.923] * [-431.765] (-433.813) (-437.604) (-434.474) -- 0:00:05
911000 -- (-433.766) (-430.626) (-430.860) [-432.955] * (-430.791) (-435.594) [-430.918] (-432.526) -- 0:00:05
911500 -- (-430.198) (-431.971) [-434.653] (-431.392) * (-433.171) (-432.394) (-432.775) [-430.684] -- 0:00:05
912000 -- [-431.106] (-432.806) (-430.488) (-430.172) * (-431.512) (-434.090) (-434.102) [-433.042] -- 0:00:05
912500 -- (-431.874) (-430.162) [-430.476] (-432.309) * (-431.870) [-436.981] (-436.330) (-437.253) -- 0:00:05
913000 -- (-431.800) (-436.531) [-431.981] (-432.724) * (-434.293) (-432.107) [-431.690] (-434.794) -- 0:00:05
913500 -- [-432.722] (-436.225) (-431.430) (-432.761) * (-430.852) [-431.967] (-430.616) (-432.960) -- 0:00:05
914000 -- (-431.106) [-434.198] (-430.877) (-431.340) * (-432.441) [-431.271] (-433.485) (-434.670) -- 0:00:04
914500 -- (-430.656) [-436.141] (-434.882) (-430.534) * [-432.620] (-431.512) (-431.484) (-434.675) -- 0:00:04
915000 -- (-434.067) (-434.080) (-432.726) [-430.292] * (-430.620) (-434.134) (-430.983) [-430.963] -- 0:00:04
Average standard deviation of split frequencies: 0.007816
915500 -- (-435.996) (-430.426) [-432.513] (-430.757) * (-430.845) [-430.995] (-433.151) (-431.110) -- 0:00:04
916000 -- [-434.705] (-430.932) (-432.528) (-432.438) * (-433.525) (-431.667) [-432.457] (-431.687) -- 0:00:04
916500 -- [-433.072] (-431.417) (-431.336) (-430.247) * (-434.473) (-436.063) (-430.379) [-431.383] -- 0:00:04
917000 -- (-433.128) (-431.793) (-433.729) [-433.418] * (-434.479) (-431.649) [-433.038] (-431.653) -- 0:00:04
917500 -- (-430.307) (-431.632) (-434.450) [-431.255] * [-431.994] (-430.669) (-433.457) (-432.393) -- 0:00:04
918000 -- [-430.955] (-432.940) (-431.711) (-433.773) * (-432.923) [-431.699] (-434.284) (-430.481) -- 0:00:04
918500 -- (-430.238) [-430.797] (-431.240) (-434.780) * (-430.884) (-433.564) [-432.848] (-430.377) -- 0:00:04
919000 -- [-431.325] (-433.597) (-432.212) (-434.298) * (-430.404) [-431.628] (-433.719) (-431.717) -- 0:00:04
919500 -- [-431.661] (-431.365) (-434.513) (-438.013) * (-431.650) (-437.319) (-431.186) [-430.314] -- 0:00:04
920000 -- (-434.728) [-430.297] (-434.074) (-437.581) * (-431.887) (-431.582) [-435.332] (-434.127) -- 0:00:04
Average standard deviation of split frequencies: 0.007872
920500 -- (-431.577) (-431.374) (-432.221) [-432.422] * (-432.778) (-431.210) (-433.560) [-434.722] -- 0:00:04
921000 -- (-432.187) (-431.555) [-430.112] (-433.353) * (-432.289) (-430.623) (-433.263) [-434.164] -- 0:00:04
921500 -- (-431.783) (-431.143) (-431.680) [-431.750] * (-430.241) (-432.162) (-434.400) [-431.977] -- 0:00:04
922000 -- (-432.857) [-431.575] (-430.013) (-432.251) * [-431.179] (-431.467) (-430.916) (-435.630) -- 0:00:04
922500 -- [-431.447] (-432.807) (-431.425) (-435.878) * (-431.951) [-433.355] (-431.207) (-435.419) -- 0:00:04
923000 -- (-431.550) (-441.342) [-430.822] (-433.164) * (-432.881) (-430.740) (-433.776) [-433.732] -- 0:00:04
923500 -- (-432.680) (-436.798) (-431.539) [-429.953] * [-433.719] (-431.120) (-433.623) (-430.255) -- 0:00:04
924000 -- [-431.881] (-433.374) (-433.017) (-431.138) * (-433.128) (-433.744) (-433.297) [-430.735] -- 0:00:04
924500 -- [-433.713] (-433.705) (-432.680) (-430.896) * (-432.097) [-431.699] (-434.148) (-432.101) -- 0:00:04
925000 -- (-433.415) [-436.718] (-430.061) (-430.675) * (-433.536) [-431.898] (-431.509) (-433.453) -- 0:00:04
Average standard deviation of split frequencies: 0.007795
925500 -- (-430.472) (-432.082) (-431.910) [-432.562] * [-430.858] (-437.871) (-430.388) (-435.668) -- 0:00:04
926000 -- (-435.801) [-431.093] (-432.040) (-430.451) * (-432.900) [-431.925] (-431.512) (-431.305) -- 0:00:04
926500 -- (-433.608) (-434.009) [-430.129] (-430.543) * [-430.036] (-430.848) (-431.894) (-430.965) -- 0:00:04
927000 -- (-431.742) [-432.420] (-436.539) (-430.082) * (-433.529) [-432.416] (-433.839) (-431.324) -- 0:00:04
927500 -- (-431.053) [-430.154] (-439.083) (-430.003) * (-434.049) (-431.787) (-432.104) [-431.330] -- 0:00:04
928000 -- (-431.433) (-430.180) (-432.260) [-433.649] * [-431.614] (-431.907) (-434.326) (-432.073) -- 0:00:04
928500 -- [-430.601] (-432.841) (-430.342) (-431.162) * [-431.824] (-431.386) (-433.381) (-435.478) -- 0:00:04
929000 -- [-432.892] (-431.809) (-430.824) (-431.582) * [-436.191] (-437.065) (-432.416) (-436.111) -- 0:00:04
929500 -- (-433.143) [-431.576] (-433.352) (-434.169) * (-431.512) (-430.563) [-432.237] (-433.282) -- 0:00:04
930000 -- (-432.294) (-435.070) [-433.378] (-432.668) * (-430.455) (-432.017) (-431.449) [-433.160] -- 0:00:04
Average standard deviation of split frequencies: 0.007724
930500 -- (-436.910) [-433.136] (-436.113) (-430.982) * [-431.426] (-436.084) (-431.498) (-432.314) -- 0:00:04
931000 -- [-432.118] (-432.853) (-432.285) (-430.950) * [-431.974] (-432.692) (-431.166) (-433.129) -- 0:00:04
931500 -- (-431.914) [-432.972] (-430.978) (-430.314) * (-430.574) (-431.009) [-431.612] (-434.599) -- 0:00:03
932000 -- [-432.590] (-436.529) (-431.027) (-430.100) * (-431.089) (-446.002) [-431.108] (-434.684) -- 0:00:03
932500 -- (-432.746) (-432.704) [-433.824] (-434.176) * [-432.150] (-433.894) (-434.920) (-435.272) -- 0:00:03
933000 -- (-434.884) [-430.448] (-432.092) (-432.558) * (-430.680) (-434.103) [-431.102] (-436.359) -- 0:00:03
933500 -- (-431.569) [-430.489] (-431.295) (-431.308) * (-432.164) [-432.113] (-434.628) (-432.150) -- 0:00:03
934000 -- [-430.596] (-436.323) (-432.158) (-432.432) * (-435.089) [-431.011] (-434.549) (-430.228) -- 0:00:03
934500 -- (-433.389) (-433.826) [-431.715] (-433.866) * (-431.534) [-431.080] (-435.498) (-432.631) -- 0:00:03
935000 -- [-432.397] (-432.657) (-433.405) (-432.261) * (-430.516) (-433.020) (-434.402) [-431.130] -- 0:00:03
Average standard deviation of split frequencies: 0.007397
935500 -- [-431.309] (-432.208) (-434.866) (-431.788) * (-433.194) (-435.799) (-434.207) [-431.658] -- 0:00:03
936000 -- (-434.373) (-430.256) [-432.753] (-433.776) * (-432.965) (-430.522) (-432.737) [-432.329] -- 0:00:03
936500 -- (-433.490) (-430.933) (-431.733) [-434.175] * (-438.004) (-430.495) [-434.391] (-430.126) -- 0:00:03
937000 -- [-431.766] (-431.110) (-432.637) (-433.989) * (-433.816) (-430.618) (-436.140) [-431.250] -- 0:00:03
937500 -- (-431.941) (-431.797) (-438.926) [-430.718] * (-433.768) [-433.409] (-431.793) (-431.664) -- 0:00:03
938000 -- (-432.498) [-432.240] (-431.271) (-434.249) * (-432.485) (-431.335) [-431.149] (-432.017) -- 0:00:03
938500 -- (-431.912) (-431.239) (-435.871) [-433.560] * (-430.887) (-434.333) [-436.355] (-430.908) -- 0:00:03
939000 -- [-433.242] (-431.844) (-433.757) (-430.601) * [-430.933] (-431.679) (-432.474) (-431.913) -- 0:00:03
