--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:55:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/atpE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -333.71 -336.26
2 -333.70 -336.44
--------------------------------------
TOTAL -333.71 -336.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898796 0.090310 0.362704 1.493182 0.871571 1322.83 1411.91 1.000
r(A<->C){all} 0.168155 0.019902 0.000007 0.441546 0.131600 168.02 247.53 1.000
r(A<->G){all} 0.162345 0.018712 0.000322 0.438521 0.126330 203.39 235.20 1.005
r(A<->T){all} 0.172096 0.021761 0.000050 0.467694 0.132409 131.31 246.90 1.000
r(C<->G){all} 0.164994 0.018867 0.000191 0.438531 0.129919 145.63 237.33 1.000
r(C<->T){all} 0.164587 0.019431 0.000029 0.448468 0.128983 260.00 285.97 1.000
r(G<->T){all} 0.167824 0.019140 0.000022 0.445604 0.134111 146.33 220.84 1.000
pi(A){all} 0.169690 0.000577 0.124637 0.218880 0.168772 1109.59 1305.30 1.000
pi(C){all} 0.270611 0.000786 0.216311 0.326100 0.270276 1367.34 1434.17 1.000
pi(G){all} 0.295371 0.000823 0.241044 0.352017 0.295428 981.32 1229.52 1.001
pi(T){all} 0.264328 0.000756 0.214262 0.319016 0.262608 1257.62 1334.26 1.000
alpha{1,2} 0.408025 0.235239 0.000169 1.324718 0.234785 1161.58 1331.29 1.002
alpha{3} 0.449584 0.225182 0.000155 1.397465 0.301613 1363.50 1387.18 1.000
pinvar{all} 0.993308 0.000058 0.978386 0.999993 0.995775 1083.81 1207.84 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -315.913444
Model 2: PositiveSelection -315.913444
Model 0: one-ratio -315.913444
Model 7: beta -315.913618
Model 8: beta&w>1 -315.913444
Model 0 vs 1 0.0
Model 2 vs 1 0.0
Model 8 vs 7 3.479999999171923E-4
>C1
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C2
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C3
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C4
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C5
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C6
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=81
C1 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C2 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C3 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C4 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C5 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C6 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
**************************************************
C1 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C2 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C3 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C4 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C5 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C6 TPFFITVGLVEAAYFINLAFMALFVFATPVK
*******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2430]--->[2430]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.602 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C2 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C3 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C4 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C5 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C6 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
**************************************************
C1 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C2 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C3 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C4 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C5 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C6 TPFFITVGLVEAAYFINLAFMALFVFATPVK
*******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C2 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C3 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C4 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C5 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C6 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
**************************************************
C1 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C2 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C3 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C4 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C5 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C6 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
**************************************************
C1 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C2 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C3 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C4 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C5 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C6 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
