--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 09:53:40 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/arsC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -431.45          -434.48
2       -431.47          -435.27
--------------------------------------
TOTAL     -431.46          -434.95
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.899568    0.093368    0.329596    1.481552    0.864827   1472.86   1486.93    1.000
r(A<->C){all}   0.157864    0.018352    0.000091    0.434498    0.122103    257.58    276.04    1.000
r(A<->G){all}   0.169722    0.020245    0.000003    0.450827    0.131837    106.38    226.89    1.006
r(A<->T){all}   0.176700    0.020789    0.000006    0.451908    0.144262    168.82    227.05    1.004
r(C<->G){all}   0.168430    0.021380    0.000116    0.468843    0.128900    202.29    244.40    1.002
r(C<->T){all}   0.167912    0.018850    0.000108    0.449825    0.136554    246.50    355.04    1.003
r(G<->T){all}   0.159372    0.019836    0.000099    0.453162    0.121746    179.85    203.67    1.001
pi(A){all}      0.275331    0.000646    0.227257    0.325539    0.274766    906.79   1045.93    1.000
pi(C){all}      0.281555    0.000645    0.232296    0.331151    0.281090   1086.43   1163.75    1.000
pi(G){all}      0.243378    0.000579    0.197488    0.290679    0.242311   1191.28   1331.87    1.000
pi(T){all}      0.199737    0.000494    0.155881    0.242601    0.199640   1308.01   1335.97    1.000
alpha{1,2}      0.421818    0.231454    0.000132    1.364516    0.257399   1088.74   1198.59    1.001
alpha{3}        0.449780    0.218626    0.000113    1.393478    0.297395   1382.50   1441.75    1.000
pinvar{all}     0.995030    0.000036    0.983556    0.999998    0.996888   1356.86   1379.16    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-410.765871
Model 2: PositiveSelection	-410.7659
Model 0: one-ratio	-410.76584
Model 7: beta	-410.765706
Model 8: beta&w>1	-410.765899


Model 0 vs 1	6.199999995715189E-5

Model 2 vs 1	5.7999999967250915E-5

Model 8 vs 7	3.859999999349384E-4
>C1
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C2
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C3
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C4
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C5
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C6
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=104 

C1              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C2              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C3              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C4              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C5              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C6              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
                **************************************************

C1              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C2              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C3              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C4              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C5              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C6              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
                **************************************************

C1              HEIR
C2              HEIR
C3              HEIR
C4              HEIR
C5              HEIR
C6              HEIR
                ****




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  104 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  104 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [3120]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [3120]--->[3120]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.450 Mb, Max= 30.624 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C2              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C3              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C4              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C5              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
C6              MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
                **************************************************

C1              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C2              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C3              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C4              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C5              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
C6              KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
                **************************************************

C1              HEIR
C2              HEIR
C3              HEIR
C4              HEIR
C5              HEIR
C6              HEIR
                ****




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C2              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C3              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C4              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C5              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
C6              ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
                **************************************************

C1              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C2              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C3              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C4              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C5              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
C6              TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
                **************************************************

C1              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C2              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C3              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C4              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C5              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
C6              TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
                **************************************************

C1              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C2              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C3              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C4              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C5              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
C6              AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
                **************************************************

C1              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C2              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C3              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C4              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C5              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
C6              GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
                **************************************************

C1              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C2              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C3              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C4              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C5              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
C6              TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
                **************************************************

C1              CACGAAATTCGG
C2              CACGAAATTCGG
C3              CACGAAATTCGG
C4              CACGAAATTCGG
C5              CACGAAATTCGG
C6              CACGAAATTCGG
                ************



>C1
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C2
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C3
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C4
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C5
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C6
ATGTACAGCACCTCTTGTAAGATGCTAAACTTAGTGCGAAAGAAAGATTT
TAATCACATCACCGCGGAATATCTGAGTATGCCGCCATCCAGGAGCGAAC
TGGTAAAAATTATTCACATCGACGATGTGGATGTGCTCACTGCTGTACGC
AAACATGAACCGTTCGACGCCGAACTGAACCTCGCCACCGCGACCGATGA
GCAGCTGCTGGACTCCATGGCCGAACACAACACCCGCTTCAAACGGCTTT
TTGTCGTCACGCCGAAGGGCGCCCGGCAGGCTAAGCCGATCGACGCGGTA
CACGAAATTCGG
>C1
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C2
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C3
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C4
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C5
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR
>C6
MYSTSCKMLNLVRKKDFNHITAEYLSMPPSRSELVKIIHIDDVDVLTAVR
KHEPFDAELNLATATDEQLLDSMAEHNTRFKRLFVVTPKGARQAKPIDAV
HEIR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 312 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579773127
      Setting output file names to "/data/1res/arsC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1612955149
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 8861644520
      Seed = 1287374584
      Swapseed = 1579773127
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -698.270960 -- -24.965149
         Chain 2 -- -698.270960 -- -24.965149
         Chain 3 -- -698.270921 -- -24.965149
         Chain 4 -- -698.270921 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -698.270960 -- -24.965149
         Chain 2 -- -698.270921 -- -24.965149
         Chain 3 -- -698.270960 -- -24.965149
         Chain 4 -- -698.270960 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-698.271] (-698.271) (-698.271) (-698.271) * [-698.271] (-698.271) (-698.271) (-698.271) 
        500 -- (-439.851) [-442.639] (-443.314) (-438.225) * (-443.800) (-445.542) [-438.698] (-441.175) -- 0:00:00
       1000 -- (-441.966) (-445.432) [-440.672] (-441.575) * (-442.190) (-438.047) [-440.514] (-439.466) -- 0:00:00
       1500 -- (-437.673) (-442.984) [-443.398] (-435.120) * (-446.403) [-437.342] (-439.875) (-437.853) -- 0:00:00
       2000 -- (-442.704) (-441.294) [-435.375] (-443.771) * (-437.655) (-440.798) [-439.021] (-449.946) -- 0:00:00
       2500 -- [-442.033] (-441.202) (-443.520) (-446.146) * (-444.757) (-437.815) [-439.014] (-451.701) -- 0:00:00
       3000 -- (-440.269) (-446.274) (-441.537) [-443.563] * (-437.057) (-438.814) [-438.927] (-447.741) -- 0:00:00
       3500 -- [-437.980] (-436.683) (-440.747) (-440.142) * (-439.242) (-440.200) (-442.267) [-441.288] -- 0:00:00
       4000 -- (-446.712) (-445.926) [-437.263] (-443.253) * (-440.507) [-439.639] (-440.736) (-438.143) -- 0:00:00
       4500 -- (-451.589) (-440.940) (-441.208) [-435.942] * (-437.521) [-439.088] (-446.481) (-446.770) -- 0:00:00
       5000 -- (-449.466) (-440.341) [-437.633] (-438.093) * (-446.526) [-438.650] (-439.707) (-444.509) -- 0:00:00

      Average standard deviation of split frequencies: 0.111304

       5500 -- (-439.472) [-438.640] (-446.676) (-438.883) * (-441.648) (-440.664) [-446.065] (-441.308) -- 0:00:00
       6000 -- (-431.506) [-442.995] (-436.468) (-441.892) * (-439.295) (-441.858) (-446.034) [-439.963] -- 0:00:00
       6500 -- (-431.692) [-436.296] (-451.556) (-440.534) * [-436.356] (-446.730) (-437.396) (-440.814) -- 0:00:00
       7000 -- [-434.888] (-448.801) (-446.784) (-455.506) * (-439.183) (-444.058) (-440.327) [-438.036] -- 0:00:00
       7500 -- [-433.596] (-438.817) (-440.263) (-456.056) * [-435.813] (-440.149) (-438.242) (-444.864) -- 0:00:00
       8000 -- (-434.135) (-435.349) [-441.845] (-449.616) * (-437.693) (-438.383) (-443.379) [-440.983] -- 0:00:00
       8500 -- (-431.814) [-447.715] (-453.407) (-432.417) * [-448.906] (-443.942) (-445.912) (-442.448) -- 0:00:00
       9000 -- (-431.077) [-441.422] (-449.583) (-432.369) * [-434.144] (-444.549) (-440.446) (-441.597) -- 0:00:00
       9500 -- (-433.664) [-449.848] (-440.745) (-434.168) * (-433.654) (-448.382) (-444.914) [-436.625] -- 0:00:00
      10000 -- (-432.809) [-438.402] (-438.563) (-430.764) * (-435.117) [-440.331] (-439.766) (-436.756) -- 0:00:00

      Average standard deviation of split frequencies: 0.041739

      10500 -- (-432.800) (-440.039) (-440.650) [-432.057] * (-431.876) (-444.585) (-437.643) [-440.456] -- 0:00:00
      11000 -- (-433.007) (-447.777) (-447.991) [-434.219] * (-432.197) [-441.399] (-441.220) (-441.500) -- 0:00:00
      11500 -- (-443.178) [-437.502] (-443.700) (-431.311) * (-436.969) (-439.530) (-441.857) [-434.586] -- 0:00:00
      12000 -- (-438.610) (-438.011) (-440.891) [-432.281] * (-431.929) (-444.499) [-442.961] (-442.323) -- 0:00:00
      12500 -- (-431.383) (-443.893) [-443.280] (-431.065) * [-435.809] (-446.606) (-439.683) (-437.726) -- 0:00:00
      13000 -- [-430.845] (-444.239) (-442.415) (-433.468) * (-434.077) (-440.535) [-445.904] (-447.095) -- 0:00:00
      13500 -- [-431.235] (-448.408) (-439.607) (-433.735) * (-432.334) (-444.909) [-442.749] (-442.368) -- 0:00:00
      14000 -- (-432.576) (-440.762) (-445.014) [-430.641] * (-432.190) [-436.883] (-443.369) (-439.547) -- 0:00:00
      14500 -- (-432.931) [-439.130] (-440.242) (-430.001) * (-433.200) (-445.711) [-439.227] (-448.402) -- 0:00:00
      15000 -- (-434.316) [-439.871] (-439.428) (-431.232) * (-431.429) (-438.192) (-439.944) [-440.601] -- 0:00:00

      Average standard deviation of split frequencies: 0.055652

      15500 -- (-435.069) (-455.183) (-452.832) [-432.440] * (-433.086) (-440.177) (-440.474) [-438.473] -- 0:01:03
      16000 -- (-432.581) (-455.117) (-441.483) [-432.847] * (-431.716) (-441.021) [-436.674] (-443.002) -- 0:01:01
      16500 -- [-431.133] (-431.072) (-442.177) (-433.233) * (-432.212) (-440.620) [-436.986] (-443.394) -- 0:00:59
      17000 -- [-434.181] (-432.223) (-436.007) (-433.360) * (-431.967) [-442.576] (-440.782) (-439.164) -- 0:00:57
      17500 -- (-434.418) (-437.181) [-437.658] (-430.554) * (-432.482) (-434.527) [-439.897] (-438.686) -- 0:00:56
      18000 -- [-434.092] (-431.378) (-447.613) (-430.448) * (-435.457) (-438.526) (-443.154) [-439.550] -- 0:00:54
      18500 -- (-436.090) (-430.749) [-444.341] (-432.091) * (-431.806) (-440.207) (-446.530) [-437.097] -- 0:00:53
      19000 -- (-433.297) (-432.833) (-443.131) [-432.520] * (-432.663) (-437.202) [-438.438] (-436.585) -- 0:00:51
      19500 -- (-432.003) (-432.859) [-438.307] (-436.469) * (-430.524) [-440.771] (-441.945) (-445.894) -- 0:00:50
      20000 -- (-434.560) [-431.501] (-439.772) (-435.918) * [-430.997] (-443.680) (-436.716) (-440.954) -- 0:00:49

      Average standard deviation of split frequencies: 0.064628

      20500 -- (-431.228) (-432.824) (-447.795) [-431.025] * (-433.124) (-452.002) [-440.943] (-440.282) -- 0:00:47
      21000 -- [-430.328] (-434.371) (-439.913) (-431.069) * (-434.902) (-443.721) [-444.071] (-440.943) -- 0:00:46
      21500 -- (-432.005) (-436.318) [-436.967] (-430.685) * (-432.948) (-441.863) [-447.329] (-445.906) -- 0:00:45
      22000 -- (-431.818) (-433.460) (-438.122) [-432.743] * [-431.479] (-437.653) (-445.787) (-440.781) -- 0:00:44
      22500 -- (-433.603) [-432.285] (-443.560) (-433.158) * (-433.706) [-438.283] (-448.645) (-442.055) -- 0:00:43
      23000 -- (-433.586) (-433.552) (-436.532) [-432.600] * (-438.007) [-435.246] (-441.288) (-443.155) -- 0:00:42
      23500 -- (-432.331) (-431.933) (-443.277) [-432.033] * (-432.072) (-441.375) (-445.424) [-440.745] -- 0:00:41
      24000 -- (-430.813) (-431.066) (-444.999) [-432.474] * (-430.633) [-438.891] (-440.048) (-446.402) -- 0:00:40
      24500 -- (-432.033) (-433.567) (-439.273) [-431.029] * [-436.104] (-441.651) (-445.334) (-442.989) -- 0:00:39
      25000 -- [-430.480] (-436.345) (-434.234) (-434.954) * [-433.083] (-439.966) (-439.298) (-443.625) -- 0:00:39