939500 -- (-434.250) [-432.142] (-433.491) (-433.058) * [-431.404] (-430.619) (-433.627) (-434.876) -- 0:00:03
940000 -- (-432.168) (-431.289) (-430.348) [-430.960] * [-432.130] (-431.957) (-436.671) (-433.073) -- 0:00:03
Average standard deviation of split frequencies: 0.007392
940500 -- [-431.279] (-432.214) (-431.502) (-430.488) * (-431.971) (-432.908) [-433.114] (-432.674) -- 0:00:03
941000 -- (-431.563) (-432.705) [-432.255] (-436.124) * (-432.902) (-432.121) (-433.973) [-431.370] -- 0:00:03
941500 -- (-431.060) [-431.310] (-430.242) (-430.840) * (-431.156) (-433.058) (-430.753) [-430.839] -- 0:00:03
942000 -- (-431.056) [-431.975] (-434.068) (-433.294) * (-430.404) (-432.290) (-432.661) [-433.192] -- 0:00:03
942500 -- (-431.111) (-430.281) [-430.693] (-433.736) * [-430.926] (-433.097) (-432.244) (-433.320) -- 0:00:03
943000 -- (-437.938) (-431.227) [-432.317] (-432.819) * (-433.363) (-433.795) [-430.112] (-434.393) -- 0:00:03
943500 -- (-432.521) (-433.122) (-432.347) [-435.005] * (-431.880) (-432.145) (-436.503) [-434.626] -- 0:00:03
944000 -- [-432.904] (-433.155) (-432.485) (-437.411) * (-431.771) [-431.408] (-433.158) (-432.466) -- 0:00:03
944500 -- [-433.159] (-432.962) (-434.249) (-432.371) * (-435.383) (-433.911) [-433.042] (-432.503) -- 0:00:03
945000 -- [-431.741] (-432.035) (-432.697) (-433.518) * (-435.538) (-432.678) [-431.031] (-431.003) -- 0:00:03
Average standard deviation of split frequencies: 0.007350
945500 -- [-431.479] (-433.122) (-430.482) (-432.511) * (-430.777) [-434.159] (-431.327) (-430.656) -- 0:00:03
946000 -- [-429.885] (-431.552) (-430.702) (-432.431) * [-430.683] (-432.319) (-433.038) (-432.321) -- 0:00:03
946500 -- (-433.892) [-431.344] (-431.188) (-432.368) * (-430.494) (-432.567) [-430.839] (-435.683) -- 0:00:03
947000 -- (-431.614) [-432.218] (-436.758) (-433.709) * (-432.451) (-431.919) [-433.124] (-430.495) -- 0:00:03
947500 -- (-431.045) [-433.144] (-433.049) (-431.310) * (-433.791) (-432.995) [-432.238] (-430.815) -- 0:00:03
948000 -- [-430.794] (-432.918) (-432.961) (-433.251) * (-432.171) (-433.705) (-433.139) [-436.662] -- 0:00:03
948500 -- (-431.672) (-432.556) (-432.853) [-436.571] * (-434.709) (-437.042) [-431.341] (-436.014) -- 0:00:02
949000 -- [-432.208] (-430.770) (-432.514) (-432.402) * (-431.110) [-433.265] (-431.722) (-436.519) -- 0:00:02
949500 -- (-437.811) [-429.829] (-432.214) (-434.449) * (-432.629) [-433.108] (-433.934) (-431.356) -- 0:00:02
950000 -- (-430.544) [-431.532] (-432.127) (-431.099) * (-431.652) [-432.558] (-433.490) (-432.446) -- 0:00:02
Average standard deviation of split frequencies: 0.007221
950500 -- [-433.257] (-431.545) (-430.456) (-434.409) * [-434.237] (-437.471) (-433.896) (-431.679) -- 0:00:02
951000 -- [-432.656] (-431.633) (-431.336) (-444.133) * (-432.192) (-432.140) [-434.248] (-430.209) -- 0:00:02
951500 -- [-433.046] (-432.207) (-432.167) (-440.940) * [-431.641] (-432.108) (-434.103) (-431.766) -- 0:00:02
952000 -- (-431.241) (-433.313) (-432.614) [-433.607] * (-430.806) (-434.419) [-432.535] (-431.728) -- 0:00:02
952500 -- (-432.389) [-433.051] (-432.515) (-437.636) * (-433.420) [-432.528] (-433.984) (-433.465) -- 0:00:02
953000 -- (-433.036) [-431.834] (-432.859) (-432.823) * (-433.320) (-432.044) [-433.434] (-431.828) -- 0:00:02
953500 -- (-432.169) (-431.992) (-435.615) [-434.557] * (-432.388) (-433.080) (-432.005) [-431.937] -- 0:00:02
954000 -- (-434.166) (-431.064) (-431.996) [-431.997] * (-432.753) (-434.322) (-434.801) [-430.807] -- 0:00:02
954500 -- (-431.378) (-430.680) [-431.450] (-431.800) * (-431.749) (-433.816) (-434.953) [-431.928] -- 0:00:02
955000 -- (-439.351) (-432.009) (-431.975) [-430.517] * [-430.683] (-432.434) (-433.033) (-432.342) -- 0:00:02
Average standard deviation of split frequencies: 0.007027
955500 -- [-433.039] (-432.232) (-431.581) (-430.549) * [-431.906] (-435.124) (-431.336) (-434.210) -- 0:00:02
956000 -- (-437.004) (-432.174) [-431.231] (-432.580) * (-430.745) (-432.438) (-431.172) [-433.323] -- 0:00:02
956500 -- (-435.195) [-439.076] (-431.883) (-434.017) * [-431.153] (-434.494) (-433.628) (-433.556) -- 0:00:02
957000 -- [-431.368] (-435.641) (-431.512) (-435.758) * [-430.298] (-433.794) (-430.398) (-431.488) -- 0:00:02
957500 -- [-432.350] (-432.638) (-435.779) (-431.900) * (-433.727) (-432.958) [-431.014] (-432.360) -- 0:00:02
958000 -- (-432.697) [-432.008] (-431.302) (-431.516) * (-433.637) (-432.787) (-432.271) [-430.054] -- 0:00:02
958500 -- (-432.225) (-435.894) (-432.612) [-435.511] * (-435.225) [-431.728] (-431.089) (-430.068) -- 0:00:02
959000 -- (-433.269) (-431.139) [-431.742] (-431.272) * (-431.006) (-430.442) (-432.384) [-430.090] -- 0:00:02
959500 -- (-431.170) [-431.483] (-434.218) (-432.588) * [-433.194] (-435.661) (-431.990) (-431.749) -- 0:00:02
960000 -- [-435.443] (-431.297) (-437.058) (-433.815) * [-431.661] (-434.663) (-435.467) (-431.550) -- 0:00:02
Average standard deviation of split frequencies: 0.006594
960500 -- (-434.181) (-430.785) [-434.416] (-432.045) * (-431.220) (-431.472) [-433.545] (-431.852) -- 0:00:02
961000 -- (-432.845) (-431.109) [-432.006] (-430.940) * [-435.983] (-434.672) (-434.694) (-433.534) -- 0:00:02
961500 -- (-432.009) [-435.110] (-430.723) (-431.193) * (-431.359) [-431.360] (-432.038) (-431.868) -- 0:00:02
962000 -- (-431.406) [-431.183] (-432.646) (-430.183) * (-429.912) (-430.604) (-436.565) [-432.667] -- 0:00:02
962500 -- (-434.245) [-431.115] (-433.038) (-432.751) * (-430.695) [-430.826] (-432.931) (-431.005) -- 0:00:02
963000 -- (-430.594) (-432.985) [-432.774] (-433.868) * (-432.416) [-430.384] (-437.624) (-433.774) -- 0:00:02
963500 -- (-436.662) [-430.777] (-431.648) (-432.665) * [-430.521] (-431.501) (-435.231) (-433.764) -- 0:00:02
964000 -- (-432.658) (-433.379) (-431.982) [-436.603] * [-430.908] (-434.261) (-434.284) (-433.532) -- 0:00:02
964500 -- (-431.656) (-434.615) [-434.398] (-430.619) * (-434.177) (-435.760) [-430.162] (-430.651) -- 0:00:02
965000 -- (-432.995) [-430.646] (-432.243) (-431.283) * (-433.090) [-431.892] (-430.766) (-430.084) -- 0:00:02
Average standard deviation of split frequencies: 0.006801
965500 -- [-431.924] (-432.933) (-431.688) (-430.315) * (-434.831) (-431.690) (-440.655) [-430.107] -- 0:00:02
966000 -- (-431.723) (-431.378) [-434.510] (-430.499) * (-430.256) [-430.248] (-431.393) (-431.732) -- 0:00:01
966500 -- (-433.698) (-433.949) [-432.891] (-437.672) * [-432.224] (-432.884) (-430.345) (-432.438) -- 0:00:01
967000 -- (-432.634) [-432.304] (-434.675) (-434.141) * (-432.703) (-433.038) (-430.192) [-430.771] -- 0:00:01
967500 -- [-431.918] (-432.956) (-434.189) (-432.764) * [-430.981] (-430.864) (-432.616) (-432.878) -- 0:00:01