**************************************************
C1 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C2 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C3 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C4 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C5 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C6 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
**************************************************
C1 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C2 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C3 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C4 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C5 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C6 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
*******************************************
>C1
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C2
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C3
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C4
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C5
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C6
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C1
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C2
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C3
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C4
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C5
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C6
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 243 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773226
Setting output file names to "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1856078168
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8945311745
Seed = 755173270
Swapseed = 1579773226
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -543.845616 -- -24.965149
Chain 2 -- -543.845616 -- -24.965149
Chain 3 -- -543.845648 -- -24.965149
Chain 4 -- -543.845648 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -543.845648 -- -24.965149
Chain 2 -- -543.845565 -- -24.965149
Chain 3 -- -543.845648 -- -24.965149
Chain 4 -- -543.845565 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-543.846] (-543.846) (-543.846) (-543.846) * [-543.846] (-543.846) (-543.846) (-543.846)
500 -- (-340.366) (-340.317) (-343.302) [-339.329] * (-345.629) (-342.489) [-346.495] (-354.582) -- 0:00:00
1000 -- (-347.103) [-340.037] (-345.553) (-341.380) * [-344.399] (-339.185) (-338.889) (-347.176) -- 0:00:00
1500 -- (-340.127) (-339.802) [-345.310] (-347.613) * [-340.808] (-346.265) (-341.378) (-355.483) -- 0:00:00
2000 -- (-341.005) [-342.918] (-346.264) (-340.355) * [-343.091] (-343.335) (-353.787) (-340.162) -- 0:00:00
2500 -- (-343.604) [-340.940] (-344.986) (-346.036) * (-341.573) (-346.277) (-345.558) [-336.902] -- 0:00:00
3000 -- (-341.728) [-339.693] (-346.924) (-344.641) * [-348.496] (-340.375) (-349.206) (-345.372) -- 0:05:32
3500 -- [-343.214] (-352.754) (-343.984) (-342.137) * [-342.846] (-347.654) (-345.841) (-348.300) -- 0:04:44
4000 -- (-342.915) [-341.854] (-338.576) (-349.960) * (-338.307) [-337.203] (-362.778) (-344.981) -- 0:04:09
4500 -- (-342.720) (-343.935) (-346.232) [-338.104] * [-338.975] (-347.429) (-344.348) (-341.601) -- 0:03:41
5000 -- (-346.978) [-343.996] (-350.072) (-340.939) * (-343.841) (-346.912) (-349.506) [-341.383] -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-338.943) (-342.727) (-343.374) [-343.554] * (-347.285) [-341.929] (-347.274) (-343.696) -- 0:03:00
6000 -- (-342.685) [-339.034] (-343.655) (-353.037) * (-339.914) [-341.515] (-355.648) (-344.076) -- 0:02:45
6500 -- (-345.319) (-341.460) (-340.913) [-344.687] * (-338.845) [-342.397] (-335.748) (-342.820) -- 0:02:32
7000 -- (-342.061) (-344.314) [-341.960] (-347.461) * (-345.595) (-342.324) [-334.572] (-341.300) -- 0:02:21
7500 -- (-349.641) [-341.282] (-343.990) (-344.949) * (-351.969) [-341.907] (-334.159) (-340.278) -- 0:02:12
8000 -- (-347.995) (-342.564) [-341.220] (-345.672) * [-346.324] (-341.505) (-333.732) (-348.450) -- 0:02:04
8500 -- (-342.763) [-337.576] (-348.503) (-346.621) * (-341.201) (-342.834) [-334.309] (-343.367) -- 0:01:56
9000 -- (-346.715) (-349.501) (-344.691) [-337.277] * (-338.992) (-349.945) [-332.766] (-339.422) -- 0:01:50
9500 -- (-356.259) (-344.338) (-339.389) [-343.575] * (-345.994) (-345.421) [-334.287] (-339.012) -- 0:01:44