      Average standard deviation of split frequencies: 0.043169

      25500 -- (-430.859) [-432.612] (-432.314) (-432.580) * (-435.556) [-441.521] (-437.617) (-441.124) -- 0:00:38
      26000 -- [-430.767] (-432.682) (-434.221) (-434.521) * (-433.522) (-443.472) (-436.416) [-442.934] -- 0:00:37
      26500 -- (-432.881) (-433.810) (-437.280) [-431.089] * (-436.009) (-449.862) [-437.300] (-440.976) -- 0:00:36
      27000 -- (-432.680) [-434.225] (-431.137) (-430.106) * (-432.472) (-438.773) [-448.210] (-442.122) -- 0:00:36
      27500 -- (-432.005) (-430.264) [-431.958] (-431.018) * (-432.007) (-442.033) (-448.076) [-438.814] -- 0:00:35
      28000 -- [-433.722] (-430.506) (-432.882) (-433.588) * [-431.215] (-447.639) (-442.419) (-453.600) -- 0:00:34
      28500 -- (-430.712) [-430.496] (-433.707) (-433.869) * (-432.228) (-459.665) [-437.220] (-441.622) -- 0:00:34
      29000 -- (-431.374) (-430.867) (-431.891) [-431.069] * [-431.801] (-450.338) (-445.937) (-436.443) -- 0:00:33
      29500 -- (-433.055) [-430.830] (-431.427) (-431.693) * [-431.029] (-445.456) (-442.511) (-455.430) -- 0:00:32
      30000 -- (-432.843) (-430.619) [-433.691] (-432.011) * [-431.865] (-442.450) (-438.074) (-450.850) -- 0:00:32

      Average standard deviation of split frequencies: 0.049190

      30500 -- (-432.024) (-432.615) [-431.868] (-430.045) * [-433.350] (-435.457) (-438.063) (-442.570) -- 0:00:31
      31000 -- (-434.231) (-430.604) [-434.892] (-433.718) * (-434.118) [-432.497] (-439.256) (-433.216) -- 0:00:31
      31500 -- (-436.839) (-432.599) (-432.988) [-431.752] * (-437.274) [-431.649] (-435.424) (-433.181) -- 0:00:30
      32000 -- (-433.505) [-432.655] (-434.418) (-433.197) * (-430.377) [-432.254] (-444.580) (-431.165) -- 0:00:30
      32500 -- (-432.234) (-433.215) [-433.784] (-439.091) * [-431.483] (-432.587) (-441.084) (-430.783) -- 0:00:59
      33000 -- (-434.557) (-431.958) (-433.104) [-435.205] * (-432.489) (-431.438) (-444.608) [-430.886] -- 0:00:58
      33500 -- (-431.708) [-431.898] (-430.924) (-431.533) * (-431.504) (-430.336) (-445.345) [-431.716] -- 0:00:57
      34000 -- (-433.770) (-431.364) (-431.047) [-431.080] * (-431.649) (-432.242) (-445.766) [-432.099] -- 0:00:56
      34500 -- (-431.623) (-431.027) (-431.717) [-432.491] * (-432.193) [-430.201] (-443.164) (-436.458) -- 0:00:55
      35000 -- (-432.541) (-432.434) [-432.534] (-431.546) * [-433.281] (-435.359) (-447.211) (-434.533) -- 0:00:55

      Average standard deviation of split frequencies: 0.043905

      35500 -- (-435.188) (-432.009) (-430.701) [-432.611] * (-434.698) (-440.002) (-447.183) [-435.421] -- 0:00:54
      36000 -- (-430.241) [-432.619] (-436.699) (-434.169) * (-432.583) (-430.827) (-439.733) [-433.137] -- 0:00:53
      36500 -- (-435.270) (-435.353) [-432.646] (-432.380) * [-430.976] (-432.102) (-443.183) (-430.564) -- 0:00:52
      37000 -- [-430.309] (-433.911) (-434.369) (-432.847) * [-432.487] (-434.479) (-446.960) (-431.940) -- 0:00:52
      37500 -- (-432.534) (-433.076) (-432.289) [-430.934] * [-430.586] (-432.159) (-439.416) (-430.491) -- 0:00:51
      38000 -- (-432.440) (-431.409) [-432.891] (-438.518) * [-430.817] (-437.926) (-438.781) (-432.897) -- 0:00:50
      38500 -- (-432.332) (-432.503) [-430.181] (-434.841) * (-436.198) (-430.922) [-439.845] (-436.550) -- 0:00:49
      39000 -- (-432.178) (-432.304) (-435.519) [-435.733] * [-430.129] (-432.158) (-443.505) (-433.525) -- 0:00:49
      39500 -- [-431.735] (-433.734) (-433.561) (-432.267) * (-432.437) [-430.054] (-453.470) (-432.227) -- 0:00:48
      40000 -- (-432.464) [-431.997] (-436.536) (-432.858) * [-430.631] (-434.827) (-442.580) (-433.768) -- 0:00:48

      Average standard deviation of split frequencies: 0.044322

      40500 -- (-429.973) [-431.326] (-436.152) (-432.737) * (-430.529) (-439.717) (-458.196) [-433.989] -- 0:00:47
      41000 -- (-432.311) (-434.153) [-430.786] (-430.855) * (-431.718) [-432.036] (-436.947) (-430.706) -- 0:00:46
      41500 -- (-431.784) (-433.488) [-430.681] (-430.315) * [-433.375] (-432.458) (-431.334) (-431.713) -- 0:00:46
      42000 -- (-432.504) (-430.441) (-435.574) [-431.386] * (-432.616) (-432.876) (-433.150) [-430.766] -- 0:00:45
      42500 -- (-432.737) (-431.453) [-431.015] (-431.243) * [-431.019] (-430.932) (-436.019) (-430.929) -- 0:00:45
      43000 -- (-436.066) (-430.723) [-434.122] (-434.112) * (-432.364) [-434.269] (-431.508) (-434.927) -- 0:00:44
      43500 -- [-439.284] (-430.943) (-431.214) (-432.620) * (-435.273) (-432.433) [-430.909] (-431.658) -- 0:00:43
      44000 -- (-435.721) (-433.704) (-432.656) [-431.752] * (-433.596) (-435.219) (-431.994) [-431.288] -- 0:00:43
      44500 -- (-430.460) (-434.859) [-430.878] (-432.807) * (-431.880) [-433.165] (-430.699) (-431.597) -- 0:00:42
      45000 -- (-430.932) [-435.416] (-430.961) (-434.379) * (-430.970) (-434.108) (-431.463) [-432.755] -- 0:00:42

      Average standard deviation of split frequencies: 0.038663

      45500 -- (-432.371) (-437.461) [-432.143] (-431.068) * (-433.429) [-434.108] (-430.611) (-431.282) -- 0:00:41
      46000 -- (-430.375) [-436.737] (-432.086) (-434.233) * (-432.832) (-433.470) [-430.741] (-432.353) -- 0:00:41
      46500 -- (-433.942) (-432.230) (-433.096) [-431.945] * [-433.352] (-431.186) (-435.063) (-433.749) -- 0:00:41
      47000 -- [-432.282] (-432.892) (-435.709) (-431.104) * (-433.251) (-431.272) (-432.530) [-431.772] -- 0:00:40
      47500 -- [-433.393] (-430.624) (-432.636) (-433.315) * (-430.803) [-431.479] (-431.652) (-430.043) -- 0:00:40
      48000 -- (-431.388) [-431.630] (-430.315) (-433.178) * (-440.216) [-431.842] (-432.821) (-430.364) -- 0:00:39
      48500 -- (-435.295) [-431.450] (-431.229) (-431.499) * (-434.139) [-430.582] (-430.550) (-432.653) -- 0:00:39
      49000 -- (-433.462) [-432.296] (-430.798) (-432.346) * (-432.066) [-431.803] (-431.913) (-431.566) -- 0:00:38
      49500 -- (-433.868) (-432.785) [-431.046] (-431.930) * (-431.726) (-432.692) [-430.233] (-438.098) -- 0:00:38
      50000 -- (-432.060) (-430.513) [-431.845] (-436.493) * [-432.215] (-433.645) (-431.128) (-431.940) -- 0:00:57

      Average standard deviation of split frequencies: 0.030127

      50500 -- (-431.738) [-432.246] (-430.470) (-433.558) * (-431.114) (-437.363) [-432.099] (-431.733) -- 0:00:56
      51000 -- (-433.288) [-433.787] (-431.664) (-435.786) * (-431.022) [-434.059] (-432.821) (-433.084) -- 0:00:55
      51500 -- (-432.750) [-434.328] (-432.438) (-431.046) * (-431.618) [-430.176] (-433.151) (-432.982) -- 0:00:55
      52000 -- (-432.514) [-432.581] (-436.316) (-432.893) * (-430.422) (-431.252) [-432.858] (-433.939) -- 0:00:54
      52500 -- [-433.120] (-432.322) (-435.002) (-432.359) * (-434.406) [-435.127] (-435.624) (-434.495) -- 0:00:54
      53000 -- [-430.160] (-430.944) (-432.272) (-434.373) * (-432.665) (-431.987) (-433.768) [-430.354] -- 0:00:53
      53500 -- [-433.503] (-430.355) (-431.905) (-435.597) * (-434.356) (-432.073) [-430.171] (-431.058) -- 0:00:53
      54000 -- [-434.840] (-432.553) (-431.851) (-434.070) * [-432.322] (-434.072) (-433.624) (-433.197) -- 0:00:52
      54500 -- [-433.623] (-432.459) (-431.886) (-434.100) * (-433.184) (-432.402) (-433.427) [-433.435] -- 0:00:52
      55000 -- (-432.450) [-430.423] (-430.219) (-430.799) * [-432.778] (-433.464) (-431.972) (-432.047) -- 0:00:51

      Average standard deviation of split frequencies: 0.031900

      55500 -- (-433.729) (-430.631) [-430.051] (-432.519) * (-431.184) [-431.531] (-430.511) (-434.299) -- 0:00:51
      56000 -- (-430.664) (-435.682) [-436.055] (-440.444) * (-429.967) (-432.551) (-433.383) [-432.302] -- 0:00:50
      56500 -- (-430.440) [-432.585] (-437.238) (-435.114) * [-431.342] (-435.836) (-433.968) (-430.675) -- 0:00:50
      57000 -- (-432.575) (-432.014) (-431.335) [-432.605] * (-433.514) [-430.900] (-430.574) (-430.378) -- 0:00:49
      57500 -- [-431.718] (-430.334) (-432.104) (-432.006) * (-433.752) [-430.645] (-430.561) (-430.653) -- 0:00:49
      58000 -- [-431.802] (-437.028) (-431.151) (-431.789) * (-432.453) (-433.700) (-434.352) [-432.666] -- 0:00:48
      58500 -- (-432.897) (-434.566) [-431.532] (-432.696) * (-433.379) [-433.057] (-435.696) (-430.689) -- 0:00:48
      59000 -- [-432.877] (-432.458) (-434.132) (-434.568) * (-433.174) (-432.464) [-434.432] (-433.549) -- 0:00:47
      59500 -- [-431.869] (-432.291) (-433.539) (-431.706) * (-435.601) [-433.076] (-435.227) (-432.611) -- 0:00:47
      60000 -- (-431.201) [-430.872] (-435.277) (-436.237) * (-433.315) (-431.828) [-435.102] (-430.235) -- 0:00:47