968000 -- [-434.858] (-432.454) (-438.440) (-431.422) * (-432.256) (-431.778) (-432.650) [-432.224] -- 0:00:01
968500 -- (-433.007) (-434.538) (-434.294) [-433.755] * (-434.543) (-433.792) (-435.523) [-433.440] -- 0:00:01
969000 -- (-433.906) [-431.934] (-431.800) (-433.258) * (-433.736) (-431.559) (-435.782) [-431.746] -- 0:00:01
969500 -- (-432.518) [-432.967] (-431.939) (-434.504) * (-436.701) (-430.658) (-431.106) [-430.772] -- 0:00:01
970000 -- (-435.955) [-430.619] (-433.552) (-432.321) * (-437.422) (-433.579) [-430.667] (-431.988) -- 0:00:01
Average standard deviation of split frequencies: 0.007042
970500 -- (-439.673) [-432.278] (-435.973) (-432.434) * (-432.697) (-431.639) [-430.962] (-431.054) -- 0:00:01
971000 -- [-433.870] (-432.148) (-434.251) (-433.764) * [-432.283] (-431.582) (-432.425) (-431.792) -- 0:00:01
971500 -- [-435.883] (-431.253) (-435.901) (-431.325) * (-431.965) (-433.619) (-432.932) [-432.337] -- 0:00:01
972000 -- (-433.170) (-430.395) [-432.328] (-433.541) * (-432.420) [-432.934] (-433.537) (-430.157) -- 0:00:01
972500 -- [-435.677] (-433.996) (-434.013) (-439.663) * (-432.817) [-435.049] (-430.518) (-432.095) -- 0:00:01
973000 -- (-432.262) (-431.599) [-431.663] (-432.133) * (-431.897) [-432.518] (-431.405) (-436.823) -- 0:00:01
973500 -- (-431.973) (-431.466) [-431.336] (-431.308) * (-431.175) (-432.268) (-431.668) [-433.223] -- 0:00:01
974000 -- (-432.993) [-431.779] (-433.830) (-432.515) * [-430.924] (-436.945) (-432.394) (-431.871) -- 0:00:01
974500 -- [-431.495] (-431.212) (-431.894) (-431.328) * (-432.919) (-431.034) (-433.910) [-432.684] -- 0:00:01
975000 -- [-432.202] (-434.289) (-435.713) (-430.147) * (-433.105) (-430.504) [-430.847] (-435.457) -- 0:00:01
Average standard deviation of split frequencies: 0.007245
975500 -- (-434.038) (-434.356) (-430.167) [-430.930] * [-430.616] (-430.421) (-436.409) (-429.976) -- 0:00:01
976000 -- (-431.215) (-432.546) [-430.576] (-430.934) * (-431.706) (-430.321) [-436.451] (-431.882) -- 0:00:01
976500 -- (-430.323) (-431.751) [-430.574] (-430.954) * [-432.259] (-430.555) (-433.898) (-432.944) -- 0:00:01
977000 -- (-431.554) (-432.617) [-431.000] (-439.462) * (-432.715) (-431.154) (-432.906) [-432.317] -- 0:00:01
977500 -- (-431.888) (-430.848) (-431.171) [-436.365] * (-431.406) (-432.791) (-433.481) [-430.637] -- 0:00:01
978000 -- (-432.075) (-434.667) (-431.072) [-434.572] * (-430.956) (-431.701) (-436.325) [-431.120] -- 0:00:01
978500 -- (-436.509) (-431.884) [-431.031] (-432.434) * (-431.181) (-431.752) [-435.098] (-432.618) -- 0:00:01
979000 -- [-434.192] (-433.007) (-430.964) (-433.088) * (-432.135) [-431.390] (-437.168) (-433.197) -- 0:00:01
979500 -- (-434.306) (-433.186) [-430.169] (-432.619) * (-431.226) (-431.468) (-441.564) [-433.607] -- 0:00:01
980000 -- (-432.535) (-436.717) (-432.306) [-431.922] * (-432.353) (-431.609) [-431.330] (-431.737) -- 0:00:01
Average standard deviation of split frequencies: 0.007271
980500 -- (-431.364) [-432.756] (-432.502) (-431.971) * (-436.032) (-432.653) [-429.948] (-431.251) -- 0:00:01
981000 -- (-433.666) (-436.021) (-433.048) [-430.605] * [-437.063] (-433.538) (-431.032) (-434.331) -- 0:00:01
981500 -- (-441.583) [-432.699] (-431.661) (-430.773) * [-432.976] (-431.145) (-433.395) (-434.525) -- 0:00:01
982000 -- (-434.644) (-432.354) [-432.299] (-433.369) * (-435.503) (-433.169) (-432.634) [-435.322] -- 0:00:01
982500 -- (-435.565) (-433.939) (-435.238) [-431.379] * (-432.222) (-431.358) (-433.961) [-435.807] -- 0:00:01
983000 -- [-431.190] (-432.038) (-432.075) (-434.112) * (-432.155) (-431.818) (-431.895) [-432.822] -- 0:00:00
983500 -- (-433.312) [-435.607] (-434.799) (-432.791) * [-432.562] (-436.021) (-432.989) (-435.584) -- 0:00:00
984000 -- [-434.258] (-434.187) (-431.971) (-434.739) * (-432.325) (-433.879) (-431.564) [-431.438] -- 0:00:00
984500 -- [-431.908] (-431.203) (-432.982) (-434.336) * (-433.186) (-438.824) [-432.186] (-431.009) -- 0:00:00
985000 -- (-431.282) (-430.470) (-432.978) [-430.891] * (-432.508) [-432.766] (-432.769) (-433.324) -- 0:00:00
Average standard deviation of split frequencies: 0.007261
985500 -- (-433.220) [-430.470] (-431.455) (-430.909) * (-431.157) (-431.452) [-432.609] (-433.253) -- 0:00:00
986000 -- [-431.428] (-430.430) (-432.017) (-431.328) * (-432.056) (-432.082) [-436.739] (-433.032) -- 0:00:00
986500 -- (-431.751) [-430.434] (-432.235) (-431.425) * [-431.075] (-437.884) (-432.481) (-432.815) -- 0:00:00
987000 -- (-430.315) [-430.825] (-432.840) (-433.946) * (-432.996) (-437.000) (-431.329) [-432.988] -- 0:00:00
987500 -- (-433.002) (-434.356) [-432.302] (-433.736) * [-433.008] (-431.769) (-432.122) (-431.419) -- 0:00:00
988000 -- [-432.919] (-431.035) (-432.139) (-431.279) * (-431.934) (-431.611) [-432.778] (-430.209) -- 0:00:00
988500 -- (-430.096) [-431.314] (-435.082) (-433.027) * (-431.384) (-432.675) [-431.953] (-431.689) -- 0:00:00
989000 -- (-433.762) (-439.475) (-433.052) [-430.816] * (-430.193) (-431.505) [-430.438] (-433.704) -- 0:00:00
989500 -- (-431.529) (-433.635) (-431.987) [-433.960] * (-432.365) (-430.465) (-431.686) [-431.060] -- 0:00:00
990000 -- [-431.704] (-432.512) (-433.343) (-432.248) * (-436.516) (-435.862) (-430.922) [-432.493] -- 0:00:00
Average standard deviation of split frequencies: 0.007048
990500 -- (-436.013) (-435.480) (-431.737) [-434.730] * (-434.174) [-434.896] (-431.785) (-435.368) -- 0:00:00
991000 -- (-432.447) [-433.854] (-432.367) (-431.858) * (-434.397) (-435.345) (-430.666) [-430.339] -- 0:00:00
991500 -- [-430.452] (-435.667) (-435.181) (-431.086) * (-434.597) [-432.754] (-431.313) (-431.562) -- 0:00:00
992000 -- (-434.953) (-432.304) (-437.096) [-432.899] * (-432.783) (-434.366) (-434.275) [-431.816] -- 0:00:00
992500 -- (-432.110) [-430.727] (-432.262) (-430.578) * (-431.402) (-430.702) (-436.507) [-431.229] -- 0:00:00
993000 -- (-431.186) [-431.427] (-434.400) (-431.156) * [-430.662] (-435.608) (-433.390) (-433.015) -- 0:00:00
993500 -- (-431.737) [-431.425] (-430.764) (-430.767) * [-430.823] (-434.923) (-430.773) (-432.444) -- 0:00:00
994000 -- (-431.321) (-431.743) (-432.713) [-431.154] * [-436.069] (-436.176) (-430.907) (-432.589) -- 0:00:00
994500 -- (-433.236) [-432.347] (-431.007) (-430.317) * (-433.618) (-434.707) (-430.805) [-433.594] -- 0:00:00
995000 -- (-433.670) (-433.196) (-430.933) [-431.385] * (-435.295) (-439.207) (-435.688) [-432.598] -- 0:00:00
Average standard deviation of split frequencies: 0.006922
995500 -- (-436.150) [-434.320] (-435.620) (-437.183) * [-432.258] (-431.740) (-432.222) (-433.380) -- 0:00:00
996000 -- (-432.453) (-433.746) [-434.283] (-433.131) * (-432.754) [-432.129] (-431.703) (-431.653) -- 0:00:00