10000 -- (-348.612) (-344.638) [-348.239] (-339.361) * (-350.074) (-340.278) (-335.286) [-338.423] -- 0:01:39
Average standard deviation of split frequencies: 0.083969
10500 -- (-336.365) (-346.706) (-342.409) [-341.585] * [-342.268] (-341.755) (-332.626) (-349.484) -- 0:01:34
11000 -- (-334.573) (-354.379) [-343.498] (-345.041) * [-349.368] (-339.699) (-332.269) (-350.832) -- 0:01:29
11500 -- [-337.487] (-340.867) (-340.359) (-348.464) * (-340.850) [-338.811] (-332.110) (-345.382) -- 0:01:25
12000 -- (-334.332) [-337.537] (-339.060) (-344.850) * [-343.242] (-348.270) (-333.500) (-341.622) -- 0:01:22
12500 -- [-336.226] (-336.401) (-339.528) (-348.760) * (-339.162) [-339.927] (-333.636) (-347.144) -- 0:01:19
13000 -- (-333.398) [-334.159] (-344.274) (-342.051) * (-343.319) [-341.472] (-335.679) (-340.789) -- 0:01:15
13500 -- (-334.981) [-333.200] (-352.624) (-348.244) * (-347.142) [-338.112] (-336.744) (-355.799) -- 0:01:13
14000 -- (-333.791) [-334.762] (-345.629) (-349.719) * [-343.390] (-343.994) (-340.480) (-344.534) -- 0:01:10
14500 -- (-334.582) [-335.177] (-349.955) (-343.208) * [-337.006] (-344.592) (-341.798) (-339.994) -- 0:01:07
15000 -- [-333.520] (-335.569) (-346.599) (-353.219) * (-350.580) [-345.268] (-334.956) (-345.795) -- 0:01:05
Average standard deviation of split frequencies: 0.084922
15500 -- (-332.905) [-334.621] (-345.690) (-343.933) * (-346.029) [-339.048] (-332.963) (-348.435) -- 0:01:03
16000 -- (-333.871) [-333.304] (-351.404) (-342.500) * [-349.959] (-350.511) (-333.357) (-346.314) -- 0:01:01
16500 -- (-333.099) (-333.365) (-346.198) [-339.370] * (-339.904) (-344.544) [-332.686] (-347.362) -- 0:00:59
17000 -- (-333.438) [-332.678] (-343.131) (-342.624) * (-349.861) (-343.684) (-333.477) [-345.826] -- 0:00:57
17500 -- (-333.886) (-332.596) (-338.960) [-352.662] * [-346.641] (-340.802) (-333.734) (-345.579) -- 0:00:56
18000 -- (-336.800) (-337.065) [-343.289] (-346.571) * (-344.832) (-351.050) [-333.374] (-346.633) -- 0:00:54
18500 -- (-334.148) (-334.854) [-339.477] (-341.323) * (-340.084) (-349.088) (-334.022) [-344.956] -- 0:00:53
19000 -- (-333.819) (-333.451) (-349.771) [-344.403] * [-333.438] (-344.657) (-332.804) (-339.733) -- 0:00:51
19500 -- (-340.923) (-335.890) (-339.899) [-343.695] * [-335.188] (-350.594) (-333.998) (-347.959) -- 0:01:40
20000 -- (-333.084) (-335.145) (-355.338) [-340.105] * (-334.325) [-349.132] (-334.508) (-342.626) -- 0:01:38
Average standard deviation of split frequencies: 0.058292
20500 -- (-333.136) (-334.027) [-345.902] (-346.063) * (-332.383) (-342.544) (-333.390) [-342.693] -- 0:01:35
21000 -- (-333.197) (-334.466) (-348.149) [-346.209] * [-332.486] (-348.172) (-333.087) (-345.817) -- 0:01:33
21500 -- (-335.869) (-335.301) [-336.542] (-356.604) * [-334.955] (-348.211) (-334.899) (-342.516) -- 0:01:31
22000 -- (-341.665) [-334.571] (-348.562) (-358.689) * [-333.449] (-345.130) (-334.419) (-346.442) -- 0:01:28
22500 -- [-334.863] (-335.159) (-348.533) (-357.544) * (-335.764) (-344.242) [-332.286] (-346.462) -- 0:01:26
23000 -- (-333.266) (-334.169) [-336.557] (-349.675) * (-335.461) [-344.648] (-334.556) (-348.161) -- 0:01:24
23500 -- [-332.840] (-334.178) (-335.170) (-338.034) * [-336.002] (-345.930) (-339.504) (-358.073) -- 0:01:23
24000 -- (-335.182) [-336.349] (-333.599) (-344.332) * (-334.702) (-348.914) (-336.807) [-350.479] -- 0:01:21
24500 -- [-333.560] (-333.720) (-332.193) (-335.692) * (-334.752) (-352.534) [-333.578] (-350.694) -- 0:01:19
25000 -- (-332.886) (-345.443) [-334.739] (-335.286) * (-333.932) (-342.961) (-334.557) [-342.839] -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- [-333.320] (-341.536) (-339.335) (-336.427) * [-334.506] (-346.629) (-335.067) (-341.745) -- 0:01:16
26000 -- (-333.573) (-333.385) [-333.331] (-335.950) * [-334.019] (-341.522) (-339.509) (-350.816) -- 0:01:14
26500 -- (-333.097) [-335.418] (-333.220) (-336.391) * (-332.840) (-348.038) [-336.438] (-338.917) -- 0:01:13
27000 -- (-336.059) (-333.967) (-335.861) [-334.327] * [-333.273] (-345.320) (-333.805) (-345.319) -- 0:01:12
27500 -- [-334.652] (-332.767) (-334.080) (-337.722) * (-334.449) [-347.022] (-333.076) (-348.461) -- 0:01:10
28000 -- (-334.966) [-335.532] (-332.729) (-337.102) * (-332.820) (-340.718) (-333.468) [-344.736] -- 0:01:09
28500 -- (-337.060) (-333.651) [-334.424] (-338.092) * (-336.434) (-341.323) [-335.146] (-342.269) -- 0:01:08
29000 -- (-332.164) [-334.765] (-334.277) (-336.945) * [-334.644] (-340.492) (-332.381) (-341.222) -- 0:01:06