      Average standard deviation of split frequencies: 0.029916

      60500 -- [-431.410] (-430.566) (-434.126) (-436.305) * (-436.277) (-430.294) [-430.814] (-433.413) -- 0:00:46
      61000 -- (-431.195) [-431.562] (-435.229) (-434.885) * (-432.026) (-430.849) (-431.661) [-431.268] -- 0:00:46
      61500 -- (-433.355) [-431.459] (-431.195) (-430.555) * (-436.092) (-431.930) [-436.061] (-433.145) -- 0:00:45
      62000 -- (-435.828) (-432.022) [-431.276] (-431.805) * (-433.777) [-431.985] (-437.570) (-431.266) -- 0:00:45
      62500 -- [-436.555] (-435.136) (-433.163) (-434.933) * (-433.551) (-433.021) (-440.082) [-431.869] -- 0:00:45
      63000 -- (-430.040) (-430.337) (-432.723) [-435.555] * (-430.805) (-432.665) [-432.739] (-433.459) -- 0:00:44
      63500 -- (-432.352) [-432.240] (-432.360) (-434.154) * (-433.688) (-432.220) (-434.206) [-433.458] -- 0:00:44
      64000 -- (-434.703) (-434.135) [-432.881] (-434.444) * [-430.651] (-431.406) (-431.414) (-431.009) -- 0:00:43
      64500 -- (-433.832) (-440.106) (-430.934) [-432.340] * [-431.191] (-431.469) (-430.826) (-433.404) -- 0:00:43
      65000 -- (-436.601) [-430.903] (-431.960) (-435.183) * [-430.072] (-436.161) (-436.207) (-435.263) -- 0:00:43

      Average standard deviation of split frequencies: 0.029219

      65500 -- (-433.138) [-431.159] (-434.029) (-431.881) * [-431.485] (-432.971) (-436.195) (-430.416) -- 0:00:42
      66000 -- [-432.204] (-432.526) (-436.407) (-432.361) * (-430.075) (-430.983) [-433.822] (-430.675) -- 0:00:42
      66500 -- (-432.609) (-433.806) [-431.160] (-431.489) * (-434.391) (-431.106) [-431.897] (-430.896) -- 0:00:42
      67000 -- (-430.561) (-432.926) [-432.119] (-431.662) * (-434.025) (-436.301) (-430.456) [-430.695] -- 0:00:55
      67500 -- (-430.630) [-431.033] (-432.646) (-432.836) * (-431.929) (-434.122) (-430.025) [-430.592] -- 0:00:55
      68000 -- [-430.659] (-436.357) (-432.480) (-431.940) * (-431.511) (-430.905) [-431.144] (-434.662) -- 0:00:54
      68500 -- (-433.186) (-430.240) [-430.818] (-430.484) * (-430.933) [-430.800] (-431.628) (-430.086) -- 0:00:54
      69000 -- (-433.562) (-435.026) (-432.190) [-435.495] * [-432.193] (-433.354) (-433.341) (-433.635) -- 0:00:53
      69500 -- (-432.139) [-432.421] (-430.791) (-431.507) * [-430.111] (-430.825) (-434.794) (-432.312) -- 0:00:53
      70000 -- (-432.353) (-436.274) (-433.840) [-433.954] * (-432.503) [-429.928] (-431.517) (-431.810) -- 0:00:53

      Average standard deviation of split frequencies: 0.025774

      70500 -- (-431.060) (-433.192) (-431.849) [-433.120] * (-432.029) (-430.792) (-430.177) [-431.842] -- 0:00:52
      71000 -- (-440.036) [-432.091] (-433.168) (-431.710) * (-433.910) (-433.513) [-433.014] (-433.422) -- 0:00:52
      71500 -- (-431.659) [-430.750] (-431.332) (-430.919) * (-432.448) (-435.666) [-430.873] (-431.524) -- 0:00:51
      72000 -- (-431.793) [-433.598] (-432.256) (-432.034) * (-431.507) (-430.209) (-435.458) [-431.879] -- 0:00:51
      72500 -- (-430.822) (-433.191) (-431.104) [-432.656] * (-431.314) (-430.934) [-431.845] (-430.149) -- 0:00:51
      73000 -- (-432.828) (-430.007) [-431.790] (-431.741) * (-430.207) (-430.545) (-430.552) [-430.627] -- 0:00:50
      73500 -- (-433.106) (-432.714) [-431.292] (-430.332) * [-430.154] (-433.717) (-431.577) (-431.586) -- 0:00:50
      74000 -- (-433.091) (-430.792) (-432.965) [-430.265] * (-432.218) (-434.882) [-430.659] (-430.122) -- 0:00:50
      74500 -- [-432.767] (-429.854) (-431.742) (-434.202) * (-433.423) (-432.296) [-430.860] (-432.121) -- 0:00:49
      75000 -- (-432.768) [-431.998] (-431.701) (-432.865) * (-431.060) (-430.689) (-430.430) [-430.924] -- 0:00:49

      Average standard deviation of split frequencies: 0.024484

      75500 -- (-432.762) (-431.415) (-433.124) [-430.187] * (-431.999) [-431.290] (-430.555) (-432.669) -- 0:00:48
      76000 -- (-432.860) (-430.806) [-431.292] (-431.255) * (-432.564) (-434.688) [-431.148] (-433.268) -- 0:00:48
      76500 -- (-434.215) (-432.982) [-432.528] (-433.036) * (-436.429) [-430.428] (-432.210) (-436.454) -- 0:00:48
      77000 -- [-432.641] (-436.519) (-432.437) (-435.779) * (-436.081) (-432.154) (-430.498) [-430.632] -- 0:00:47
      77500 -- (-434.089) (-433.511) [-431.002] (-433.368) * (-431.513) [-432.876] (-433.092) (-432.257) -- 0:00:47
      78000 -- (-434.149) (-432.363) (-433.794) [-432.124] * (-430.160) [-433.697] (-435.223) (-432.363) -- 0:00:47
      78500 -- (-432.611) (-432.037) (-430.057) [-431.342] * [-430.887] (-433.687) (-435.768) (-430.469) -- 0:00:46
      79000 -- (-433.961) [-434.916] (-430.097) (-431.835) * [-430.230] (-434.454) (-434.414) (-430.227) -- 0:00:46
      79500 -- (-430.982) (-436.086) [-432.406] (-432.736) * (-431.708) (-431.283) [-434.000] (-432.596) -- 0:00:46
      80000 -- (-433.105) (-434.938) (-432.992) [-432.148] * [-433.367] (-433.448) (-431.211) (-431.349) -- 0:00:46

      Average standard deviation of split frequencies: 0.021838

      80500 -- [-431.240] (-433.080) (-435.673) (-430.353) * [-431.755] (-432.925) (-431.426) (-432.059) -- 0:00:45
      81000 -- [-432.981] (-431.395) (-431.019) (-430.898) * (-430.521) [-432.580] (-434.549) (-431.534) -- 0:00:45
      81500 -- (-436.097) (-431.952) (-432.855) [-431.652] * (-430.527) (-434.026) [-432.102] (-430.779) -- 0:00:45
      82000 -- [-433.631] (-437.295) (-433.986) (-431.387) * (-439.029) (-431.272) (-431.751) [-430.481] -- 0:00:44
      82500 -- (-431.657) (-440.597) (-437.043) [-433.466] * (-432.640) [-431.493] (-432.027) (-434.026) -- 0:00:44
      83000 -- (-430.031) (-433.981) (-431.232) [-431.216] * (-432.190) (-433.083) [-433.772] (-430.827) -- 0:00:44
      83500 -- (-432.136) [-430.243] (-431.144) (-436.030) * (-429.943) (-432.000) [-432.042] (-434.146) -- 0:00:43
      84000 -- (-433.766) (-432.477) [-430.992] (-434.051) * (-435.648) (-430.527) (-432.898) [-430.893] -- 0:00:43
      84500 -- (-438.659) (-431.218) [-431.770] (-434.692) * (-431.697) (-431.048) (-434.995) [-431.904] -- 0:00:54
      85000 -- (-438.875) (-432.392) [-433.901] (-432.261) * [-430.867] (-432.758) (-433.909) (-430.824) -- 0:00:53

      Average standard deviation of split frequencies: 0.019329

      85500 -- (-436.068) (-433.301) [-431.642] (-436.648) * (-434.230) (-434.399) (-430.379) [-431.434] -- 0:00:53
      86000 -- (-434.301) (-433.064) [-432.786] (-431.821) * (-431.997) [-432.457] (-432.595) (-430.789) -- 0:00:53
      86500 -- [-432.043] (-431.471) (-433.786) (-434.368) * (-431.968) (-433.519) [-431.221] (-431.482) -- 0:00:52
      87000 -- (-431.983) (-432.748) (-432.715) [-431.063] * (-438.416) [-430.225] (-430.547) (-431.225) -- 0:00:52
      87500 -- [-432.443] (-431.955) (-432.589) (-431.807) * (-432.421) (-430.875) (-431.618) [-433.369] -- 0:00:52
      88000 -- (-430.416) (-432.154) (-432.321) [-432.348] * (-434.236) (-430.961) [-431.006] (-430.696) -- 0:00:51
      88500 -- (-430.380) (-433.452) [-433.410] (-439.435) * (-432.011) (-435.426) (-431.373) [-431.792] -- 0:00:51
      89000 -- (-431.011) [-432.892] (-431.772) (-439.811) * (-431.636) (-431.719) (-433.113) [-432.426] -- 0:00:51
      89500 -- (-430.802) (-430.098) (-434.510) [-439.600] * [-430.746] (-433.616) (-433.932) (-433.594) -- 0:00:50
      90000 -- [-434.474] (-435.098) (-433.592) (-436.663) * [-433.052] (-436.521) (-431.861) (-431.653) -- 0:00:50

      Average standard deviation of split frequencies: 0.018656

      90500 -- (-431.855) (-430.719) [-433.828] (-433.441) * [-431.466] (-433.518) (-431.273) (-432.512) -- 0:00:50
      91000 -- (-431.215) (-443.142) [-432.639] (-435.737) * (-430.946) (-434.314) [-432.508] (-429.887) -- 0:00:49
      91500 -- [-430.920] (-432.291) (-436.049) (-431.339) * (-430.623) [-430.481] (-439.085) (-432.665) -- 0:00:49
      92000 -- (-432.729) (-432.015) (-436.670) [-434.564] * (-433.618) (-432.656) [-431.284] (-434.253) -- 0:00:49
      92500 -- [-432.841] (-431.977) (-430.486) (-432.557) * [-433.892] (-431.744) (-432.531) (-432.020) -- 0:00:49
      93000 -- (-432.277) [-430.432] (-430.617) (-431.078) * [-430.470] (-432.342) (-431.899) (-432.979) -- 0:00:48
      93500 -- (-431.761) [-431.356] (-430.877) (-434.929) * (-431.765) (-432.445) (-434.270) [-431.274] -- 0:00:48
      94000 -- (-432.272) (-432.042) [-431.377] (-433.679) * (-436.673) [-434.409] (-432.284) (-431.689) -- 0:00:48
      94500 -- (-430.802) [-431.804] (-432.959) (-433.361) * (-436.452) (-436.872) (-436.160) [-430.380] -- 0:00:47
      95000 -- (-430.119) [-431.119] (-431.813) (-432.327) * [-431.817] (-434.023) (-432.763) (-431.626) -- 0:00:47

      Average standard deviation of split frequencies: 0.021709

      95500 -- [-430.729] (-432.090) (-433.933) (-430.622) * (-432.199) (-435.103) [-430.786] (-435.549) -- 0:00:47
      96000 -- [-430.810] (-432.302) (-432.427) (-431.948) * (-431.763) (-432.260) (-433.466) [-434.234] -- 0:00:47
      96500 -- (-430.699) (-431.633) [-430.183] (-431.201) * (-431.026) (-434.254) (-433.533) [-432.780] -- 0:00:46
      97000 -- (-432.087) (-431.135) (-434.051) [-431.186] * [-433.529] (-433.303) (-430.443) (-432.391) -- 0:00:46
      97500 -- [-435.054] (-430.311) (-433.774) (-430.125) * (-433.912) (-432.882) [-435.776] (-434.591) -- 0:00:46
      98000 -- (-439.135) (-433.791) (-433.917) [-431.956] * (-432.695) [-434.757] (-435.752) (-430.290) -- 0:00:46
      98500 -- (-435.035) (-432.002) (-431.831) [-430.037] * [-431.605] (-434.157) (-433.224) (-434.005) -- 0:00:45
      99000 -- [-440.438] (-432.615) (-433.957) (-431.000) * [-432.778] (-432.181) (-435.206) (-432.991) -- 0:00:45
      99500 -- (-433.832) (-430.094) [-433.308] (-437.897) * (-432.152) [-432.754] (-430.749) (-433.561) -- 0:00:45
      100000 -- (-437.225) (-433.106) (-432.493) [-433.042] * [-435.432] (-432.352) (-430.412) (-433.942) -- 0:00:45