996500 -- (-430.484) (-431.948) [-434.380] (-431.903) * [-431.862] (-433.391) (-433.212) (-432.942) -- 0:00:00
997000 -- (-430.251) (-435.301) (-432.903) [-430.660] * [-430.826] (-434.048) (-431.630) (-434.706) -- 0:00:00
997500 -- (-432.471) [-431.756] (-431.128) (-435.067) * (-432.001) [-430.870] (-435.231) (-436.575) -- 0:00:00
998000 -- (-431.692) [-432.063] (-430.234) (-437.316) * (-433.132) (-430.754) (-432.738) [-436.312] -- 0:00:00
998500 -- (-431.310) (-432.572) (-431.595) [-431.261] * [-430.996] (-431.855) (-431.612) (-437.967) -- 0:00:00
999000 -- [-431.422] (-437.894) (-432.435) (-432.245) * (-430.275) [-431.627] (-432.334) (-437.262) -- 0:00:00
999500 -- (-435.107) (-433.390) (-434.612) [-433.030] * (-433.721) (-432.916) [-430.872] (-442.499) -- 0:00:00
1000000 -- [-431.416] (-431.119) (-433.701) (-433.862) * (-438.200) (-434.191) (-432.066) [-434.158] -- 0:00:00
Average standard deviation of split frequencies: 0.007125
Analysis completed in 58 seconds
Analysis used 57.18 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -429.75
Likelihood of best state for "cold" chain of run 2 was -429.75
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 69 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
38.6 % ( 29 %) Dirichlet(Pi{all})
37.8 % ( 30 %) Slider(Pi{all})
78.1 % ( 48 %) Multiplier(Alpha{1,2})
77.4 % ( 46 %) Multiplier(Alpha{3})
25.9 % ( 19 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.2 % ( 78 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.7 % ( 22 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.1 % ( 67 %) Dirichlet(Revmat{all})
99.9 % ( 99 %) Slider(Revmat{all})
38.0 % ( 28 %) Dirichlet(Pi{all})
38.0 % ( 26 %) Slider(Pi{all})
78.9 % ( 53 %) Multiplier(Alpha{1,2})
78.4 % ( 60 %) Multiplier(Alpha{3})
26.3 % ( 34 %) Slider(Pinvar{all})
98.7 % ( 95 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 23 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.6 % ( 28 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166660 0.82 0.67
3 | 166711 166158 0.84
4 | 166950 166651 166870
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166021 0.82 0.67
3 | 166767 166645 0.84
4 | 167180 166633 166754
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -431.47
| 22 1 2 1 |
| 1 * 2 |
| 1 1 2 2 1 1 1 2 2 2 |
|2 1 1 2 1 2 1 1 2 1222 1 12 1 |
| 2 2 1 1 1 1 2 1 1 1 1 |
| 2 1 1 * 2 2 1 22 2 2 2 1 2 *|
|12 *1212 22 2 1 * 22 12 1 |
| 1 2 1 2111 2 * 22 1 21 1 111 2 2 |
| 2 1 2 1 |
| 21 2 12 2 1 |
| 1 2 1 2 |
| |
| |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -433.49
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -431.45 -434.48
2 -431.47 -435.27
--------------------------------------
TOTAL -431.46 -434.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899568 0.093368 0.329596 1.481552 0.864827 1472.86 1486.93 1.000
r(A<->C){all} 0.157864 0.018352 0.000091 0.434498 0.122103 257.58 276.04 1.000
r(A<->G){all} 0.169722 0.020245 0.000003 0.450827 0.131837 106.38 226.89 1.006
r(A<->T){all} 0.176700 0.020789 0.000006 0.451908 0.144262 168.82 227.05 1.004
r(C<->G){all} 0.168430 0.021380 0.000116 0.468843 0.128900 202.29 244.40 1.002
r(C<->T){all} 0.167912 0.018850 0.000108 0.449825 0.136554 246.50 355.04 1.003
r(G<->T){all} 0.159372 0.019836 0.000099 0.453162 0.121746 179.85 203.67 1.001
pi(A){all} 0.275331 0.000646 0.227257 0.325539 0.274766 906.79 1045.93 1.000
pi(C){all} 0.281555 0.000645 0.232296 0.331151 0.281090 1086.43 1163.75 1.000
pi(G){all} 0.243378 0.000579 0.197488 0.290679 0.242311 1191.28 1331.87 1.000
pi(T){all} 0.199737 0.000494 0.155881 0.242601 0.199640 1308.01 1335.97 1.000
alpha{1,2} 0.421818 0.231454 0.000132 1.364516 0.257399 1088.74 1198.59 1.001
alpha{3} 0.449780 0.218626 0.000113 1.393478 0.297395 1382.50 1441.75 1.000
pinvar{all} 0.995030 0.000036 0.983556 0.999998 0.996888 1356.86 1379.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*..*.
8 -- .**.**
9 -- ..*.*.
10 -- ...*.*
11 -- .****.
12 -- .*...*
13 -- .**...
14 -- .*.***
15 -- .*.*..
16 -- ....**
17 -- .***.*
18 -- ..*..*
19 -- ...**.
20 -- ..****
21 -- ..**..
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 459 0.152898 0.003298 0.150566 0.155230 2
8 456 0.151899 0.011306 0.143904 0.159893 2
9 450 0.149900 0.005653 0.145903 0.153897 2
10 440 0.146569 0.013191 0.137242 0.155896 2
11 433 0.144237 0.002355 0.142572 0.145903 2
12 433 0.144237 0.008009 0.138574 0.149900 2
13 431 0.143571 0.013662 0.133911 0.153231 2
14 429 0.142905 0.003298 0.140573 0.145237 2
15 427 0.142239 0.013662 0.132578 0.151899 2
16 422 0.140573 0.001884 0.139241 0.141905 2
17 422 0.140573 0.000942 0.139907 0.141239 2
18 417 0.138907 0.004240 0.135909 0.141905 2
19 406 0.135243 0.000942 0.134577 0.135909 2
20 403 0.134244 0.011777 0.125916 0.142572 2
21 403 0.134244 0.004240 0.131246 0.137242 2
22 279 0.092938 0.015546 0.081945 0.103931 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.102300 0.010626 0.000002 0.305650 0.070149 1.000 2
length{all}[2] 0.100272 0.009733 0.000012 0.304475 0.070019 1.000 2
length{all}[3] 0.098687 0.009958 0.000046 0.290718 0.067721 1.000 2
length{all}[4] 0.099554 0.010112 0.000060 0.300934 0.067375 1.001 2
length{all}[5] 0.099483 0.010047 0.000074 0.292296 0.069924 1.001 2
length{all}[6] 0.097855 0.009510 0.000006 0.287702 0.069683 1.000 2
length{all}[7] 0.099408 0.008357 0.000348 0.272792 0.073485 0.998 2
length{all}[8] 0.099104 0.009513 0.000363 0.305249 0.068283 0.998 2
length{all}[9] 0.108873 0.014037 0.000021 0.311688 0.076814 1.002 2
length{all}[10] 0.096035 0.009213 0.000476 0.280684 0.064808 1.002 2
length{all}[11] 0.105848 0.011064 0.000081 0.316561 0.070368 0.998 2
length{all}[12] 0.100560 0.011681 0.000184 0.301692 0.067199 0.998 2
length{all}[13] 0.095591 0.008960 0.000611 0.262439 0.067783 1.003 2
length{all}[14] 0.096897 0.008010 0.000130 0.274183 0.065975 1.000 2
length{all}[15] 0.100096 0.010084 0.000127 0.307892 0.072313 0.998 2
length{all}[16] 0.097328 0.009810 0.000001 0.296525 0.066995 1.001 2
length{all}[17] 0.098610 0.009196 0.000059 0.289492 0.069608 0.999 2
length{all}[18] 0.106708 0.010697 0.000606 0.299295 0.071239 1.003 2
length{all}[19] 0.093521 0.009211 0.000213 0.274716 0.062102 0.998 2
length{all}[20] 0.112795 0.012312 0.000826 0.300248 0.082072 1.002 2
length{all}[21] 0.097844 0.009297 0.000034 0.294083 0.067190 0.998 2
length{all}[22] 0.098777 0.011187 0.000284 0.324012 0.056942 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007125
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 312
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:01
Compressing, 44 patterns at 104 / 104 sites (100.0%), 0:01
Collecting fpatt[] & pose[], 44 patterns at 104 / 104 sites (100.0%), 0:01
Counting codons..