29500 -- [-332.071] (-335.384) (-340.978) (-335.172) * (-340.188) (-344.530) [-335.279] (-341.681) -- 0:01:05
30000 -- (-333.865) [-332.684] (-333.707) (-333.779) * (-334.679) [-341.910] (-334.866) (-346.878) -- 0:01:04
Average standard deviation of split frequencies: 0.050161
30500 -- (-334.079) (-336.826) [-333.321] (-332.231) * (-336.530) [-344.839] (-336.465) (-344.206) -- 0:01:03
31000 -- (-333.964) (-334.366) (-334.797) [-333.197] * (-335.951) (-341.795) [-333.357] (-342.218) -- 0:01:02
31500 -- [-333.661] (-334.592) (-332.964) (-336.638) * (-336.819) (-349.212) [-338.565] (-338.400) -- 0:01:01
32000 -- (-334.833) (-333.552) (-333.212) [-333.289] * (-332.405) (-348.709) [-334.812] (-341.039) -- 0:01:00
32500 -- (-334.521) [-333.647] (-335.712) (-335.828) * (-334.847) [-352.494] (-333.924) (-343.386) -- 0:00:59
33000 -- [-333.501] (-337.792) (-334.562) (-343.296) * [-335.087] (-348.883) (-335.223) (-347.954) -- 0:00:58
33500 -- (-333.830) (-342.601) [-333.838] (-335.585) * [-334.167] (-340.493) (-333.862) (-342.867) -- 0:00:57
34000 -- (-333.109) (-338.460) (-333.242) [-337.382] * [-336.492] (-350.964) (-335.652) (-342.542) -- 0:00:56
34500 -- (-335.636) (-335.708) (-334.713) [-335.790] * (-335.043) [-345.949] (-333.389) (-342.593) -- 0:00:55
35000 -- (-334.204) [-335.097] (-340.165) (-335.742) * [-334.533] (-352.451) (-335.814) (-345.657) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-333.361) [-332.620] (-335.269) (-334.774) * [-337.251] (-344.028) (-337.836) (-348.674) -- 0:00:54
36000 -- (-332.893) (-341.417) (-334.437) [-332.724] * [-333.901] (-335.468) (-337.448) (-344.586) -- 0:00:53
36500 -- (-335.713) (-336.471) (-335.804) [-334.807] * (-332.652) [-334.661] (-335.618) (-342.667) -- 0:01:19
37000 -- (-332.863) (-333.808) [-333.559] (-334.827) * (-334.629) [-333.583] (-333.513) (-338.916) -- 0:01:18
37500 -- [-335.276] (-335.927) (-334.887) (-334.052) * [-334.576] (-333.187) (-335.002) (-351.342) -- 0:01:17
38000 -- (-335.251) [-334.861] (-334.391) (-332.882) * [-333.582] (-335.054) (-332.893) (-342.490) -- 0:01:15
38500 -- (-337.895) [-334.760] (-334.318) (-333.805) * (-333.446) (-334.246) [-334.578] (-343.342) -- 0:01:14
39000 -- (-336.798) (-334.285) [-333.102] (-336.249) * [-333.626] (-333.622) (-333.493) (-343.810) -- 0:01:13
39500 -- (-332.628) (-336.055) [-338.327] (-332.916) * (-334.038) (-335.999) [-334.207] (-345.420) -- 0:01:12
40000 -- (-336.030) (-333.805) (-338.059) [-333.439] * (-334.086) (-333.607) [-335.409] (-349.417) -- 0:01:12
Average standard deviation of split frequencies: 0.041731
40500 -- (-335.098) [-334.306] (-337.686) (-335.346) * (-336.294) [-334.878] (-337.270) (-351.546) -- 0:01:11
41000 -- (-333.475) (-334.513) (-332.556) [-337.494] * (-336.462) (-335.630) [-334.842] (-342.831) -- 0:01:10
41500 -- [-335.338] (-332.710) (-333.547) (-334.183) * [-333.780] (-334.968) (-334.894) (-333.404) -- 0:01:09
42000 -- [-332.966] (-337.365) (-333.146) (-333.229) * (-336.365) [-333.220] (-334.781) (-333.196) -- 0:01:08
42500 -- (-332.819) (-334.944) [-334.203] (-332.793) * (-340.220) (-334.320) [-332.293] (-336.198) -- 0:01:07
43000 -- (-333.334) [-334.904] (-334.011) (-333.142) * (-334.566) (-334.493) (-333.856) [-336.156] -- 0:01:06
43500 -- (-335.333) (-336.832) (-335.075) [-336.748] * (-333.003) [-333.834] (-335.286) (-336.034) -- 0:01:05
44000 -- [-333.304] (-336.941) (-333.039) (-337.895) * [-336.977] (-333.647) (-335.755) (-336.345) -- 0:01:05
44500 -- (-333.724) (-335.549) (-334.998) [-332.561] * [-335.639] (-333.332) (-334.576) (-332.237) -- 0:01:04
45000 -- (-333.668) [-332.360] (-334.751) (-340.870) * (-332.853) (-332.821) (-334.287) [-332.099] -- 0:01:03
Average standard deviation of split frequencies: 0.039967
45500 -- (-333.959) [-334.756] (-333.516) (-334.941) * (-334.935) (-335.478) [-335.832] (-332.611) -- 0:01:02
46000 -- (-333.415) (-335.723) [-332.999] (-335.012) * (-334.014) (-333.506) (-336.687) [-336.289] -- 0:01:02
46500 -- [-334.081] (-335.385) (-333.735) (-333.736) * [-333.095] (-335.448) (-334.821) (-335.495) -- 0:01:01
47000 -- (-334.533) (-332.658) (-334.565) [-333.902] * [-334.060] (-337.381) (-333.901) (-335.363) -- 0:01:00
47500 -- (-335.239) [-334.027] (-335.847) (-335.035) * [-336.386] (-344.945) (-332.942) (-342.751) -- 0:01:00
48000 -- [-335.094] (-333.527) (-333.734) (-332.186) * [-333.881] (-334.025) (-332.245) (-338.310) -- 0:00:59
48500 -- [-334.800] (-335.406) (-334.991) (-333.629) * [-335.407] (-335.796) (-333.499) (-334.854) -- 0:00:58
49000 -- (-333.388) (-334.360) [-332.764] (-340.977) * [-334.952] (-332.819) (-333.707) (-332.397) -- 0:00:58