      Average standard deviation of split frequencies: 0.020813

      100500 -- (-431.460) [-433.871] (-432.968) (-430.316) * (-432.205) [-432.179] (-431.316) (-436.714) -- 0:00:44
      101000 -- [-431.509] (-435.277) (-431.250) (-432.155) * (-432.199) (-431.249) [-434.458] (-433.163) -- 0:00:53
      101500 -- (-431.754) (-430.631) [-431.294] (-432.986) * (-431.235) (-434.142) [-430.865] (-433.521) -- 0:00:53
      102000 -- (-431.474) [-430.979] (-431.236) (-431.327) * [-430.946] (-433.156) (-430.502) (-433.742) -- 0:00:52
      102500 -- (-430.452) [-431.324] (-431.899) (-430.673) * [-432.950] (-432.148) (-431.237) (-431.930) -- 0:00:52
      103000 -- (-432.941) (-430.754) (-430.685) [-433.351] * [-431.981] (-431.413) (-432.594) (-434.078) -- 0:00:52
      103500 -- (-430.465) (-431.640) (-432.154) [-434.433] * [-431.244] (-431.422) (-434.772) (-430.462) -- 0:00:51
      104000 -- [-430.708] (-432.784) (-432.109) (-437.708) * (-434.832) (-430.311) (-432.538) [-430.661] -- 0:00:51
      104500 -- [-430.203] (-432.510) (-431.967) (-434.350) * (-431.359) (-430.554) [-430.850] (-436.342) -- 0:00:51
      105000 -- (-431.599) [-431.858] (-431.186) (-430.810) * (-432.153) (-432.094) (-431.612) [-431.651] -- 0:00:51

      Average standard deviation of split frequencies: 0.018491

      105500 -- [-431.817] (-431.982) (-431.053) (-431.192) * (-436.080) (-430.427) (-435.927) [-433.133] -- 0:00:50
      106000 -- [-431.608] (-431.960) (-432.001) (-432.833) * (-433.261) (-433.146) (-431.283) [-430.684] -- 0:00:50
      106500 -- (-432.960) (-432.396) [-433.902] (-431.076) * (-432.816) [-432.675] (-431.554) (-433.537) -- 0:00:50
      107000 -- (-431.548) [-430.941] (-431.104) (-431.143) * (-435.353) (-432.381) [-430.158] (-431.143) -- 0:00:50
      107500 -- [-431.340] (-430.961) (-433.166) (-433.330) * (-433.461) (-432.273) (-433.538) [-431.073] -- 0:00:49
      108000 -- [-432.731] (-430.180) (-431.878) (-430.558) * (-431.216) (-434.691) [-431.220] (-431.630) -- 0:00:49
      108500 -- [-430.146] (-436.811) (-434.443) (-430.904) * (-433.155) (-431.642) (-435.608) [-430.593] -- 0:00:49
      109000 -- (-433.701) (-435.596) (-433.435) [-430.727] * [-433.298] (-433.513) (-434.331) (-430.245) -- 0:00:49
      109500 -- (-432.399) (-430.479) (-440.538) [-430.061] * (-431.684) (-437.979) [-433.554] (-429.978) -- 0:00:48
      110000 -- [-431.408] (-430.270) (-430.856) (-430.462) * (-432.831) (-431.132) [-430.351] (-432.769) -- 0:00:48

      Average standard deviation of split frequencies: 0.018695

      110500 -- (-432.494) (-433.579) [-432.489] (-435.068) * (-432.747) (-433.222) [-431.115] (-434.569) -- 0:00:48
      111000 -- (-434.442) [-430.387] (-432.021) (-432.774) * [-431.430] (-434.146) (-430.452) (-430.982) -- 0:00:48
      111500 -- (-435.549) [-430.195] (-435.872) (-432.664) * (-433.187) (-432.684) (-430.833) [-433.660] -- 0:00:47
      112000 -- (-432.253) [-432.088] (-432.638) (-433.033) * (-435.415) (-432.628) [-430.164] (-430.759) -- 0:00:47
      112500 -- (-436.837) [-431.484] (-433.253) (-431.558) * (-431.491) (-432.108) [-430.636] (-431.229) -- 0:00:47
      113000 -- (-433.309) (-435.983) [-432.894] (-430.479) * (-431.259) [-431.727] (-434.948) (-433.354) -- 0:00:47
      113500 -- (-431.708) [-433.333] (-433.297) (-434.361) * (-431.662) (-432.264) (-436.270) [-434.304] -- 0:00:46
      114000 -- (-431.491) (-431.481) [-433.868] (-431.524) * [-432.250] (-433.530) (-430.107) (-430.817) -- 0:00:46
      114500 -- (-430.764) [-437.456] (-436.890) (-432.190) * [-432.426] (-431.063) (-430.930) (-434.320) -- 0:00:46
      115000 -- (-434.769) [-431.715] (-433.814) (-432.452) * (-432.657) (-431.720) [-431.322] (-433.861) -- 0:00:46

      Average standard deviation of split frequencies: 0.020558

      115500 -- (-433.174) (-430.709) (-432.153) [-431.176] * (-434.810) (-431.021) [-431.471] (-433.187) -- 0:00:45
      116000 -- (-432.005) (-432.896) (-433.144) [-434.055] * (-431.323) (-431.562) [-431.185] (-431.812) -- 0:00:45
      116500 -- (-433.429) (-432.501) [-432.879] (-433.338) * (-430.994) (-430.671) [-431.871] (-431.852) -- 0:00:45
      117000 -- [-433.409] (-432.515) (-430.389) (-431.019) * (-433.280) [-437.332] (-434.174) (-431.359) -- 0:00:45
      117500 -- (-431.022) (-431.320) (-435.105) [-431.998] * (-430.794) (-433.016) [-433.694] (-431.520) -- 0:00:45
      118000 -- (-431.177) (-431.676) (-440.857) [-436.323] * (-431.439) (-432.959) (-433.051) [-431.218] -- 0:00:44
      118500 -- (-431.896) (-431.437) (-433.251) [-431.989] * (-435.047) (-431.739) [-432.260] (-434.427) -- 0:00:52
      119000 -- [-431.905] (-434.582) (-434.774) (-431.301) * (-441.516) (-431.089) [-432.513] (-431.442) -- 0:00:51
      119500 -- (-432.943) (-433.862) [-430.748] (-431.205) * (-433.952) (-431.866) (-434.179) [-430.686] -- 0:00:51
      120000 -- (-433.870) (-433.569) [-430.617] (-431.774) * (-433.635) (-432.533) [-434.178] (-430.544) -- 0:00:51

      Average standard deviation of split frequencies: 0.015627

      120500 -- [-434.679] (-430.785) (-431.232) (-432.111) * (-431.109) (-435.204) [-431.264] (-434.076) -- 0:00:51
      121000 -- [-430.603] (-430.789) (-432.993) (-432.396) * [-433.776] (-433.751) (-430.842) (-435.393) -- 0:00:50
      121500 -- (-436.076) (-431.147) [-430.888] (-430.507) * (-431.130) [-433.160] (-431.072) (-431.443) -- 0:00:50
      122000 -- (-430.960) (-431.944) [-431.891] (-434.701) * (-431.385) (-432.010) (-430.754) [-431.341] -- 0:00:50
      122500 -- (-436.293) (-431.292) (-432.701) [-430.341] * (-432.629) [-431.848] (-431.450) (-435.744) -- 0:00:50
      123000 -- (-438.519) [-431.898] (-434.520) (-431.410) * (-434.398) [-434.133] (-430.551) (-433.050) -- 0:00:49
      123500 -- (-435.090) (-432.008) [-431.657] (-437.821) * (-431.148) (-437.323) (-431.101) [-431.370] -- 0:00:49
      124000 -- [-431.316] (-430.585) (-432.790) (-433.996) * (-431.243) (-429.947) (-431.806) [-432.301] -- 0:00:49
      124500 -- (-431.954) [-431.947] (-431.746) (-434.550) * [-435.982] (-433.061) (-435.310) (-437.861) -- 0:00:49
      125000 -- (-430.851) (-435.477) (-433.070) [-433.190] * (-436.993) [-429.933] (-432.756) (-432.959) -- 0:00:49

      Average standard deviation of split frequencies: 0.017252

      125500 -- (-430.513) (-432.854) (-431.548) [-432.739] * (-432.424) [-432.164] (-432.080) (-432.009) -- 0:00:48
      126000 -- [-430.860] (-431.087) (-431.251) (-432.537) * (-431.734) (-431.132) (-432.484) [-430.877] -- 0:00:48
      126500 -- (-433.472) (-430.305) [-431.309] (-434.025) * (-431.614) (-432.885) (-433.966) [-431.094] -- 0:00:48
      127000 -- (-431.206) (-431.739) [-435.066] (-433.358) * (-433.106) (-433.546) [-430.357] (-432.739) -- 0:00:48
      127500 -- (-432.290) (-431.323) (-430.476) [-432.502] * [-431.287] (-438.905) (-436.048) (-433.133) -- 0:00:47
      128000 -- (-430.152) [-433.879] (-434.018) (-432.799) * [-432.186] (-442.262) (-431.442) (-432.927) -- 0:00:47
      128500 -- [-434.032] (-431.018) (-431.079) (-433.175) * (-433.213) [-437.113] (-432.557) (-431.438) -- 0:00:47
      129000 -- [-434.429] (-431.082) (-431.795) (-435.610) * [-433.092] (-432.592) (-433.105) (-430.549) -- 0:00:47
      129500 -- (-430.794) (-432.068) [-434.467] (-439.680) * (-435.033) [-434.558] (-432.591) (-432.521) -- 0:00:47
      130000 -- (-430.483) [-431.745] (-434.636) (-435.422) * (-438.371) (-435.681) [-430.224] (-431.612) -- 0:00:46

      Average standard deviation of split frequencies: 0.017659

      130500 -- (-430.788) [-430.074] (-430.731) (-439.636) * (-438.651) (-431.846) (-431.627) [-431.675] -- 0:00:46
      131000 -- (-430.279) (-433.869) (-431.294) [-432.971] * (-439.255) (-433.272) (-433.247) [-430.465] -- 0:00:46
      131500 -- (-430.380) (-431.720) [-431.213] (-430.731) * (-435.398) [-432.317] (-435.270) (-433.028) -- 0:00:46
      132000 -- (-433.470) [-431.087] (-430.568) (-431.541) * (-441.552) (-430.663) (-433.870) [-430.772] -- 0:00:46
      132500 -- (-433.023) (-432.201) [-431.092] (-431.327) * (-438.910) [-432.540] (-431.318) (-433.122) -- 0:00:45
      133000 -- (-432.444) (-431.271) (-432.035) [-435.333] * (-431.641) (-433.623) [-430.879] (-430.689) -- 0:00:45
      133500 -- [-432.278] (-431.450) (-436.304) (-433.364) * (-432.766) (-430.153) (-433.406) [-432.724] -- 0:00:45
      134000 -- [-434.333] (-430.676) (-431.854) (-431.252) * (-431.280) [-430.203] (-433.761) (-431.468) -- 0:00:45
      134500 -- (-433.540) (-430.658) [-431.634] (-431.401) * (-434.111) [-430.289] (-431.063) (-436.199) -- 0:00:45
      135000 -- [-431.242] (-431.624) (-433.238) (-432.727) * [-433.039] (-431.423) (-431.375) (-431.162) -- 0:00:44

      Average standard deviation of split frequencies: 0.020432

      135500 -- (-431.834) (-431.485) (-436.513) [-433.265] * (-435.269) (-431.769) (-431.888) [-431.840] -- 0:00:44
      136000 -- [-431.950] (-433.347) (-433.061) (-432.885) * (-439.009) [-431.427] (-431.593) (-435.438) -- 0:00:50
      136500 -- (-433.054) [-433.504] (-431.644) (-433.457) * [-434.681] (-431.494) (-433.179) (-432.419) -- 0:00:50
      137000 -- (-431.521) [-432.022] (-432.930) (-433.237) * (-432.335) (-431.619) (-434.996) [-433.477] -- 0:00:50
      137500 -- (-435.041) (-430.035) [-431.891] (-432.663) * (-432.048) (-434.524) [-432.595] (-435.172) -- 0:00:50
      138000 -- (-431.851) (-432.514) (-434.803) [-431.933] * (-432.999) (-430.935) [-432.466] (-432.174) -- 0:00:49
      138500 -- (-430.736) [-430.572] (-432.156) (-432.404) * (-430.932) [-432.888] (-430.183) (-434.523) -- 0:00:49
      139000 -- [-431.745] (-432.915) (-436.663) (-430.136) * (-430.844) (-431.980) (-431.302) [-431.976] -- 0:00:49
      139500 -- (-431.452) (-434.273) [-433.453] (-431.804) * [-431.687] (-434.054) (-431.349) (-436.868) -- 0:00:49
      140000 -- (-432.589) [-430.651] (-431.101) (-434.231) * (-430.848) (-432.284) [-436.322] (-432.081) -- 0:00:49