120 bytes for distance
42944 bytes for conP
3872 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095628 0.063190 0.012161 0.082072 0.053273 0.043074 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -446.775691
Iterating by ming2
Initial: fx= 446.775691
x= 0.09563 0.06319 0.01216 0.08207 0.05327 0.04307 0.30000 1.30000
1 h-m-p 0.0000 0.0001 251.4589 ++ 439.339640 m 0.0001 13 | 1/8
2 h-m-p 0.0009 0.0151 30.1190 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 229.6635 +++ 423.455853 m 0.0003 45 | 2/8
4 h-m-p 0.0026 0.0227 23.9700 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 206.3078 ++ 419.227220 m 0.0001 77 | 3/8
6 h-m-p 0.0010 0.0412 18.5528 -----------.. | 3/8
7 h-m-p 0.0000 0.0001 178.7743 ++ 416.134303 m 0.0001 108 | 4/8
8 h-m-p 0.0010 0.0612 14.1545 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 146.0025 +++ 412.190444 m 0.0002 140 | 5/8
10 h-m-p 0.0020 0.1155 9.5352 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 103.4582 ++ 410.765906 m 0.0001 172 | 6/8
12 h-m-p 0.7104 8.0000 0.0000 ++ 410.765906 m 8.0000 183 | 6/8
13 h-m-p 0.0412 8.0000 0.0003 ++++ 410.765906 m 8.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.5459 +++Y 410.765905 0 2.0908 214 | 6/8
15 h-m-p 1.6000 8.0000 0.0587 C 410.765905 0 1.4106 227 | 6/8
16 h-m-p 1.6000 8.0000 0.0004 +C 410.765905 0 5.6471 241 | 6/8
17 h-m-p 0.7133 8.0000 0.0031 ----------------.. | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765905 m 8.0000 284 | 6/8
19 h-m-p 0.0002 0.1198 9.3480 +++++ 410.765840 m 0.1198 300 | 7/8
20 h-m-p 0.9651 8.0000 0.2191 --------------Y 410.765840 0 0.0000 325 | 7/8
21 h-m-p 0.0160 8.0000 0.0000 ---------C 410.765840 0 0.0000 346
Out..
lnL = -410.765840
347 lfun, 347 eigenQcodon, 2082 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026386 0.070769 0.094961 0.095145 0.079573 0.028254 1.128705 0.860094 0.307486
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.485624
np = 9
lnL0 = -450.187628
Iterating by ming2
Initial: fx= 450.187628
x= 0.02639 0.07077 0.09496 0.09514 0.07957 0.02825 1.12871 0.86009 0.30749
1 h-m-p 0.0000 0.0003 238.1349 +++ 434.752017 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0000 295.0761 ++ 433.812639 m 0.0000 27 | 2/9
3 h-m-p 0.0000 0.0006 168.2779 +++ 417.188034 m 0.0006 40 | 3/9
4 h-m-p 0.0001 0.0004 111.3556 ++ 414.073972 m 0.0004 52 | 4/9
5 h-m-p 0.0000 0.0000 2834.6027 ++ 410.783269 m 0.0000 64 | 5/9
6 h-m-p 0.0000 0.0000 32298.5689 ++ 410.765874 m 0.0000 76 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 410.765874 m 8.0000 88 | 6/9
8 h-m-p 0.0010 0.4966 1.8688 ---------C 410.765874 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765874 m 8.0000 127 | 6/9
10 h-m-p 0.0131 6.5654 0.2963 ----------Y 410.765874 0 0.0000 152 | 6/9
11 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765874 m 8.0000 170 | 6/9
12 h-m-p 0.0082 4.1002 0.2262 -------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765874 m 8.0000 214 | 6/9
14 h-m-p 0.0151 7.5665 0.1704 ---------Y 410.765874 0 0.0000 238 | 6/9
15 h-m-p 0.0160 8.0000 0.0002 +++++ 410.765874 m 8.0000 256 | 6/9
16 h-m-p 0.0102 5.1063 0.2076 -------------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765874 m 8.0000 300 | 6/9
18 h-m-p 0.0152 7.5944 0.1699 -----------N 410.765874 0 0.0000 326 | 6/9
19 h-m-p 0.0160 8.0000 0.0003 +++++ 410.765873 m 8.0000 344 | 6/9
20 h-m-p 0.0127 6.3479 0.2208 -------------.. | 6/9
21 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765873 m 8.0000 388 | 6/9
22 h-m-p 0.0154 7.7186 0.1674 ----------C 410.765873 0 0.0000 413 | 6/9
23 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765873 m 8.0000 431 | 6/9
24 h-m-p 0.0060 2.9828 0.3408 ----------Y 410.765873 0 0.0000 456 | 6/9
25 h-m-p 0.0160 8.0000 0.0004 +++++ 410.765873 m 8.0000 474 | 6/9
26 h-m-p 0.0107 4.2415 0.2959 ------------Y 410.765873 0 0.0000 501 | 6/9
27 h-m-p 0.0160 8.0000 0.0010 +++++ 410.765872 m 8.0000 519 | 6/9
28 h-m-p 0.0246 3.9178 0.3212 -------------.. | 6/9
29 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765872 m 8.0000 563 | 6/9
30 h-m-p 0.0157 7.8443 0.1639 -------------.. | 6/9
31 h-m-p 0.0160 8.0000 0.0001 +++++ 410.765872 m 8.0000 607 | 6/9
32 h-m-p 0.0157 7.8406 0.1641 -----------C 410.765872 0 0.0000 633 | 6/9
33 h-m-p 0.0160 8.0000 0.0004 +++++ 410.765871 m 8.0000 651 | 6/9
34 h-m-p 0.0181 6.0638 0.1843 ----------Y 410.765871 0 0.0000 676 | 6/9
35 h-m-p 0.0160 8.0000 0.0004 +++++ 410.765871 m 8.0000 694 | 6/9
36 h-m-p 0.0179 5.7560 0.2010 ----------C 410.765871 0 0.0000 719 | 6/9
37 h-m-p 0.0160 8.0000 0.0017 ---------Y 410.765871 0 0.0000 743 | 6/9
38 h-m-p 0.0160 8.0000 0.0000 ----Y 410.765871 0 0.0000 762
Out..