49500 -- [-335.535] (-333.565) (-333.448) (-338.660) * (-335.320) (-343.478) (-335.165) [-332.709] -- 0:00:57
50000 -- (-337.147) (-333.055) (-334.345) [-334.922] * (-333.610) (-336.578) (-336.093) [-332.786] -- 0:00:57
Average standard deviation of split frequencies: 0.041623
50500 -- (-336.817) (-336.247) (-335.157) [-335.650] * (-334.714) (-334.210) [-339.587] (-334.182) -- 0:00:56
51000 -- [-333.921] (-334.300) (-335.701) (-336.603) * (-334.844) [-332.333] (-333.842) (-337.057) -- 0:00:55
51500 -- (-335.517) (-334.464) [-334.990] (-333.430) * [-333.919] (-333.207) (-334.867) (-332.877) -- 0:00:55
52000 -- [-334.725] (-336.206) (-337.256) (-335.116) * [-334.143] (-334.018) (-333.373) (-333.452) -- 0:00:54
52500 -- (-335.804) (-335.675) [-335.310] (-333.955) * [-334.820] (-335.407) (-335.325) (-334.011) -- 0:00:54
53000 -- [-334.117] (-333.144) (-335.887) (-334.158) * (-333.291) [-333.223] (-340.477) (-332.921) -- 0:00:53
53500 -- (-337.202) [-333.025] (-334.571) (-338.076) * [-333.396] (-336.090) (-332.473) (-337.071) -- 0:01:10
54000 -- [-336.047] (-336.003) (-339.033) (-337.871) * (-337.272) (-337.345) [-334.430] (-332.615) -- 0:01:10
54500 -- (-333.597) (-333.750) (-337.272) [-334.661] * (-336.390) (-334.507) (-334.466) [-332.851] -- 0:01:09
55000 -- (-333.344) (-336.246) [-335.271] (-332.750) * (-334.701) (-332.777) (-332.801) [-332.883] -- 0:01:08
Average standard deviation of split frequencies: 0.042976
55500 -- (-335.376) [-335.268] (-334.014) (-335.415) * (-333.491) (-333.497) (-334.299) [-336.558] -- 0:01:08
56000 -- [-334.117] (-335.073) (-335.387) (-335.080) * (-334.254) (-339.081) (-333.370) [-335.278] -- 0:01:07
56500 -- (-339.078) (-335.357) (-332.815) [-333.916] * (-333.950) [-335.772] (-333.483) (-335.121) -- 0:01:06
57000 -- [-335.618] (-334.282) (-332.755) (-333.544) * (-334.849) (-336.599) [-332.312] (-334.072) -- 0:01:06
57500 -- (-336.473) [-340.311] (-334.348) (-332.928) * (-334.080) (-335.760) [-334.912] (-336.085) -- 0:01:05
58000 -- (-338.314) [-335.426] (-337.752) (-334.214) * [-334.004] (-335.925) (-334.258) (-340.614) -- 0:01:04
58500 -- (-334.634) (-333.553) (-338.462) [-334.998] * (-334.792) [-332.949] (-333.929) (-333.542) -- 0:01:04
59000 -- (-336.692) (-333.088) [-333.282] (-333.572) * (-334.853) (-334.790) (-332.697) [-336.858] -- 0:01:03
59500 -- (-335.620) (-333.888) (-335.302) [-333.504] * (-333.149) [-334.005] (-336.101) (-334.820) -- 0:01:03
60000 -- (-335.366) (-332.689) [-335.986] (-332.999) * [-336.891] (-334.301) (-335.293) (-335.388) -- 0:01:02
Average standard deviation of split frequencies: 0.044169
60500 -- (-333.505) [-333.488] (-332.633) (-337.449) * (-335.346) (-335.554) [-333.178] (-336.319) -- 0:01:02
61000 -- [-332.874] (-338.649) (-337.329) (-333.748) * (-335.167) (-336.042) [-340.043] (-340.218) -- 0:01:01
61500 -- [-334.882] (-336.591) (-332.132) (-333.636) * (-334.125) [-335.130] (-336.448) (-335.155) -- 0:01:01
62000 -- (-335.764) (-337.436) [-335.355] (-333.376) * [-333.092] (-332.631) (-336.339) (-333.935) -- 0:01:00
62500 -- [-334.113] (-339.588) (-333.459) (-332.413) * (-336.960) [-334.490] (-334.396) (-333.243) -- 0:01:00
63000 -- [-332.990] (-334.471) (-332.603) (-334.360) * (-334.158) (-333.351) (-335.740) [-336.768] -- 0:00:59
63500 -- [-333.095] (-335.495) (-333.093) (-340.275) * (-334.600) [-335.086] (-334.275) (-332.924) -- 0:00:58
64000 -- (-337.962) (-337.183) [-333.232] (-333.815) * [-335.309] (-333.701) (-334.128) (-337.355) -- 0:00:58
64500 -- [-335.511] (-332.868) (-335.108) (-338.183) * (-338.028) (-340.556) [-334.424] (-333.505) -- 0:00:58
65000 -- [-333.037] (-332.984) (-335.392) (-335.311) * (-334.527) (-338.090) [-333.914] (-334.590) -- 0:00:57
Average standard deviation of split frequencies: 0.037576
65500 -- (-338.864) [-333.086] (-333.138) (-333.618) * (-336.040) (-335.805) (-334.023) [-334.737] -- 0:00:57
66000 -- (-333.939) (-340.909) (-333.162) [-332.534] * [-335.670] (-335.355) (-336.513) (-334.272) -- 0:00:56
66500 -- (-333.633) [-336.211] (-332.934) (-335.932) * [-333.749] (-332.427) (-340.653) (-333.484) -- 0:00:56
67000 -- [-336.745] (-336.337) (-333.167) (-333.360) * [-333.796] (-333.869) (-333.236) (-333.041) -- 0:00:55
67500 -- (-334.879) (-340.354) (-333.636) [-332.311] * (-333.476) (-336.578) [-333.428] (-335.355) -- 0:00:55
68000 -- (-336.728) [-339.906] (-333.793) (-335.251) * (-333.039) (-338.314) [-337.028] (-333.744) -- 0:00:54
68500 -- (-335.683) (-334.773) (-334.320) [-335.692] * (-336.352) (-333.911) [-333.641] (-335.713) -- 0:00:54