      Average standard deviation of split frequencies: 0.019549

      140500 -- (-433.413) [-431.820] (-430.524) (-431.350) * (-431.629) (-431.074) [-433.443] (-431.316) -- 0:00:48
      141000 -- (-431.830) (-433.327) (-431.497) [-430.984] * (-432.385) (-432.184) [-432.291] (-430.963) -- 0:00:48
      141500 -- (-431.168) (-433.132) (-433.630) [-433.321] * (-431.599) (-430.942) (-431.949) [-430.062] -- 0:00:48
      142000 -- (-435.121) [-434.003] (-434.134) (-432.204) * (-430.234) [-430.377] (-433.450) (-433.789) -- 0:00:48
      142500 -- (-434.514) (-432.435) [-435.316] (-433.440) * (-431.785) (-431.068) [-433.350] (-431.039) -- 0:00:48
      143000 -- [-434.125] (-430.722) (-433.299) (-430.376) * (-431.366) (-433.642) [-433.129] (-436.114) -- 0:00:47
      143500 -- (-430.916) (-431.419) [-431.772] (-437.392) * (-435.629) (-432.953) [-432.477] (-431.888) -- 0:00:47
      144000 -- (-432.033) [-431.817] (-433.792) (-433.988) * (-432.226) (-430.234) [-431.446] (-432.181) -- 0:00:47
      144500 -- (-430.600) (-436.529) [-431.848] (-431.373) * (-431.124) (-430.995) [-430.713] (-432.777) -- 0:00:47
      145000 -- (-432.355) (-431.535) (-431.077) [-430.509] * (-433.845) [-433.914] (-431.301) (-431.565) -- 0:00:47

      Average standard deviation of split frequencies: 0.020449

      145500 -- [-432.313] (-431.818) (-432.475) (-433.662) * (-432.266) (-433.117) [-431.443] (-430.738) -- 0:00:46
      146000 -- (-430.398) [-433.895] (-433.141) (-433.492) * (-434.320) (-432.393) [-432.731] (-430.682) -- 0:00:46
      146500 -- (-431.344) (-431.347) (-432.491) [-431.170] * (-430.447) [-431.277] (-433.320) (-430.703) -- 0:00:46
      147000 -- (-433.076) (-432.008) [-431.296] (-433.039) * [-429.989] (-431.045) (-432.256) (-431.836) -- 0:00:46
      147500 -- (-432.157) (-431.922) (-431.065) [-431.409] * (-431.893) (-431.639) (-439.832) [-436.372] -- 0:00:46
      148000 -- (-432.050) (-430.225) (-431.449) [-439.151] * (-432.030) (-432.107) [-432.028] (-438.015) -- 0:00:46
      148500 -- [-430.851] (-432.986) (-432.303) (-435.301) * [-432.277] (-436.966) (-433.359) (-436.338) -- 0:00:45
      149000 -- (-441.179) [-431.506] (-436.779) (-431.485) * (-432.735) [-431.421] (-431.795) (-440.720) -- 0:00:45
      149500 -- (-431.379) (-434.419) (-431.052) [-433.474] * (-431.273) (-434.149) [-430.025] (-430.969) -- 0:00:45
      150000 -- (-434.867) (-431.246) (-431.371) [-431.711] * [-433.564] (-431.849) (-435.998) (-435.730) -- 0:00:45

      Average standard deviation of split frequencies: 0.018947

      150500 -- (-431.384) (-433.437) (-431.914) [-431.552] * (-436.391) [-437.999] (-431.357) (-432.768) -- 0:00:45
      151000 -- (-431.035) (-432.522) (-432.081) [-432.631] * (-433.617) (-431.463) (-434.884) [-432.401] -- 0:00:44
      151500 -- (-433.932) [-430.384] (-432.036) (-434.029) * (-434.256) (-432.619) (-430.794) [-435.383] -- 0:00:44
      152000 -- [-433.380] (-433.363) (-430.740) (-431.482) * (-438.498) (-432.126) [-433.693] (-437.288) -- 0:00:44
      152500 -- (-431.075) (-437.757) [-431.240] (-435.215) * (-431.717) [-431.686] (-433.090) (-433.022) -- 0:00:44
      153000 -- (-436.578) (-436.722) [-433.632] (-433.417) * (-431.136) (-434.504) (-434.057) [-429.898] -- 0:00:49
      153500 -- (-431.673) (-434.633) [-430.983] (-434.657) * (-431.441) [-432.678] (-431.720) (-430.570) -- 0:00:49
      154000 -- (-434.078) (-439.568) [-431.833] (-431.554) * (-430.585) [-433.274] (-433.229) (-430.454) -- 0:00:49
      154500 -- (-433.765) [-431.516] (-430.867) (-433.943) * (-431.545) [-433.126] (-432.738) (-434.113) -- 0:00:49
      155000 -- (-430.074) [-431.039] (-431.247) (-433.417) * (-433.189) (-430.866) [-432.953] (-432.629) -- 0:00:49

      Average standard deviation of split frequencies: 0.021342

      155500 -- [-430.401] (-431.159) (-432.715) (-430.163) * (-435.297) [-430.818] (-432.346) (-432.695) -- 0:00:48
      156000 -- (-436.749) (-435.481) [-434.810] (-430.432) * (-435.615) [-430.816] (-434.785) (-432.608) -- 0:00:48
      156500 -- [-433.411] (-434.165) (-432.370) (-432.531) * (-430.244) [-434.039] (-433.333) (-437.811) -- 0:00:48
      157000 -- (-431.352) (-432.714) (-433.578) [-432.562] * [-434.794] (-432.639) (-430.076) (-436.731) -- 0:00:48
      157500 -- (-433.905) (-431.755) [-433.913] (-434.643) * (-432.551) (-433.786) [-431.509] (-433.560) -- 0:00:48
      158000 -- (-432.624) [-432.373] (-437.080) (-434.857) * [-432.140] (-432.205) (-430.821) (-431.324) -- 0:00:47
      158500 -- (-431.090) (-434.773) (-432.888) [-430.434] * [-434.923] (-432.864) (-431.285) (-435.932) -- 0:00:47
      159000 -- (-432.099) (-431.915) (-431.049) [-433.251] * (-431.685) (-431.027) [-433.091] (-435.902) -- 0:00:47
      159500 -- (-431.645) (-432.405) (-434.682) [-431.601] * (-432.481) [-431.162] (-435.760) (-431.994) -- 0:00:47
      160000 -- (-433.187) [-431.365] (-436.154) (-431.179) * (-434.968) (-433.212) (-431.160) [-433.162] -- 0:00:47

      Average standard deviation of split frequencies: 0.023127

      160500 -- [-432.733] (-431.079) (-431.388) (-439.674) * (-431.949) (-434.293) [-430.388] (-432.694) -- 0:00:47
      161000 -- [-437.102] (-431.833) (-434.916) (-431.397) * (-432.801) (-434.660) (-433.543) [-432.116] -- 0:00:46
      161500 -- (-431.229) (-431.235) (-433.769) [-432.011] * (-432.601) (-431.985) (-430.088) [-432.232] -- 0:00:46
      162000 -- (-430.857) (-431.604) (-433.662) [-436.071] * (-432.908) (-432.039) [-430.934] (-430.568) -- 0:00:46
      162500 -- (-431.708) (-430.799) (-433.432) [-431.679] * [-431.897] (-432.936) (-431.551) (-431.829) -- 0:00:46
      163000 -- [-431.570] (-434.584) (-434.747) (-433.833) * (-432.232) (-432.426) (-436.090) [-434.349] -- 0:00:46
      163500 -- (-431.093) (-430.555) (-432.786) [-432.569] * [-430.949] (-439.201) (-432.580) (-433.198) -- 0:00:46
      164000 -- (-434.268) (-430.217) [-431.772] (-436.807) * [-430.787] (-435.024) (-431.572) (-430.849) -- 0:00:45
      164500 -- (-433.093) (-430.695) (-431.990) [-432.035] * (-432.930) [-435.876] (-431.438) (-433.394) -- 0:00:45
      165000 -- (-432.633) [-434.457] (-431.517) (-430.832) * (-434.721) (-434.140) (-430.269) [-432.358] -- 0:00:45

      Average standard deviation of split frequencies: 0.022050

      165500 -- (-432.668) (-433.245) (-440.357) [-431.218] * (-431.595) (-434.899) [-432.992] (-434.608) -- 0:00:45
      166000 -- (-435.123) (-433.068) [-431.385] (-431.368) * [-433.112] (-433.264) (-434.565) (-433.354) -- 0:00:45
      166500 -- [-430.473] (-433.802) (-430.839) (-430.118) * (-430.293) (-432.322) (-431.337) [-431.829] -- 0:00:45
      167000 -- (-433.845) [-433.991] (-436.346) (-434.402) * (-432.164) (-430.762) (-432.411) [-431.943] -- 0:00:44
      167500 -- (-433.520) (-432.851) (-436.837) [-431.189] * (-431.440) [-431.268] (-430.992) (-432.788) -- 0:00:44
      168000 -- [-432.918] (-433.225) (-433.554) (-430.722) * (-430.822) (-432.769) [-433.983] (-433.375) -- 0:00:44
      168500 -- [-431.395] (-435.280) (-430.775) (-431.627) * [-432.081] (-437.531) (-431.301) (-431.233) -- 0:00:49
      169000 -- (-430.632) (-432.275) [-431.790] (-432.658) * (-430.498) (-431.001) (-431.120) [-431.892] -- 0:00:49
      169500 -- (-434.639) (-433.877) [-433.887] (-433.029) * (-430.957) (-433.637) [-431.153] (-439.538) -- 0:00:48
      170000 -- (-432.583) [-431.058] (-430.633) (-434.636) * (-432.070) [-434.094] (-433.002) (-433.739) -- 0:00:48

      Average standard deviation of split frequencies: 0.018721

      170500 -- (-431.168) (-432.999) [-430.795] (-436.037) * (-431.369) [-431.921] (-431.199) (-432.926) -- 0:00:48
      171000 -- [-430.441] (-432.264) (-430.767) (-433.609) * [-434.054] (-435.455) (-433.155) (-430.836) -- 0:00:48
      171500 -- (-433.165) [-432.310] (-433.470) (-433.007) * (-433.565) (-436.134) (-431.504) [-432.796] -- 0:00:48
      172000 -- (-432.600) [-431.350] (-431.570) (-430.711) * (-433.604) (-435.502) (-430.822) [-432.244] -- 0:00:48
      172500 -- (-436.489) (-431.472) (-431.335) [-432.608] * [-431.564] (-433.957) (-433.351) (-432.216) -- 0:00:47
      173000 -- (-430.582) [-432.196] (-432.345) (-432.160) * (-432.379) (-432.523) (-434.867) [-430.787] -- 0:00:47
      173500 -- [-435.453] (-430.882) (-437.831) (-430.752) * (-433.386) [-434.067] (-431.546) (-430.481) -- 0:00:47
      174000 -- (-431.870) (-432.758) (-434.438) [-432.824] * (-432.636) [-434.897] (-431.260) (-431.198) -- 0:00:47
      174500 -- (-430.377) [-432.413] (-436.625) (-433.115) * (-431.207) (-437.130) [-432.948] (-431.382) -- 0:00:47
      175000 -- (-433.540) (-431.376) [-432.442] (-430.831) * (-432.732) (-433.976) [-431.227] (-431.228) -- 0:00:47

      Average standard deviation of split frequencies: 0.019064

      175500 -- [-430.520] (-432.993) (-432.766) (-432.920) * (-432.160) (-433.048) [-430.066] (-432.786) -- 0:00:46
      176000 -- (-431.175) (-435.659) [-432.507] (-432.609) * (-432.555) (-433.967) [-430.161] (-435.445) -- 0:00:46
      176500 -- (-431.680) (-431.167) [-430.555] (-433.456) * (-435.478) (-434.707) [-431.319] (-433.172) -- 0:00:46
      177000 -- (-433.760) [-431.748] (-432.431) (-435.763) * (-431.510) [-433.376] (-432.185) (-434.728) -- 0:00:46
      177500 -- (-433.814) (-431.350) [-431.784] (-430.939) * (-432.642) [-433.266] (-433.397) (-435.253) -- 0:00:46
      178000 -- (-431.587) (-433.416) (-433.850) [-435.265] * [-431.567] (-434.001) (-430.900) (-433.419) -- 0:00:46
      178500 -- (-433.732) (-434.855) [-432.281] (-431.507) * [-435.377] (-430.432) (-433.212) (-432.942) -- 0:00:46
      179000 -- (-433.264) [-432.221] (-435.140) (-433.138) * (-431.081) [-431.513] (-432.642) (-433.827) -- 0:00:45
      179500 -- (-434.565) [-430.808] (-430.565) (-432.134) * (-432.935) (-433.150) (-433.187) [-432.398] -- 0:00:45
      180000 -- (-430.220) (-432.827) [-434.161] (-430.626) * (-431.361) (-432.695) [-433.754] (-432.305) -- 0:00:45