lnL = -410.765871
763 lfun, 2289 eigenQcodon, 9156 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.076074 0.073921 0.038232 0.043702 0.039414 0.037853 1.109421 0.918657 0.364521 0.260996 2.801085
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.709079
np = 11
lnL0 = -439.792483
Iterating by ming2
Initial: fx= 439.792483
x= 0.07607 0.07392 0.03823 0.04370 0.03941 0.03785 1.10942 0.91866 0.36452 0.26100 2.80108
1 h-m-p 0.0000 0.0004 209.4986 +++ 419.081127 m 0.0004 17 | 1/11
2 h-m-p 0.0000 0.0002 35.8864 ++ 418.862006 m 0.0002 31 | 2/11
3 h-m-p 0.0000 0.0000 4555.5187 ++ 418.249199 m 0.0000 45 | 3/11
4 h-m-p 0.0000 0.0000 1833.6388 ++ 416.797145 m 0.0000 59 | 4/11
5 h-m-p 0.0000 0.0000 12300.4500 ++ 413.869785 m 0.0000 73 | 5/11
6 h-m-p 0.0422 3.4793 1.5831 --------------.. | 5/11
7 h-m-p 0.0000 0.0001 141.0969 ++ 410.955527 m 0.0001 113 | 6/11
8 h-m-p 0.0098 3.1686 1.4687 -------------.. | 6/11
9 h-m-p 0.0000 0.0000 103.2285 ++ 410.765901 m 0.0000 152 | 7/11
10 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765901 m 8.0000 198 | 7/11
12 h-m-p 0.0160 8.0000 3.7367 ----------C 410.765901 0 0.0000 226 | 7/11
13 h-m-p 0.0160 8.0000 0.0012 +++++ 410.765901 m 8.0000 243 | 7/11
14 h-m-p 0.0160 8.0000 0.9707 ---------Y 410.765901 0 0.0000 270 | 7/11
15 h-m-p 0.0160 8.0000 0.0053 +++++ 410.765900 m 8.0000 291 | 7/11
16 h-m-p 0.0427 8.0000 1.0011 --------------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765900 m 8.0000 338 | 7/11
18 h-m-p 0.0160 8.0000 0.0066 +++++ 410.765900 m 8.0000 359 | 7/11
19 h-m-p 0.0559 8.0000 0.9505 -----------C 410.765900 0 0.0000 388 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 -------N 410.765900 0 0.0000 413 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765900 m 8.0000 434 | 7/11
22 h-m-p 0.0160 8.0000 0.7464 -----------C 410.765900 0 0.0000 463 | 7/11
23 h-m-p 0.0160 8.0000 0.0000 +++++ 410.765900 m 8.0000 484 | 7/11
24 h-m-p 0.0160 8.0000 0.3700 ----------Y 410.765900 0 0.0000 512 | 7/11
25 h-m-p 0.0160 8.0000 0.0000 -----N 410.765900 0 0.0000 535 | 7/11
26 h-m-p 0.0160 8.0000 0.0000 -Y 410.765900 0 0.0010 554
Out..
lnL = -410.765900
555 lfun, 2220 eigenQcodon, 9990 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -410.769817 S = -410.764161 -0.002162
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:06
did 20 / 44 patterns 0:06
did 30 / 44 patterns 0:06
did 40 / 44 patterns 0:06
did 44 / 44 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021394 0.059613 0.033040 0.030450 0.076569 0.069654 1.043184 0.796535 1.067924
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.468259
np = 9
lnL0 = -439.721964
Iterating by ming2
Initial: fx= 439.721964
x= 0.02139 0.05961 0.03304 0.03045 0.07657 0.06965 1.04318 0.79653 1.06792
1 h-m-p 0.0000 0.0002 236.4527 +++ 427.222051 m 0.0002 15 | 1/9
2 h-m-p 0.0019 0.0211 24.8287 ++ 422.249316 m 0.0211 27 | 2/9
3 h-m-p 0.0000 0.0000 20296.0719 ++ 421.350769 m 0.0000 39 | 3/9
4 h-m-p 0.0003 0.0013 79.1364 ++ 416.059110 m 0.0013 51 | 4/9
5 h-m-p 0.0020 0.0101 27.6630 ++ 415.028132 m 0.0101 63 | 5/9
6 h-m-p 0.0003 0.0014 92.5057 ++ 414.260624 m 0.0014 75 | 6/9
7 h-m-p 0.0027 0.0144 47.0366 ++ 412.191323 m 0.0144 87 | 7/9
8 h-m-p 0.0056 0.0282 4.9522 ++ 410.765706 m 0.0282 99 | 8/9
9 h-m-p 1.6000 8.0000 0.0041 ++ 410.765706 m 8.0000 111 | 8/9
10 h-m-p 1.6000 8.0000 0.0013 ++ 410.765706 m 8.0000 124 | 8/9
11 h-m-p 0.1227 8.0000 0.0848 ---C 410.765706 0 0.0007 140 | 8/9
12 h-m-p 0.3333 8.0000 0.0002 C 410.765706 0 0.0833 153 | 8/9
13 h-m-p 0.1429 8.0000 0.0001 Y 410.765706 0 0.1429 166 | 8/9
14 h-m-p 0.1667 8.0000 0.0001 C 410.765706 0 0.0521 179 | 8/9
15 h-m-p 0.3333 8.0000 0.0000 Y 410.765706 0 0.0833 192 | 8/9
16 h-m-p 0.2857 8.0000 0.0000 ---------------.. | 8/9
17 h-m-p 0.0160 8.0000 0.0000 -----N 410.765706 0 0.0000 236
Out..
lnL = -410.765706
237 lfun, 2607 eigenQcodon, 14220 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.053249 0.049031 0.063856 0.018940 0.075255 0.025169 0.000100 0.900000 1.086027 1.031647 2.822172
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 11.100512
np = 11
lnL0 = -437.420723
Iterating by ming2
Initial: fx= 437.420723
x= 0.05325 0.04903 0.06386 0.01894 0.07526 0.02517 0.00011 0.90000 1.08603 1.03165 2.82217
1 h-m-p 0.0000 0.0000 210.4138 ++ 437.215465 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0008 132.1292 ++++ 426.846831 m 0.0008 32 | 2/11
3 h-m-p 0.0000 0.0001 368.6945 ++ 424.057980 m 0.0001 46 | 3/11
4 h-m-p 0.0014 0.0602 15.3864 +++ 416.640220 m 0.0602 61 | 4/11
5 h-m-p 0.0000 0.0002 941.4378 ++ 414.517832 m 0.0002 75 | 5/11
6 h-m-p 0.0005 0.0027 200.5813 ++ 413.937750 m 0.0027 89 | 6/11
7 h-m-p 0.0001 0.0006 681.7066
QuantileBeta(0.15, 0.00500, 2.24350) = 1.165107e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 413.457676 m 0.0006 103
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
8 h-m-p 0.0006 0.0154 669.9974
QuantileBeta(0.15, 0.00500, 2.59539) = 9.734286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37519) = 1.085221e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.32015) = 1.117256e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30638) = 1.125560e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30294) = 1.127655e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30208) = 1.128180e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30187) = 1.128311e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30181) = 1.128344e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128352e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
9 h-m-p 0.0000 0.0003 100.0221
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 410.765914 m 0.0003 141
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 8/11
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 410.765914 m 8.0000 155
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 8/11
11 h-m-p 0.0160 8.0000 0.0035
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 410.765913 m 8.0000 175
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 8/11
12 h-m-p 0.0160 8.0000 2.1067
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
Y 410.765913 0 0.0000 203
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128354e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 8/11
13 h-m-p 0.0248 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
Y 410.765913 0 0.0039 217
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
14 h-m-p -0.0000 -0.0000 0.0004
h-m-p: -0.00000000e+00 -0.00000000e+00 4.39967151e-04 410.765913
..