69000 -- (-333.485) (-336.478) [-333.401] (-335.777) * (-334.630) [-333.826] (-337.091) (-334.656) -- 0:00:53
69500 -- (-332.959) [-336.391] (-334.621) (-333.519) * [-335.167] (-334.377) (-335.545) (-334.619) -- 0:00:53
70000 -- (-334.268) (-336.843) (-333.445) [-333.401] * (-334.300) [-334.053] (-335.046) (-335.184) -- 0:00:53
Average standard deviation of split frequencies: 0.032774
70500 -- [-333.335] (-335.333) (-336.215) (-333.652) * (-333.548) (-335.668) (-335.591) [-332.354] -- 0:00:52
71000 -- [-333.840] (-335.927) (-336.536) (-334.904) * (-333.050) (-333.620) [-338.672] (-333.755) -- 0:01:05
71500 -- [-333.629] (-337.097) (-336.193) (-332.292) * [-333.477] (-337.125) (-340.977) (-336.015) -- 0:01:04
72000 -- (-336.671) (-335.389) [-337.285] (-334.832) * (-333.546) [-335.304] (-333.510) (-337.099) -- 0:01:04
72500 -- [-335.820] (-334.400) (-333.862) (-333.643) * (-334.123) [-332.463] (-336.136) (-335.402) -- 0:01:03
73000 -- (-334.470) [-333.799] (-333.604) (-335.252) * (-334.853) (-333.905) [-332.859] (-335.884) -- 0:01:03
73500 -- (-336.120) (-332.631) (-336.051) [-333.049] * (-335.055) (-333.796) [-334.804] (-335.563) -- 0:01:03
74000 -- [-335.662] (-332.962) (-335.916) (-334.165) * (-333.664) [-334.494] (-337.256) (-334.937) -- 0:01:02
74500 -- [-334.206] (-335.371) (-336.146) (-333.912) * (-333.318) [-335.113] (-338.102) (-333.176) -- 0:01:02
75000 -- [-335.064] (-335.667) (-338.024) (-337.698) * [-333.182] (-333.825) (-334.743) (-336.244) -- 0:01:01
Average standard deviation of split frequencies: 0.029886
75500 -- (-333.582) [-334.539] (-335.764) (-335.954) * (-334.722) (-334.310) [-332.506] (-332.540) -- 0:01:01
76000 -- (-334.715) (-333.778) (-332.652) [-336.988] * (-338.621) (-335.132) [-333.708] (-333.566) -- 0:01:00
76500 -- (-334.066) (-334.348) [-335.974] (-333.126) * (-336.229) (-334.903) [-332.031] (-336.274) -- 0:01:00
77000 -- (-337.256) (-337.709) (-333.281) [-334.682] * (-335.476) [-334.021] (-334.017) (-334.312) -- 0:00:59
77500 -- (-337.488) [-334.379] (-333.412) (-338.336) * [-334.011] (-334.626) (-332.859) (-337.865) -- 0:00:59
78000 -- (-336.376) (-333.389) (-333.290) [-334.460] * (-332.767) (-333.245) (-333.744) [-335.738] -- 0:00:59
78500 -- (-333.196) [-332.548] (-333.030) (-333.303) * [-332.948] (-336.502) (-332.761) (-336.244) -- 0:00:58
79000 -- (-333.027) [-334.946] (-334.153) (-336.248) * [-335.214] (-333.337) (-336.230) (-332.734) -- 0:00:58
79500 -- (-334.793) (-333.787) (-333.783) [-336.120] * (-343.490) [-336.423] (-334.191) (-333.519) -- 0:00:57
80000 -- (-333.084) (-334.015) [-334.549] (-336.423) * (-334.769) (-334.114) [-333.970] (-338.433) -- 0:00:57
Average standard deviation of split frequencies: 0.027066
80500 -- (-334.680) (-335.176) (-333.502) [-332.559] * [-332.234] (-334.834) (-333.693) (-336.441) -- 0:00:57
81000 -- [-336.681] (-334.476) (-333.192) (-340.705) * (-332.900) (-337.624) (-332.256) [-332.839] -- 0:00:56
81500 -- (-334.899) (-333.102) (-336.352) [-336.079] * (-333.384) (-340.361) (-335.315) [-332.486] -- 0:00:56
82000 -- (-333.031) (-334.632) (-335.126) [-332.832] * [-333.484] (-333.865) (-334.096) (-335.357) -- 0:00:55
82500 -- [-334.706] (-340.727) (-335.205) (-333.422) * (-334.411) (-333.851) (-332.713) [-333.498] -- 0:00:55
83000 -- (-334.928) (-334.837) (-333.710) [-333.359] * [-332.819] (-340.027) (-335.274) (-334.146) -- 0:00:55
83500 -- (-333.964) [-333.632] (-333.368) (-333.696) * [-332.204] (-335.361) (-337.774) (-338.367) -- 0:00:54
84000 -- [-333.819] (-335.062) (-335.879) (-334.065) * [-335.522] (-335.998) (-334.162) (-332.987) -- 0:00:54
84500 -- (-332.627) [-333.333] (-332.993) (-334.178) * (-334.569) (-334.269) (-335.504) [-342.200] -- 0:00:54
85000 -- (-333.734) (-337.068) (-333.644) [-335.635] * (-333.308) [-334.412] (-339.205) (-338.734) -- 0:00:53
Average standard deviation of split frequencies: 0.026542
85500 -- (-337.833) [-335.469] (-338.572) (-334.250) * (-337.054) (-333.360) [-334.210] (-334.590) -- 0:00:53
86000 -- [-339.647] (-334.985) (-333.828) (-332.361) * (-335.786) [-333.315] (-332.449) (-337.901) -- 0:00:53
86500 -- (-335.920) (-334.273) (-334.365) [-332.797] * (-342.825) (-332.740) [-333.956] (-333.062) -- 0:00:52
87000 -- (-335.074) (-334.404) [-334.449] (-336.217) * (-335.679) [-332.241] (-333.453) (-333.239) -- 0:00:52
87500 -- (-333.932) (-334.325) (-332.840) [-334.642] * [-335.385] (-335.723) (-333.398) (-335.514) -- 0:00:52
88000 -- [-338.445] (-334.546) (-332.888) (-337.171) * (-333.367) [-338.123] (-334.170) (-341.955) -- 0:01:02