      Average standard deviation of split frequencies: 0.018265

      180500 -- (-430.380) [-431.956] (-431.302) (-438.964) * (-433.099) [-431.072] (-433.061) (-430.626) -- 0:00:45
      181000 -- [-434.030] (-433.065) (-435.731) (-432.994) * (-431.536) [-431.170] (-433.769) (-434.401) -- 0:00:45
      181500 -- (-431.717) [-434.263] (-442.255) (-431.994) * [-432.740] (-430.655) (-430.926) (-431.660) -- 0:00:45
      182000 -- (-433.195) (-437.441) (-430.985) [-430.841] * (-433.700) [-432.973] (-433.172) (-432.598) -- 0:00:44
      182500 -- (-433.654) (-434.378) (-435.867) [-435.876] * (-436.465) (-432.528) [-433.570] (-431.251) -- 0:00:44
      183000 -- (-431.390) [-430.990] (-430.998) (-435.938) * (-433.034) (-431.057) [-433.943] (-432.033) -- 0:00:44
      183500 -- (-431.073) (-435.677) (-431.566) [-430.478] * [-432.759] (-431.787) (-430.963) (-431.015) -- 0:00:48
      184000 -- (-431.614) [-431.537] (-434.200) (-434.086) * (-436.079) [-432.696] (-431.005) (-433.642) -- 0:00:48
      184500 -- (-433.102) (-430.637) [-433.946] (-433.678) * (-433.174) (-430.662) (-433.873) [-434.170] -- 0:00:48
      185000 -- (-433.031) [-433.016] (-436.024) (-430.835) * (-430.616) (-430.475) [-429.990] (-432.934) -- 0:00:48

      Average standard deviation of split frequencies: 0.017741

      185500 -- (-430.202) [-431.973] (-432.083) (-430.405) * (-432.461) (-431.604) [-430.846] (-432.289) -- 0:00:48
      186000 -- (-434.728) [-432.144] (-431.350) (-433.526) * (-436.401) (-437.135) (-432.226) [-431.419] -- 0:00:48
      186500 -- [-431.196] (-429.788) (-434.637) (-433.581) * (-432.620) (-431.924) [-431.448] (-433.475) -- 0:00:47
      187000 -- (-432.559) (-430.427) (-440.221) [-432.003] * (-432.576) [-431.318] (-434.236) (-431.000) -- 0:00:47
      187500 -- (-434.445) [-430.886] (-436.927) (-432.979) * (-432.262) (-432.519) (-431.326) [-431.289] -- 0:00:47
      188000 -- (-432.381) [-431.543] (-430.989) (-431.124) * (-432.469) (-433.131) [-430.832] (-430.540) -- 0:00:47
      188500 -- (-430.210) (-437.548) (-430.291) [-432.184] * (-431.515) (-433.513) [-432.017] (-432.465) -- 0:00:47
      189000 -- (-432.425) (-431.483) [-430.462] (-430.648) * (-432.110) [-430.635] (-431.424) (-432.970) -- 0:00:47
      189500 -- (-430.914) [-430.333] (-432.565) (-430.890) * (-431.570) (-431.619) (-431.728) [-431.888] -- 0:00:47
      190000 -- (-433.372) (-432.442) [-431.545] (-436.649) * (-432.724) (-430.657) (-430.802) [-432.632] -- 0:00:46

      Average standard deviation of split frequencies: 0.015998

      190500 -- (-435.480) (-434.466) (-431.269) [-431.553] * [-432.089] (-431.220) (-432.024) (-431.009) -- 0:00:46
      191000 -- (-431.893) (-430.371) [-431.307] (-433.441) * (-433.057) (-434.433) (-431.924) [-433.421] -- 0:00:46
      191500 -- (-433.539) (-432.925) [-431.241] (-431.619) * (-430.705) (-430.527) [-430.986] (-433.703) -- 0:00:46
      192000 -- (-437.195) [-431.495] (-433.865) (-432.336) * (-430.414) (-430.851) (-433.558) [-430.667] -- 0:00:46
      192500 -- (-430.876) (-434.536) [-433.118] (-432.206) * [-432.474] (-431.922) (-432.367) (-433.159) -- 0:00:46
      193000 -- (-431.116) (-434.421) [-431.895] (-431.582) * (-435.951) (-436.262) [-432.929] (-430.847) -- 0:00:45
      193500 -- (-432.974) (-430.978) (-437.669) [-432.874] * [-430.405] (-431.628) (-437.638) (-430.950) -- 0:00:45
      194000 -- (-430.069) (-432.096) [-432.538] (-431.924) * (-432.859) (-433.976) [-432.001] (-432.301) -- 0:00:45
      194500 -- (-433.609) [-432.068] (-430.226) (-431.459) * (-433.297) (-433.290) (-432.710) [-431.122] -- 0:00:45
      195000 -- (-432.771) (-437.822) (-431.018) [-430.183] * (-430.992) (-432.432) (-433.402) [-431.529] -- 0:00:45

      Average standard deviation of split frequencies: 0.016270

      195500 -- (-432.230) (-434.869) (-430.465) [-430.761] * (-431.844) [-430.808] (-435.893) (-432.195) -- 0:00:45
      196000 -- (-431.092) (-434.284) [-431.895] (-431.529) * (-430.500) (-431.982) [-432.582] (-432.479) -- 0:00:45
      196500 -- (-433.851) (-431.984) [-433.105] (-432.108) * [-432.241] (-431.010) (-433.973) (-431.090) -- 0:00:44
      197000 -- (-432.820) [-432.520] (-433.624) (-432.146) * (-432.175) [-432.539] (-433.872) (-433.000) -- 0:00:44
      197500 -- [-432.508] (-431.809) (-433.289) (-432.921) * (-431.899) (-433.269) [-435.490] (-430.791) -- 0:00:44
      198000 -- [-430.841] (-430.296) (-431.084) (-434.701) * (-434.900) [-431.008] (-433.667) (-432.018) -- 0:00:44
      198500 -- (-431.941) (-434.588) (-432.204) [-431.062] * (-432.384) [-431.501] (-431.813) (-439.613) -- 0:00:44
      199000 -- (-431.598) [-431.274] (-433.575) (-429.927) * (-431.076) (-433.723) (-431.533) [-430.361] -- 0:00:44
      199500 -- (-430.089) [-431.867] (-434.744) (-430.430) * (-431.840) [-430.194] (-432.731) (-431.591) -- 0:00:44
      200000 -- (-431.982) (-430.698) (-431.517) [-430.576] * (-433.376) [-431.826] (-433.007) (-434.188) -- 0:00:44

      Average standard deviation of split frequencies: 0.013681

      200500 -- (-435.775) [-431.952] (-432.442) (-431.496) * (-431.008) (-432.827) [-431.770] (-433.024) -- 0:00:47
      201000 -- [-433.834] (-435.053) (-430.752) (-430.155) * (-430.810) (-434.026) [-431.053] (-431.205) -- 0:00:47
      201500 -- [-431.631] (-437.499) (-433.788) (-431.974) * (-430.262) (-434.452) (-432.991) [-431.159] -- 0:00:47
      202000 -- [-432.288] (-432.048) (-431.089) (-432.367) * (-432.387) (-431.824) (-430.147) [-430.917] -- 0:00:47
      202500 -- (-432.791) (-433.191) [-430.108] (-439.293) * (-434.120) [-431.068] (-431.216) (-431.173) -- 0:00:47
      203000 -- (-432.637) [-433.682] (-430.133) (-431.116) * (-432.507) (-431.046) [-430.632] (-430.663) -- 0:00:47
      203500 -- (-432.574) (-433.016) [-431.777] (-431.736) * (-435.001) (-432.510) (-432.178) [-438.462] -- 0:00:46
      204000 -- (-432.136) (-431.423) (-430.658) [-430.876] * [-430.853] (-430.116) (-431.326) (-433.784) -- 0:00:46
      204500 -- (-433.987) (-434.212) (-432.884) [-431.149] * (-430.851) (-432.694) [-432.434] (-435.001) -- 0:00:46
      205000 -- (-432.290) (-431.898) (-431.492) [-431.386] * (-434.186) [-431.727] (-430.549) (-436.132) -- 0:00:46

      Average standard deviation of split frequencies: 0.011696

      205500 -- (-431.670) (-432.178) (-434.459) [-433.063] * [-431.104] (-433.833) (-430.717) (-431.852) -- 0:00:46
      206000 -- (-432.337) (-430.419) [-434.049] (-431.725) * (-430.765) (-433.701) [-436.010] (-432.695) -- 0:00:46
      206500 -- [-432.381] (-431.866) (-431.176) (-432.433) * (-430.175) (-431.008) (-437.812) [-432.088] -- 0:00:46
      207000 -- [-432.824] (-432.577) (-434.887) (-435.352) * (-434.296) [-430.201] (-432.360) (-431.782) -- 0:00:45
      207500 -- (-433.004) [-432.587] (-435.725) (-434.962) * [-434.286] (-430.985) (-430.944) (-436.306) -- 0:00:45
      208000 -- (-431.757) [-433.460] (-433.172) (-433.742) * (-430.853) (-435.784) [-431.809] (-433.621) -- 0:00:45
      208500 -- (-434.437) (-433.209) [-432.535] (-433.163) * (-436.174) (-433.828) [-430.808] (-432.366) -- 0:00:45
      209000 -- (-433.447) (-432.409) [-433.471] (-434.013) * (-432.537) [-432.822] (-432.968) (-431.608) -- 0:00:45
      209500 -- (-430.525) (-433.166) (-433.370) [-435.186] * (-436.234) (-434.669) [-431.847] (-433.655) -- 0:00:45
      210000 -- (-431.588) (-433.226) [-433.028] (-433.249) * (-431.607) [-431.508] (-430.744) (-433.643) -- 0:00:45

      Average standard deviation of split frequencies: 0.010794

      210500 -- [-431.013] (-436.035) (-436.077) (-436.191) * (-432.875) [-433.018] (-433.098) (-434.069) -- 0:00:45
      211000 -- (-431.180) [-431.998] (-435.566) (-432.394) * (-431.271) (-434.009) [-433.850] (-435.236) -- 0:00:44
      211500 -- (-433.454) [-431.210] (-432.447) (-433.536) * (-430.860) (-434.362) (-432.152) [-432.746] -- 0:00:44
      212000 -- (-431.374) (-430.905) (-437.751) [-431.306] * (-431.350) [-431.236] (-432.754) (-430.457) -- 0:00:44
      212500 -- (-435.395) (-432.669) (-431.443) [-430.786] * (-434.191) [-431.823] (-432.696) (-431.714) -- 0:00:44
      213000 -- [-432.843] (-433.704) (-430.631) (-434.278) * (-435.952) (-430.314) [-432.423] (-435.506) -- 0:00:44
      213500 -- (-430.009) (-429.997) [-431.333] (-430.561) * (-436.477) [-430.525] (-430.703) (-431.530) -- 0:00:44
      214000 -- [-432.350] (-431.902) (-430.848) (-433.566) * (-432.355) (-433.710) (-431.551) [-432.607] -- 0:00:44
      214500 -- (-430.238) [-431.016] (-431.093) (-437.737) * [-434.754] (-433.911) (-432.400) (-431.162) -- 0:00:43
      215000 -- (-431.003) (-431.585) (-430.836) [-433.396] * (-430.376) (-430.540) (-432.462) [-432.787] -- 0:00:43