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
15 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 410.765913 m 8.0000 252
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
16 h-m-p 0.0003 0.0013 0.2766
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
Y 410.765913 0 0.0000 279
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
17 h-m-p 0.0160 8.0000 0.0070
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
+ 410.765911 m 8.0000 300
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
18 h-m-p 0.0410 0.2049 0.2854
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
C 410.765911 0 0.0000 328
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.167745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30192) = 1.128279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30167) = 1.128431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
| 7/11
19 h-m-p 0.0160 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30179) = 1.128356e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30179) = 1.128359e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30177) = 1.128372e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30168) = 1.128423e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
+ 410.765911 m 8.0000 349
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.167883e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30170) = 1.128412e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30145) = 1.128564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
| 7/11
20 h-m-p 0.0145 2.4162 0.2402
QuantileBeta(0.15, 0.00500, 2.30180) = 1.128355e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30163) = 1.128455e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30159) = 1.128480e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128486e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
Y 410.765911 0 0.0000 378
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.167883e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30170) = 1.128412e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30145) = 1.128564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30158) = 1.128488e-160 2000 rounds
| 7/11
21 h-m-p 0.0160 8.0000 0.0145
QuantileBeta(0.15, 0.00500, 2.30157) = 1.128493e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.30155) = 1.128507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30145) = 1.128563e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.30108) = 1.128789e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29961) = 1.129692e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
+ 410.765902 m 8.0000 399
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.170318e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29786) = 1.130765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29761) = 1.130917e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
| 7/11
22 h-m-p 0.1997 0.9986 0.2705
QuantileBeta(0.15, 0.00500, 2.29953) = 1.129743e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29818) = 1.130566e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29785) = 1.130772e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130824e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29774) = 1.130837e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29774) = 1.130840e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
N 410.765902 0 0.0000 431
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.170318e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29786) = 1.130765e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29761) = 1.130917e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
| 7/11
23 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130841e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29774) = 1.130839e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29774) = 1.130834e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+ 410.765902 m 8.0000 452
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.170305e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29788) = 1.130752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29763) = 1.130904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
| 7/11
24 h-m-p 0.0007 0.3552 0.2525
QuantileBeta(0.15, 0.00500, 2.29765) = 1.130891e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29773) = 1.130844e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130832e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130829e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
Y 410.765902 0 0.0000 479
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.170305e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29788) = 1.130752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29763) = 1.130904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
| 7/11
25 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130829e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.170305e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29788) = 1.130752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29763) = 1.130904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
| 7/11
26 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
+ 410.765902 m 8.0000 529
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.170305e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29788) = 1.130752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29763) = 1.130904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
| 7/11
27 h-m-p 0.0078 3.9072 0.1788
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
C 410.765902 0 0.0000 558
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.170305e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29788) = 1.130752e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29763) = 1.130904e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
| 7/11
28 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29775) = 1.130830e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29774) = 1.130837e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29769) = 1.130865e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29751) = 1.130977e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
+ 410.765902 m 8.0000 579
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.170607e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29740) = 1.131044e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29715) = 1.131196e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
| 7/11
29 h-m-p 0.0025 0.0138 0.3052
QuantileBeta(0.15, 0.00500, 2.29776) = 1.130828e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29740) = 1.131047e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29731) = 1.131102e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29729) = 1.131115e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131119e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
Y 410.765902 0 0.0000 606
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.170607e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29740) = 1.131043e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29715) = 1.131196e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29728) = 1.131120e-160 2000 rounds
| 7/11
30 h-m-p 0.0160 8.0000 0.0007
QuantileBeta(0.15, 0.00500, 2.29727) = 1.131125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29725) = 1.131139e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29715) = 1.131198e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29677) = 1.131432e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29524) = 1.132370e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
+ 410.765902 m 8.0000 627
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.173137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29343) = 1.133488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29318) = 1.133641e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
| 7/11
31 h-m-p 0.0123 0.0615 0.2904
QuantileBeta(0.15, 0.00500, 2.29597) = 1.131923e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29397) = 1.133154e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29347) = 1.133462e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29335) = 1.133539e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29332) = 1.133558e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29331) = 1.133563e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29331) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29331) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29331) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
C 410.765902 0 0.0000 657
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.173137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29343) = 1.133488e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29318) = 1.133641e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
| 7/11
32 h-m-p 0.0160 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133565e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133569e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133583e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29319) = 1.133638e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29283) = 1.133858e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
+ 410.765902 m 8.0000 678
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.173730e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29250) = 1.134061e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29225) = 1.134214e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
| 7/11
33 h-m-p 0.0053 0.0377 0.3031
QuantileBeta(0.15, 0.00500, 2.29330) = 1.133564e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29261) = 1.133994e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29243) = 1.134101e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29239) = 1.134128e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134135e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
C 410.765902 0 0.0000 706
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.173730e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29250) = 1.134061e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29225) = 1.134214e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
| 7/11
34 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134138e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29237) = 1.134139e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29236) = 1.134146e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29232) = 1.134170e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
+ 410.765902 m 8.0000 727
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.173797e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29240) = 1.134125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29215) = 1.134279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
| 7/11
35 h-m-p 0.0010 0.0553 0.3290
QuantileBeta(0.15, 0.00500, 2.29238) = 1.134137e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29230) = 1.134186e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29228) = 1.134198e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134201e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
N 410.765902 0 0.0000 755
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.173797e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29240) = 1.134125e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29215) = 1.134279e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
| 7/11
36 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134203e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134204e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29226) = 1.134212e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29221) = 1.134241e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29202) = 1.134358e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+ 410.765902 m 8.0000 776
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
37 h-m-p 0.0039 0.0498 0.2908
QuantileBeta(0.15, 0.00500, 2.29227) = 1.134202e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29181) = 1.134488e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134503e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134506e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
38 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+ 410.765902 m 8.0000 825
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
39 h-m-p 0.0081 4.0336 0.1749
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
C 410.765902 0 0.0000 853
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
40 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+ 410.765902 m 8.0000 874
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
41 h-m-p 0.0120 5.9806 1.3158
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134506e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
42 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
+ 410.765901 m 8.0000 920
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
43 h-m-p 0.0048 2.4029 0.2939
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
Y 410.765901 0 0.0000 947
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.174113e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29190) = 1.134431e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29165) = 1.134584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134507e-160 2000 rounds
| 7/11
44 h-m-p 0.0160 8.0000 0.0023
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134508e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29177) = 1.134511e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29176) = 1.134520e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29169) = 1.134559e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29144) = 1.134714e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+ 410.765900 m 8.0000 968
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.174530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29125) = 1.134834e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29100) = 1.134987e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
| 7/11
45 h-m-p 0.0418 0.2090 0.1868
QuantileBeta(0.15, 0.00500, 2.29140) = 1.134740e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29119) = 1.134868e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29114) = 1.134900e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29113) = 1.134908e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.174530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29125) = 1.134834e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29100) = 1.134987e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
| 7/11
46 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
+ 410.765899 m 8.0000 1019
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.174530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29125) = 1.134834e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29100) = 1.134987e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
| 7/11
47 h-m-p 0.0088 4.4007 0.1649
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
Y 410.765899 0 0.0000 1048
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.174530e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29125) = 1.134834e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29100) = 1.134987e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
| 7/11
48 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134911e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134912e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29111) = 1.134916e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29109) = 1.134932e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29098) = 1.134998e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
+ 410.765899 m 8.0000 1069
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.174708e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29097) = 1.135006e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29072) = 1.135159e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
| 7/11
49 h-m-p 0.0016 0.0175 0.4525
QuantileBeta(0.15, 0.00500, 2.29112) = 1.134910e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29091) = 1.135039e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29086) = 1.135072e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135080e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
Y 410.765899 0 0.0000 1096
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.174708e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29097) = 1.135006e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29072) = 1.135159e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
| 7/11
50 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29084) = 1.135083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135083e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
C 410.765899 0 0.0000 1118
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.174708e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29097) = 1.135006e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29072) = 1.135159e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
| 7/11
51 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135080e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29086) = 1.135074e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29090) = 1.135050e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+ 410.765899 m 8.0000 1139
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
52 h-m-p 0.0005 0.0295 0.3689
QuantileBeta(0.15, 0.00500, 2.29085) = 1.135082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29092) = 1.135035e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29094) = 1.135023e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135020e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
53 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+ 410.765899 m 8.0000 1187
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
54 h-m-p 0.0089 4.4277 0.1642
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
55 h-m-p 0.0160 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
+ 410.765899 m 8.0000 1237
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
56 h-m-p 0.0089 4.4418 0.1639
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
Y 410.765899 0 0.0000 1265
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.174642e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29107) = 1.134942e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29082) = 1.135096e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
| 7/11
57 h-m-p 0.0160 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135018e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135015e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29097) = 1.135004e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29105) = 1.134957e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29135) = 1.134770e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
+ 410.765899 m 8.0000 1286
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.174139e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29186) = 1.134456e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29161) = 1.134609e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
| 7/11
58 h-m-p 0.0102 0.0709 0.2234
QuantileBeta(0.15, 0.00500, 2.29095) = 1.135019e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29154) = 1.134654e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29169) = 1.134563e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29172) = 1.134540e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29173) = 1.134535e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29173) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
Y 410.765899 0 0.0000 1315
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.174139e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29186) = 1.134456e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29161) = 1.134609e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
| 7/11
59 h-m-p 0.0160 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29175) = 1.134525e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29178) = 1.134502e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29193) = 1.134410e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29253) = 1.134043e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
+ 410.765899 m 8.0000 1336
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.173150e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29341) = 1.133501e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29316) = 1.133654e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
| 7/11
60 h-m-p 0.0081 0.2909 0.2704
QuantileBeta(0.15, 0.00500, 2.29174) = 1.134533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29290) = 1.133816e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29319) = 1.133637e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29326) = 1.133592e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133581e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133578e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133578e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
Y 410.765899 0 0.0000 1365
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.173150e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29341) = 1.133501e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29316) = 1.133654e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
| 7/11
61 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
N 410.765899 0 0.0000 1388
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.173150e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29341) = 1.133501e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29316) = 1.133654e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
| 7/11
62 h-m-p 0.0160 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.29329) = 1.133576e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
Y 410.765899 0 0.0000 1414
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
Out..