88500 -- (-333.708) [-337.622] (-334.917) (-334.214) * (-333.752) (-336.072) (-336.878) [-334.672] -- 0:01:01
89000 -- [-333.224] (-336.211) (-334.958) (-334.755) * (-340.540) (-336.589) [-335.164] (-333.365) -- 0:01:01
89500 -- [-332.843] (-333.272) (-334.067) (-337.604) * (-337.836) (-334.989) (-334.534) [-332.904] -- 0:01:01
90000 -- (-336.499) (-333.990) [-333.659] (-337.806) * (-334.627) [-337.313] (-333.285) (-334.572) -- 0:01:00
Average standard deviation of split frequencies: 0.029463
90500 -- (-335.833) (-333.841) [-336.586] (-333.408) * (-335.239) (-334.115) (-332.979) [-333.111] -- 0:01:00
91000 -- (-333.374) (-334.404) (-333.558) [-334.486] * (-333.202) (-333.760) (-335.665) [-335.515] -- 0:00:59
91500 -- [-332.925] (-332.815) (-334.672) (-333.992) * [-334.468] (-335.331) (-334.468) (-333.935) -- 0:00:59
92000 -- (-337.019) (-340.025) (-332.170) [-333.509] * (-335.201) [-332.437] (-336.066) (-333.192) -- 0:00:59
92500 -- (-334.330) (-332.646) (-333.966) [-335.284] * (-333.856) (-333.311) [-333.024] (-332.688) -- 0:00:58
93000 -- [-333.875] (-333.164) (-334.775) (-337.312) * (-334.088) [-332.557] (-333.562) (-336.809) -- 0:00:58
93500 -- (-333.024) (-335.005) (-334.221) [-334.141] * [-334.968] (-334.854) (-333.025) (-335.550) -- 0:00:58
94000 -- (-335.146) (-334.888) [-336.508] (-335.333) * (-333.936) (-334.852) (-336.260) [-333.471] -- 0:00:57
94500 -- [-334.765] (-338.533) (-333.073) (-334.717) * (-333.413) (-335.281) (-333.389) [-333.513] -- 0:00:57
95000 -- (-334.422) (-333.867) [-332.530] (-335.593) * (-334.879) [-333.672] (-340.324) (-335.657) -- 0:00:57
Average standard deviation of split frequencies: 0.027826
95500 -- (-336.734) (-335.149) [-334.965] (-332.725) * [-333.979] (-333.700) (-338.829) (-335.565) -- 0:00:56
96000 -- (-336.535) (-336.583) (-335.328) [-336.460] * (-334.515) (-336.169) [-335.799] (-333.240) -- 0:00:56
96500 -- (-338.804) (-338.593) [-332.895] (-335.605) * (-334.308) [-332.640] (-335.418) (-338.253) -- 0:00:56
97000 -- (-334.804) (-332.700) (-337.603) [-335.802] * (-334.964) [-336.708] (-334.059) (-345.074) -- 0:00:55
97500 -- (-332.753) (-333.494) [-332.786] (-333.176) * (-333.651) (-336.389) [-334.326] (-334.134) -- 0:00:55
98000 -- (-335.854) [-333.859] (-333.707) (-336.254) * (-335.149) (-333.528) [-334.088] (-335.213) -- 0:00:55
98500 -- (-333.510) (-336.491) [-333.449] (-333.355) * (-333.000) (-335.451) [-333.428] (-336.838) -- 0:00:54
99000 -- [-334.231] (-333.153) (-333.105) (-335.903) * (-334.902) (-335.366) (-334.362) [-333.161] -- 0:00:54
99500 -- (-335.451) [-333.082] (-332.770) (-336.422) * (-335.013) (-338.071) (-336.721) [-334.088] -- 0:00:54
100000 -- (-336.412) (-332.985) (-335.796) [-333.592] * (-335.363) (-334.059) [-337.354] (-335.160) -- 0:00:54
Average standard deviation of split frequencies: 0.029474
100500 -- (-335.350) [-332.996] (-335.602) (-334.004) * (-334.671) (-334.068) (-334.644) [-334.038] -- 0:00:53
101000 -- (-337.459) (-336.012) [-333.132] (-337.305) * (-333.501) (-333.923) (-333.218) [-332.846] -- 0:00:53
101500 -- (-332.984) (-332.892) [-334.153] (-336.373) * [-333.719] (-334.879) (-333.455) (-332.448) -- 0:00:53
102000 -- (-332.898) (-333.234) [-333.867] (-333.542) * (-335.849) (-338.947) [-337.447] (-332.516) -- 0:00:52
102500 -- (-333.541) (-335.316) (-335.980) [-335.774] * (-335.671) (-334.218) (-336.777) [-332.883] -- 0:00:52
103000 -- (-337.269) (-333.166) (-335.389) [-332.593] * [-339.626] (-335.954) (-339.085) (-332.516) -- 0:00:52
103500 -- [-334.370] (-334.148) (-333.902) (-338.334) * (-333.460) (-334.112) (-335.192) [-333.214] -- 0:00:51
104000 -- (-335.430) (-335.049) (-336.053) [-335.387] * (-335.807) [-333.168] (-338.776) (-332.442) -- 0:00:51
104500 -- (-333.583) (-335.458) (-336.018) [-332.944] * [-332.769] (-334.070) (-335.600) (-333.290) -- 0:00:51
105000 -- (-332.791) [-333.638] (-335.418) (-336.137) * (-333.257) (-337.749) (-335.086) [-335.849] -- 0:00:59
Average standard deviation of split frequencies: 0.025279
105500 -- (-334.451) (-336.398) [-336.411] (-333.072) * (-332.621) (-335.429) (-332.697) [-333.934] -- 0:00:59
106000 -- (-333.278) (-335.633) (-334.668) [-333.158] * [-335.188] (-335.733) (-332.982) (-334.132) -- 0:00:59
106500 -- (-335.005) (-334.842) [-333.074] (-335.364) * (-333.865) (-340.143) (-338.576) [-337.186] -- 0:00:58
107000 -- [-335.092] (-336.422) (-333.333) (-333.466) * [-333.832] (-334.876) (-335.544) (-335.916) -- 0:00:58