      Average standard deviation of split frequencies: 0.011297

      215500 -- (-430.386) [-433.035] (-430.470) (-432.465) * (-430.767) [-431.268] (-435.770) (-430.353) -- 0:00:43
      216000 -- [-433.308] (-432.011) (-433.094) (-435.706) * [-430.200] (-431.499) (-436.484) (-430.356) -- 0:00:43
      216500 -- (-432.461) [-431.528] (-435.407) (-436.943) * [-433.161] (-431.687) (-433.557) (-430.451) -- 0:00:43
      217000 -- (-431.893) [-431.582] (-431.661) (-433.800) * [-432.410] (-432.146) (-430.288) (-431.093) -- 0:00:43
      217500 -- [-433.190] (-435.162) (-432.809) (-432.909) * (-433.115) [-430.447] (-430.439) (-431.184) -- 0:00:43
      218000 -- (-432.974) [-431.540] (-432.466) (-431.401) * [-433.101] (-430.689) (-434.163) (-437.008) -- 0:00:46
      218500 -- (-434.940) (-431.303) [-434.361] (-434.860) * (-430.888) (-431.233) [-430.966] (-432.705) -- 0:00:46
      219000 -- (-432.839) [-437.421] (-436.780) (-438.040) * (-431.927) (-431.890) [-434.786] (-430.397) -- 0:00:46
      219500 -- (-435.627) (-431.557) (-431.680) [-432.995] * [-433.529] (-432.405) (-437.552) (-430.910) -- 0:00:46
      220000 -- (-435.399) [-431.443] (-431.989) (-436.120) * (-433.856) [-432.042] (-431.265) (-431.647) -- 0:00:46

      Average standard deviation of split frequencies: 0.010053

      220500 -- (-433.283) (-432.798) (-430.007) [-432.751] * (-432.070) [-432.283] (-431.057) (-432.498) -- 0:00:45
      221000 -- (-432.828) [-431.771] (-430.241) (-431.750) * [-431.503] (-430.515) (-433.180) (-430.998) -- 0:00:45
      221500 -- (-432.130) (-433.768) [-433.465] (-432.759) * (-430.608) (-432.084) [-432.013] (-433.453) -- 0:00:45
      222000 -- (-431.327) (-433.798) [-433.765] (-430.821) * (-433.878) (-436.409) (-430.636) [-431.923] -- 0:00:45
      222500 -- [-432.382] (-434.711) (-430.977) (-430.379) * [-431.565] (-434.919) (-433.205) (-431.829) -- 0:00:45
      223000 -- (-433.278) (-433.263) (-435.912) [-433.702] * (-432.301) (-433.008) [-435.375] (-432.734) -- 0:00:45
      223500 -- (-430.514) (-431.485) (-433.124) [-430.548] * [-430.516] (-433.449) (-435.712) (-431.216) -- 0:00:45
      224000 -- (-430.156) [-431.391] (-430.802) (-433.634) * (-430.267) (-436.310) [-436.525] (-430.967) -- 0:00:45
      224500 -- (-433.080) (-432.356) (-437.706) [-433.229] * (-430.441) (-430.859) [-431.860] (-433.387) -- 0:00:44
      225000 -- [-434.109] (-431.642) (-432.456) (-435.740) * (-430.005) [-431.308] (-436.436) (-432.425) -- 0:00:44

      Average standard deviation of split frequencies: 0.011704

      225500 -- [-434.110] (-433.749) (-433.233) (-435.967) * (-433.509) [-432.438] (-432.980) (-433.413) -- 0:00:44
      226000 -- (-432.937) (-432.155) (-435.635) [-431.815] * (-432.706) (-430.627) (-430.889) [-431.860] -- 0:00:44
      226500 -- (-430.566) (-430.958) (-430.897) [-433.073] * (-432.531) (-430.767) (-434.039) [-431.570] -- 0:00:44
      227000 -- (-432.170) [-431.808] (-433.282) (-431.198) * (-436.285) (-431.419) (-432.003) [-430.721] -- 0:00:44
      227500 -- (-432.992) (-436.293) (-431.024) [-431.373] * (-435.053) (-432.889) (-430.458) [-432.167] -- 0:00:44
      228000 -- (-431.665) (-432.277) [-432.492] (-431.595) * (-432.100) (-430.030) [-434.347] (-430.353) -- 0:00:44
      228500 -- (-432.126) (-432.842) [-430.822] (-433.235) * [-434.496] (-430.779) (-431.201) (-433.297) -- 0:00:43
      229000 -- [-431.430] (-434.217) (-430.566) (-431.438) * (-432.307) (-431.395) (-432.482) [-430.259] -- 0:00:43
      229500 -- [-430.776] (-434.596) (-439.898) (-431.756) * (-433.221) [-432.412] (-431.603) (-430.759) -- 0:00:43
      230000 -- (-433.864) (-436.883) (-431.711) [-434.969] * (-434.782) (-431.993) [-436.641] (-433.237) -- 0:00:43

      Average standard deviation of split frequencies: 0.011127

      230500 -- [-431.780] (-431.790) (-435.902) (-432.232) * (-431.927) (-433.559) (-433.573) [-433.133] -- 0:00:43
      231000 -- (-431.361) [-433.867] (-432.522) (-432.982) * (-432.859) [-431.528] (-431.450) (-431.906) -- 0:00:43
      231500 -- (-433.375) (-432.621) (-431.042) [-432.923] * [-432.234] (-431.769) (-430.907) (-438.160) -- 0:00:43
      232000 -- (-433.080) (-431.941) (-432.562) [-433.509] * (-436.648) (-431.426) (-430.251) [-432.745] -- 0:00:43
      232500 -- (-433.782) [-432.007] (-431.027) (-431.468) * (-433.182) (-431.778) [-429.813] (-432.247) -- 0:00:42
      233000 -- (-436.953) [-430.846] (-433.584) (-433.559) * [-430.372] (-432.934) (-432.205) (-432.058) -- 0:00:42
      233500 -- (-431.144) (-430.490) (-430.801) [-430.887] * (-431.909) (-431.360) [-432.518] (-430.871) -- 0:00:42
      234000 -- (-431.640) (-430.500) [-431.235] (-435.736) * [-430.455] (-435.520) (-431.265) (-433.660) -- 0:00:42
      234500 -- [-431.794] (-433.454) (-435.956) (-430.586) * (-434.583) (-432.951) [-433.534] (-433.972) -- 0:00:42
      235000 -- (-433.075) (-437.212) (-435.494) [-430.726] * (-437.129) (-434.999) [-430.280] (-430.269) -- 0:00:45

      Average standard deviation of split frequencies: 0.011652

      235500 -- (-433.559) (-431.240) [-430.888] (-434.526) * (-440.119) [-434.358] (-431.499) (-432.711) -- 0:00:45
      236000 -- [-433.930] (-431.954) (-431.339) (-431.817) * (-431.986) (-432.021) (-431.480) [-432.882] -- 0:00:45
      236500 -- (-432.503) (-430.759) (-438.317) [-431.170] * (-434.503) [-431.616] (-431.635) (-432.857) -- 0:00:45
      237000 -- (-430.847) (-431.026) (-434.540) [-431.407] * (-433.917) (-433.503) (-433.699) [-433.226] -- 0:00:45
      237500 -- (-431.211) (-431.677) (-433.417) [-431.414] * (-431.898) (-432.833) (-432.098) [-433.160] -- 0:00:44
      238000 -- (-434.988) (-432.240) [-433.368] (-433.655) * [-432.800] (-432.693) (-432.287) (-432.083) -- 0:00:44
      238500 -- (-431.766) (-431.724) (-436.798) [-431.257] * [-431.048] (-434.666) (-436.191) (-430.664) -- 0:00:44
      239000 -- (-430.425) (-435.856) [-436.138] (-432.411) * (-434.110) (-431.056) (-437.038) [-430.590] -- 0:00:44
      239500 -- (-432.803) [-431.919] (-433.464) (-430.340) * (-434.703) (-431.057) (-436.372) [-430.730] -- 0:00:44
      240000 -- (-437.723) (-433.010) [-431.839] (-431.090) * (-431.400) (-432.636) (-430.689) [-430.861] -- 0:00:44

      Average standard deviation of split frequencies: 0.011292

      240500 -- (-431.964) [-430.726] (-432.493) (-434.150) * [-431.572] (-433.933) (-431.356) (-433.286) -- 0:00:44
      241000 -- (-431.469) (-435.391) [-434.087] (-432.959) * (-433.079) (-432.149) (-431.019) [-431.532] -- 0:00:44
      241500 -- (-432.588) (-434.919) (-432.462) [-433.371] * (-433.053) (-432.350) [-436.278] (-431.995) -- 0:00:43
      242000 -- (-432.695) (-437.819) (-431.635) [-432.552] * [-434.296] (-432.948) (-433.327) (-430.737) -- 0:00:43
      242500 -- (-433.367) (-432.617) (-433.870) [-431.371] * (-431.497) (-433.040) (-432.699) [-430.543] -- 0:00:43
      243000 -- (-431.103) [-430.733] (-434.058) (-431.656) * [-433.541] (-433.539) (-434.346) (-433.599) -- 0:00:43
      243500 -- (-432.743) (-433.222) (-430.353) [-434.414] * (-433.751) (-434.331) [-430.251] (-431.845) -- 0:00:43
      244000 -- (-436.165) (-431.406) [-431.590] (-431.060) * (-433.405) [-431.874] (-437.620) (-434.106) -- 0:00:43
      244500 -- (-430.978) [-430.445] (-431.542) (-431.124) * (-430.075) (-435.945) [-434.289] (-430.534) -- 0:00:43
      245000 -- (-435.398) [-435.343] (-432.249) (-432.495) * (-430.944) (-434.416) [-431.416] (-430.908) -- 0:00:43

      Average standard deviation of split frequencies: 0.010859

      245500 -- (-431.108) [-434.727] (-430.900) (-431.164) * (-431.869) (-431.326) (-431.104) [-432.179] -- 0:00:43
      246000 -- (-431.947) (-432.002) (-431.015) [-433.074] * (-434.612) (-429.959) [-434.207] (-431.772) -- 0:00:42
      246500 -- (-429.951) [-432.753] (-432.109) (-434.949) * (-434.949) (-431.692) [-433.672] (-430.299) -- 0:00:42
      247000 -- [-432.443] (-431.638) (-433.101) (-432.954) * (-431.268) [-432.756] (-435.761) (-431.380) -- 0:00:42
      247500 -- (-433.824) (-432.838) (-432.820) [-431.526] * (-431.549) (-431.812) [-433.882] (-431.856) -- 0:00:42
      248000 -- (-432.029) (-436.094) (-430.511) [-430.401] * (-431.101) [-430.723] (-431.090) (-433.361) -- 0:00:42
      248500 -- [-434.043] (-432.403) (-433.482) (-431.579) * (-432.863) (-430.915) [-433.155] (-430.903) -- 0:00:42
      249000 -- (-433.208) (-433.641) (-435.885) [-430.547] * (-432.430) (-430.869) (-432.279) [-432.200] -- 0:00:42
      249500 -- (-432.177) [-431.629] (-430.985) (-432.249) * (-435.785) [-430.197] (-434.410) (-435.018) -- 0:00:42
      250000 -- [-431.357] (-431.394) (-430.518) (-434.252) * (-436.003) [-434.495] (-434.970) (-431.880) -- 0:00:42

      Average standard deviation of split frequencies: 0.011173

      250500 -- (-430.264) (-431.355) [-431.709] (-432.130) * (-437.519) [-430.622] (-431.832) (-432.545) -- 0:00:41
      251000 -- (-432.665) (-430.198) [-433.456] (-432.218) * (-432.344) (-432.965) (-431.209) [-430.647] -- 0:00:41
      251500 -- [-432.411] (-433.002) (-432.197) (-435.183) * [-432.478] (-432.863) (-432.868) (-431.084) -- 0:00:41
      252000 -- (-431.564) [-433.456] (-431.065) (-434.626) * (-434.950) (-430.764) [-431.023] (-434.431) -- 0:00:44
      252500 -- (-431.511) [-430.945] (-436.795) (-434.110) * (-431.072) [-431.212] (-430.759) (-436.872) -- 0:00:44
      253000 -- (-434.927) (-436.687) [-431.011] (-430.353) * (-431.699) (-432.194) (-430.553) [-432.168] -- 0:00:44
      253500 -- (-431.968) (-431.999) (-431.550) [-432.238] * (-431.645) (-432.655) [-434.525] (-434.679) -- 0:00:44
      254000 -- (-432.065) [-433.339] (-430.261) (-434.376) * (-434.346) [-433.865] (-431.003) (-432.992) -- 0:00:44
      254500 -- (-436.489) [-433.297] (-430.823) (-435.493) * (-433.705) (-433.887) [-429.987] (-433.702) -- 0:00:43
      255000 -- (-436.514) (-431.484) (-433.783) [-435.071] * [-434.136] (-430.779) (-435.429) (-431.350) -- 0:00:43