lnL = -410.765899
1415 lfun, 16980 eigenQcodon, 93390 P(t)
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -410.770415 S = -410.763892 -0.002859
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 44 patterns 0:34
did 20 / 44 patterns 0:34
did 30 / 44 patterns 0:34
did 40 / 44 patterns 0:34
did 44 / 44 patterns 0:34
QuantileBeta(0.15, 0.00500, 2.29328) = 1.133577e-160 2000 rounds
Time used: 0:34
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=104
NC_011896_1_WP_010907630_1_254_MLBR_RS01245 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
NC_002677_1_NP_301306_1_178_arsC MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
**************************************************
NC_011896_1_WP_010907630_1_254_MLBR_RS01245 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
NC_002677_1_NP_301306_1_178_arsC KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350 KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
**************************************************
NC_011896_1_WP_010907630_1_254_MLBR_RS01245 HEIR
NC_002677_1_NP_301306_1_178_arsC HEIR
NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685 HEIR
NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590 HEIR
NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305 HEIR
NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350 HEIR
****
>NC_011896_1_WP_010907630_1_254_MLBR_RS01245 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG >NC_002677_1_NP_301306_1_178_arsC ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG >NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG >NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG >NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG >NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350 ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA CACGAAATTCGG
>NC_011896_1_WP_010907630_1_254_MLBR_RS01245 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR >NC_002677_1_NP_301306_1_178_arsC MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR >NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR >NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR >NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR >NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350 MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV HEIR
#NEXUS
[ID: 8861644520]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907630_1_254_MLBR_RS01245
NC_002677_1_NP_301306_1_178_arsC
NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685
NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590
NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305
NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907630_1_254_MLBR_RS01245,
2 NC_002677_1_NP_301306_1_178_arsC,
3 NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685,
4 NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590,
5 NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305,
6 NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07014891,2:0.07001904,3:0.06772146,4:0.06737519,5:0.06992396,6:0.06968301);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07014891,2:0.07001904,3:0.06772146,4:0.06737519,5:0.06992396,6:0.06968301);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -431.45 -434.48
2 -431.47 -435.27
--------------------------------------
TOTAL -431.46 -434.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.899568 0.093368 0.329596 1.481552 0.864827 1472.86 1486.93 1.000
r(A<->C){all} 0.157864 0.018352 0.000091 0.434498 0.122103 257.58 276.04 1.000
r(A<->G){all} 0.169722 0.020245 0.000003 0.450827 0.131837 106.38 226.89 1.006
r(A<->T){all} 0.176700 0.020789 0.000006 0.451908 0.144262 168.82 227.05 1.004
r(C<->G){all} 0.168430 0.021380 0.000116 0.468843 0.128900 202.29 244.40 1.002
r(C<->T){all} 0.167912 0.018850 0.000108 0.449825 0.136554 246.50 355.04 1.003
r(G<->T){all} 0.159372 0.019836 0.000099 0.453162 0.121746 179.85 203.67 1.001
pi(A){all} 0.275331 0.000646 0.227257 0.325539 0.274766 906.79 1045.93 1.000
pi(C){all} 0.281555 0.000645 0.232296 0.331151 0.281090 1086.43 1163.75 1.000
pi(G){all} 0.243378 0.000579 0.197488 0.290679 0.242311 1191.28 1331.87 1.000
pi(T){all} 0.199737 0.000494 0.155881 0.242601 0.199640 1308.01 1335.97 1.000
alpha{1,2} 0.421818 0.231454 0.000132 1.364516 0.257399 1088.74 1198.59 1.001
alpha{3} 0.449780 0.218626 0.000113 1.393478 0.297395 1382.50 1441.75 1.000
pinvar{all} 0.995030 0.000036 0.983556 0.999998 0.996888 1356.86 1379.16 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/arsC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 104
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 2 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 1 1 1 1 1 1
TTC 2 2 2 2 2 2 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 1 1 1 1 1 1 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 0 0 0 0 0 0 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 2 2 2 2 2 2 | CCC 0 0 0 0 0 0 | CAC 4 4 4 4 4 4 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 0 0 0 0 0 0 | CGA 1 1 1 1 1 1
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 2 2 2 2 2 2 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 3 3 3 3 3 3 | ACC 5 5 5 5 5 5 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 4 4 4 4 4 4 | Arg AGA 0 0 0 0 0 0
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 4 4 4 4 4 4 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 2 2 2 2 2 | Asp GAT 4 4 4 4 4 4 | Gly GGT 0 0 0 0 0 0
GTC 2 2 2 2 2 2 | GCC 4 4 4 4 4 4 | GAC 4 4 4 4 4 4 | GGC 1 1 1 1 1 1
GTA 3 3 3 3 3 3 | GCA 0 0 0 0 0 0 | Glu GAA 6 6 6 6 6 6 | GGA 0 0 0 0 0 0
GTG 3 3 3 3 3 3 | GCG 3 3 3 3 3 3 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907630_1_254_MLBR_RS01245
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
#2: NC_002677_1_NP_301306_1_178_arsC
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
#3: NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
#4: NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
#5: NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
#6: NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 12 | Ser S TCT 6 | Tyr Y TAT 6 | Cys C TGT 6
TTC 12 | TCC 12 | TAC 6 | TGC 0
Leu L TTA 6 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 0 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 12 | CCC 0 | CAC 24 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 0 | CGA 6
CTG 30 | CCG 24 | CAG 12 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 6
ATC 18 | ACC 30 | AAC 18 | AGC 12
ATA 0 | ACA 0 | Lys K AAA 24 | Arg R AGA 0
Met M ATG 24 | ACG 6 | AAG 24 | AGG 6
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 12 | Asp D GAT 24 | Gly G GGT 0
GTC 12 | GCC 24 | GAC 24 | GGC 6
GTA 18 | GCA 0 | Glu E GAA 36 | GGA 0
GTG 18 | GCG 18 | GAG 6 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10577 C:0.25962 A:0.31731 G:0.31731
position 2: T:0.30769 C:0.23077 A:0.34615 G:0.11538
position 3: T:0.18269 C:0.35577 A:0.16346 G:0.29808
Average T:0.19872 C:0.28205 A:0.27564 G:0.24359
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -410.765840 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.128705 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907630_1_254_MLBR_RS01245: 0.000004, NC_002677_1_NP_301306_1_178_arsC: 0.000004, NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685: 0.000004, NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590: 0.000004, NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305: 0.000004, NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.12871
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 242.6 69.4 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -410.765871 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.109421 0.910652 0.099479
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907630_1_254_MLBR_RS01245: 0.000004, NC_002677_1_NP_301306_1_178_arsC: 0.000004, NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685: 0.000004, NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590: 0.000004, NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305: 0.000004, NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.10942
MLEs of dN/dS (w) for site classes (K=2)
p: 0.91065 0.08935
w: 0.09948 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
7..2 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
7..3 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
7..4 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
7..5 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
7..6 0.000 242.8 69.2 0.1799 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -410.765900 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 1.043184 0.547648 0.261201 0.000001 2.830509
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907630_1_254_MLBR_RS01245: 0.000004, NC_002677_1_NP_301306_1_178_arsC: 0.000004, NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685: 0.000004, NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590: 0.000004, NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305: 0.000004, NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 1.04318
MLEs of dN/dS (w) for site classes (K=3)
p: 0.54765 0.26120 0.19115
w: 0.00000 1.00000 2.83051
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
7..2 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
7..3 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
7..4 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
7..5 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
7..6 0.000 243.5 68.5 0.8023 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907630_1_254_MLBR_RS01245)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907630_1_254_MLBR_RS01245)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -410.765706 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.609488
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907630_1_254_MLBR_RS01245: 0.000004, NC_002677_1_NP_301306_1_178_arsC: 0.000004, NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685: 0.000004, NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590: 0.000004, NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305: 0.000004, NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.60949
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 260.0 52.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -410.765899 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.007292 0.727884 0.005000 2.293284 3.795791
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907630_1_254_MLBR_RS01245: 0.000004, NC_002677_1_NP_301306_1_178_arsC: 0.000004, NZ_LVXE01000009_1_WP_010907630_1_2851_A3216_RS04685: 0.000004, NZ_LYPH01000016_1_WP_010907630_1_550_A8144_RS02590: 0.000004, NZ_CP029543_1_WP_010907630_1_253_DIJ64_RS01305: 0.000004, NZ_AP014567_1_WP_010907630_1_262_JK2ML_RS01350: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00729
Parameters in M8 (beta&w>1):
p0 = 0.72788 p = 0.00500 q = 2.29328
(p1 = 0.27212) w = 3.79579
MLEs of dN/dS (w) for site classes (K=11)
p: 0.07279 0.07279 0.07279 0.07279 0.07279 0.07279 0.07279 0.07279 0.07279 0.07279 0.27212
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 3.79579
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
7..2 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
7..3 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
7..4 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
7..5 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
7..6 0.000 259.9 52.1 1.0329 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907630_1_254_MLBR_RS01245)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907630_1_254_MLBR_RS01245)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:34
Model 1: NearlyNeutral -410.765871 Model 2: PositiveSelection -410.7659 Model 0: one-ratio -410.76584 Model 7: beta -410.765706 Model 8: beta&w>1 -410.765899 Model 0 vs 1 6.199999995715189E-5 Model 2 vs 1 5.7999999967250915E-5 Model 8 vs 7 3.859999999349384E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