      Average standard deviation of split frequencies: 0.010615

      255500 -- (-436.782) (-435.187) (-435.371) [-435.309] * (-432.916) (-432.195) (-431.566) [-432.819] -- 0:00:43
      256000 -- [-434.283] (-433.666) (-431.102) (-437.009) * [-430.946] (-436.690) (-432.443) (-431.324) -- 0:00:43
      256500 -- [-432.376] (-432.759) (-430.767) (-433.324) * [-431.904] (-433.144) (-432.088) (-430.868) -- 0:00:43
      257000 -- (-431.177) (-430.881) [-431.123] (-430.237) * (-430.815) (-430.979) (-432.375) [-430.844] -- 0:00:43
      257500 -- (-432.821) [-431.316] (-431.057) (-434.501) * (-434.065) [-430.860] (-431.154) (-434.375) -- 0:00:43
      258000 -- (-431.171) [-431.492] (-430.433) (-429.969) * (-431.217) (-431.648) (-432.518) [-431.475] -- 0:00:43
      258500 -- (-432.572) (-432.697) [-430.510] (-434.647) * (-430.870) [-431.690] (-434.389) (-431.516) -- 0:00:43
      259000 -- [-430.576] (-432.538) (-434.405) (-431.779) * (-432.963) (-431.924) (-431.265) [-430.779] -- 0:00:42
      259500 -- (-433.776) (-433.484) [-435.858] (-430.592) * (-433.522) [-435.725] (-432.319) (-432.968) -- 0:00:42
      260000 -- (-432.208) [-431.845] (-441.452) (-431.140) * (-433.021) [-434.181] (-431.202) (-433.312) -- 0:00:42

      Average standard deviation of split frequencies: 0.011595

      260500 -- [-431.130] (-433.127) (-444.088) (-433.405) * (-431.476) (-434.586) (-432.608) [-430.320] -- 0:00:42
      261000 -- (-430.682) [-430.757] (-434.948) (-432.023) * (-431.750) [-431.070] (-434.484) (-430.533) -- 0:00:42
      261500 -- (-432.098) (-434.209) [-431.798] (-432.039) * (-433.762) (-432.115) (-434.465) [-430.512] -- 0:00:42
      262000 -- (-432.365) (-431.497) (-431.969) [-432.075] * (-433.220) [-431.487] (-431.279) (-437.787) -- 0:00:42
      262500 -- (-431.186) (-434.299) [-431.249] (-431.521) * (-430.895) (-431.238) [-434.857] (-434.976) -- 0:00:42
      263000 -- (-430.334) (-431.526) (-432.116) [-430.081] * (-431.265) [-432.042] (-435.935) (-437.297) -- 0:00:42
      263500 -- (-431.499) [-433.214] (-435.121) (-431.778) * (-436.279) [-433.216] (-431.693) (-438.418) -- 0:00:41
      264000 -- (-431.543) (-431.646) (-433.184) [-431.906] * (-431.040) (-434.831) (-432.856) [-435.059] -- 0:00:41
      264500 -- [-431.627] (-431.404) (-435.959) (-431.830) * (-431.245) (-432.573) [-431.745] (-434.783) -- 0:00:41
      265000 -- (-430.696) (-435.318) [-430.784] (-431.909) * (-436.375) [-432.166] (-434.054) (-433.471) -- 0:00:41

      Average standard deviation of split frequencies: 0.010737

      265500 -- (-431.190) (-432.011) (-432.757) [-433.055] * (-430.506) (-432.877) (-431.848) [-431.207] -- 0:00:41
      266000 -- (-434.450) (-430.970) (-431.972) [-429.989] * (-430.029) (-431.186) (-431.011) [-431.802] -- 0:00:41
      266500 -- (-436.771) (-432.114) [-437.711] (-430.058) * (-434.179) (-433.919) (-433.044) [-432.527] -- 0:00:41
      267000 -- (-436.308) (-434.121) (-441.274) [-430.363] * (-431.721) (-432.132) (-433.596) [-436.225] -- 0:00:41
      267500 -- [-432.260] (-435.213) (-431.748) (-432.945) * (-431.831) (-432.911) [-431.302] (-431.161) -- 0:00:41
      268000 -- (-430.649) [-432.875] (-432.990) (-432.158) * (-432.311) (-433.721) [-431.893] (-430.290) -- 0:00:40
      268500 -- (-431.944) [-434.931] (-431.518) (-436.867) * (-431.338) (-430.989) (-431.024) [-431.669] -- 0:00:40
      269000 -- (-431.721) (-431.470) (-430.169) [-431.988] * (-431.858) [-431.270] (-431.853) (-430.474) -- 0:00:40
      269500 -- (-435.500) (-432.850) (-431.626) [-430.724] * (-433.280) (-430.584) [-432.967] (-432.222) -- 0:00:43
      270000 -- [-430.132] (-431.847) (-431.294) (-430.865) * (-430.620) (-430.722) (-431.114) [-431.191] -- 0:00:43

      Average standard deviation of split frequencies: 0.011269

      270500 -- (-433.278) (-431.492) [-432.653] (-430.619) * (-432.497) (-432.087) [-431.499] (-431.895) -- 0:00:43
      271000 -- (-430.964) (-432.102) (-433.831) [-430.760] * (-431.872) [-432.558] (-429.993) (-434.379) -- 0:00:43
      271500 -- (-432.311) [-430.918] (-432.995) (-431.058) * [-431.710] (-433.782) (-431.690) (-433.239) -- 0:00:42
      272000 -- (-432.691) [-434.709] (-432.246) (-431.869) * [-431.318] (-431.706) (-432.176) (-431.354) -- 0:00:42
      272500 -- (-432.503) (-434.232) (-435.844) [-430.534] * (-432.028) (-430.936) [-430.282] (-433.910) -- 0:00:42
      273000 -- (-431.493) (-430.751) [-431.087] (-433.090) * (-430.908) (-432.834) [-430.005] (-433.123) -- 0:00:42
      273500 -- (-430.577) (-435.159) (-430.298) [-430.989] * (-431.553) (-432.081) (-431.088) [-432.312] -- 0:00:42
      274000 -- (-435.181) [-430.660] (-430.802) (-431.415) * (-434.173) (-438.163) (-433.057) [-436.999] -- 0:00:42
      274500 -- (-432.267) (-430.574) (-430.675) [-431.630] * (-432.217) (-433.586) (-436.236) [-431.089] -- 0:00:42
      275000 -- (-433.470) (-430.100) [-432.997] (-435.249) * [-431.002] (-432.165) (-433.495) (-432.215) -- 0:00:42

      Average standard deviation of split frequencies: 0.010750

      275500 -- (-436.330) (-431.704) [-433.380] (-434.365) * (-433.007) [-431.500] (-432.786) (-432.525) -- 0:00:42
      276000 -- (-434.344) (-431.017) [-432.213] (-434.203) * (-431.623) (-430.200) (-434.434) [-433.052] -- 0:00:41
      276500 -- (-432.680) (-431.407) [-431.267] (-431.680) * (-432.566) (-431.522) [-430.639] (-431.471) -- 0:00:41
      277000 -- (-432.247) [-434.925] (-434.603) (-431.467) * (-435.600) (-433.517) (-430.957) [-433.292] -- 0:00:41
      277500 -- [-432.604] (-431.921) (-435.106) (-430.439) * (-436.199) (-435.004) [-432.044] (-432.532) -- 0:00:41
      278000 -- (-433.354) (-429.998) [-431.233] (-431.839) * (-430.414) [-430.716] (-430.942) (-432.217) -- 0:00:41
      278500 -- (-435.075) (-430.802) [-434.161] (-430.543) * (-432.604) [-430.882] (-431.209) (-433.832) -- 0:00:41
      279000 -- (-432.312) [-433.846] (-432.710) (-431.286) * (-432.192) (-432.634) [-431.638] (-432.049) -- 0:00:41
      279500 -- (-430.346) [-433.838] (-433.657) (-432.885) * [-430.574] (-431.769) (-431.360) (-431.516) -- 0:00:41
      280000 -- [-430.492] (-432.953) (-430.628) (-431.019) * (-430.497) (-432.096) [-431.192] (-432.202) -- 0:00:41

      Average standard deviation of split frequencies: 0.011757

      280500 -- (-432.327) (-435.336) [-431.840] (-430.996) * (-433.657) [-431.756] (-433.360) (-430.576) -- 0:00:41
      281000 -- [-432.142] (-433.227) (-431.793) (-435.013) * [-432.853] (-430.308) (-434.995) (-430.576) -- 0:00:40
      281500 -- (-435.683) (-432.290) [-432.361] (-430.184) * [-433.217] (-432.496) (-433.711) (-433.294) -- 0:00:40
      282000 -- (-432.195) (-433.255) [-431.432] (-433.204) * [-432.248] (-432.017) (-431.400) (-432.699) -- 0:00:40
      282500 -- (-436.257) [-430.668] (-431.781) (-430.661) * [-432.200] (-433.081) (-431.305) (-431.057) -- 0:00:40
      283000 -- (-440.017) (-430.389) [-432.411] (-431.058) * (-433.052) (-431.329) [-432.389] (-434.280) -- 0:00:40
      283500 -- (-434.447) (-432.981) (-432.685) [-431.757] * (-431.878) (-432.380) (-431.178) [-434.064] -- 0:00:40
      284000 -- (-436.432) (-430.590) [-431.052] (-431.134) * [-433.855] (-434.372) (-431.090) (-431.894) -- 0:00:40
      284500 -- (-433.963) (-432.036) (-434.255) [-431.699] * (-432.201) (-430.240) [-431.613] (-431.048) -- 0:00:40
      285000 -- (-432.051) (-431.403) (-430.970) [-432.952] * (-431.453) (-433.084) [-434.937] (-434.694) -- 0:00:40

      Average standard deviation of split frequencies: 0.012217

      285500 -- (-431.677) (-433.637) (-433.996) [-436.368] * (-430.542) [-431.362] (-432.425) (-431.536) -- 0:00:40
      286000 -- (-431.345) (-430.657) [-430.852] (-433.444) * (-431.259) [-432.239] (-431.537) (-432.961) -- 0:00:39
      286500 -- [-433.590] (-431.136) (-436.222) (-434.734) * (-436.386) (-430.860) [-436.640] (-433.385) -- 0:00:42
      287000 -- (-430.360) [-430.340] (-435.204) (-433.734) * (-433.887) (-430.216) [-441.831] (-437.309) -- 0:00:42
      287500 -- (-431.938) [-433.192] (-433.672) (-432.094) * (-433.111) [-430.851] (-432.269) (-433.872) -- 0:00:42
      288000 -- (-431.201) [-433.976] (-432.524) (-436.998) * (-432.202) [-432.341] (-431.937) (-435.162) -- 0:00:42
      288500 -- [-435.206] (-430.955) (-432.354) (-433.312) * (-431.001) (-430.938) (-436.209) [-429.876] -- 0:00:41
      289000 -- (-431.866) (-431.277) [-433.750] (-433.503) * (-435.435) [-432.168] (-438.296) (-432.110) -- 0:00:41
      289500 -- [-434.524] (-430.384) (-435.772) (-431.886) * [-431.255] (-430.570) (-434.582) (-434.127) -- 0:00:41
      290000 -- (-432.361) (-432.931) (-433.506) [-433.088] * (-433.755) (-433.654) [-434.186] (-431.595) -- 0:00:41

      Average standard deviation of split frequencies: 0.011257

      290500 -- (-430.998) (-432.148) [-430.343] (-430.964) * [-431.370] (-440.059) (-430.810) (-432.142) -- 0:00:41
      291000 -- (-431.832) [-435.838] (-430.625) (-431.365) * (-433.863) (-434.480) [-432.638] (-433.367) -- 0:00:41
      291500 -- (-435.275) (-434.505) (-431.011) [-430.333] * (-430.934) (-430.343) (-432.357) [-432.618] -- 0:00:41
      292000 -- (-433.380) [-431.901] (-431.505) (-431.037) * (-431.208) (-435.065) [-432.631] (-432.354) -- 0:00:41
      292500 -- [-432.873] (-434.511) (-431.738) (-430.736) * (-433.605) (-432.900) (-430.870) [-432.055] -- 0:00:41
      293000 -- (-430.250) (-433.486) [-431.675] (-430.570) * (-431.926) (-432.480) [-432.439] (-432.771) -- 0:00:41
      293500 -- (-432.885) [-434.461] (-431.868) (-432.973) * [-431.494] (-434.290) (-431.014) (-433.277) -- 0:00:40
      294000 -- (-431.299) (-433.727) (-432.229) [-431.530] * (-431.020) (-431.971) [-434.572] (-433.991) -- 0:00:40
      294500 -- (-433.926) (-433.849) [-431.461] (-430.607) * [-432.593] (-434.257) (-432.483) (-433.731)