107500 -- (-334.070) [-334.077] (-333.039) (-332.978) * (-335.939) (-333.071) (-335.097) [-332.425] -- 0:00:58
108000 -- (-335.040) (-333.264) [-336.155] (-338.287) * (-333.082) [-333.911] (-334.746) (-333.648) -- 0:00:57
108500 -- (-333.050) [-333.430] (-335.623) (-333.150) * (-333.346) (-333.220) (-337.684) [-334.179] -- 0:00:57
109000 -- (-335.216) (-333.779) [-333.641] (-335.126) * (-334.713) (-334.197) (-335.292) [-333.528] -- 0:00:57
109500 -- (-336.969) (-335.219) [-332.409] (-334.089) * [-334.521] (-332.959) (-333.655) (-333.890) -- 0:00:56
110000 -- (-332.994) [-336.542] (-339.498) (-336.492) * [-334.785] (-332.482) (-337.346) (-336.270) -- 0:00:56
Average standard deviation of split frequencies: 0.023989
110500 -- (-336.024) (-333.877) (-339.250) [-336.338] * (-333.583) [-333.435] (-334.715) (-334.889) -- 0:00:56
111000 -- (-334.117) (-332.915) (-334.997) [-334.506] * (-343.240) (-335.264) [-333.076] (-333.481) -- 0:00:56
111500 -- (-332.418) (-333.537) (-335.555) [-334.164] * (-335.799) (-336.817) (-335.748) [-333.601] -- 0:00:55
112000 -- (-334.202) (-332.935) [-332.580] (-334.226) * (-334.905) [-333.936] (-334.897) (-337.673) -- 0:00:55
112500 -- [-334.193] (-336.291) (-333.838) (-332.862) * [-333.299] (-336.193) (-341.855) (-336.094) -- 0:00:55
113000 -- (-333.582) (-336.282) [-334.741] (-334.817) * [-333.559] (-332.640) (-333.349) (-336.358) -- 0:00:54
113500 -- (-336.293) (-332.570) [-334.559] (-332.780) * [-337.317] (-332.765) (-332.604) (-332.464) -- 0:00:54
114000 -- (-332.702) (-333.028) (-335.743) [-338.456] * (-334.891) (-333.149) [-333.135] (-332.699) -- 0:00:54
114500 -- (-334.713) (-333.477) (-333.008) [-334.298] * (-333.117) (-333.981) (-334.060) [-333.417] -- 0:00:54
115000 -- (-334.082) [-335.409] (-333.026) (-335.514) * [-332.559] (-341.716) (-334.296) (-336.970) -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-332.512) (-337.785) [-332.832] (-334.662) * (-334.702) [-334.346] (-333.733) (-337.912) -- 0:00:53
116000 -- [-337.788] (-333.645) (-332.885) (-335.497) * [-332.417] (-333.787) (-333.380) (-334.929) -- 0:00:53
116500 -- (-335.782) [-334.345] (-332.395) (-334.907) * (-333.406) [-335.669] (-332.914) (-334.670) -- 0:00:53
117000 -- (-332.429) (-333.253) (-332.279) [-335.697] * (-334.795) (-336.664) [-335.132] (-336.788) -- 0:00:52
117500 -- (-335.082) [-334.302] (-334.015) (-337.900) * (-335.520) (-336.558) [-334.762] (-337.571) -- 0:00:52
118000 -- (-333.086) (-334.923) [-333.945] (-335.428) * (-335.452) [-336.414] (-336.554) (-336.683) -- 0:00:52
118500 -- (-333.523) [-334.698] (-334.403) (-333.483) * (-335.760) (-337.970) [-335.533] (-336.918) -- 0:00:52
119000 -- (-335.046) (-333.538) (-333.237) [-334.539] * [-333.191] (-332.541) (-334.008) (-334.854) -- 0:00:51
119500 -- [-335.493] (-335.949) (-334.299) (-333.758) * (-334.538) (-334.798) [-335.377] (-334.919) -- 0:00:51
120000 -- (-333.426) (-333.021) (-334.362) [-332.589] * (-337.502) [-333.737] (-333.940) (-339.557) -- 0:00:51
Average standard deviation of split frequencies: 0.022061
120500 -- (-336.578) (-333.627) (-335.132) [-334.503] * [-335.056] (-336.036) (-337.813) (-335.841) -- 0:00:51
121000 -- (-333.551) (-335.135) [-332.716] (-335.208) * (-337.755) [-334.015] (-343.524) (-333.818) -- 0:00:50
121500 -- [-337.703] (-332.641) (-335.689) (-338.561) * (-337.273) (-335.047) [-333.062] (-334.271) -- 0:00:50
122000 -- [-333.536] (-334.502) (-336.774) (-336.515) * (-339.664) (-335.632) [-334.119] (-332.187) -- 0:00:57
122500 -- [-334.193] (-333.687) (-334.758) (-334.682) * (-348.790) (-333.182) [-334.164] (-333.661) -- 0:00:57
123000 -- [-334.765] (-334.280) (-335.628) (-334.014) * (-333.361) [-333.628] (-335.644) (-335.452) -- 0:00:57
123500 -- (-336.653) (-333.799) (-339.421) [-332.638] * (-333.094) (-332.785) (-334.060) [-333.818] -- 0:00:56
124000 -- (-335.656) (-336.077) [-333.441] (-335.547) * (-335.711) (-333.150) (-332.922) [-334.097] -- 0:00:56
124500 -- (-335.273) (-333.499) (-335.647) [-333.531] * (-334.770) (-333.620) (-335.184) [-333.577] -- 0:00:56
125000 -- (-334.556) (-334.951) (-338.782) [-336.946] * (-332.253) (-337.668) [-334.278] (-333.740) -- 0:00:56
Average standard deviation of split frequencies: 0.019297
125500 -- [-333.678] (-334.163) (-335.430) (-334.012) * (-334.516) [-337.981] (-335.032) (-332.607) -- 0:00:55
126000 -- [-335.864] (-335.145) (-332.902) (-335.444) * (-333.185) [-335.742] (-334.075) (-332.815) -- 0:00:55
126500 -- (-332.693) (-334.973) [-334.371] (-334.089) * (-335.317) (-332.714) (-334.534) [-332.819] -- 0:00:55
127000 -- [-332.882] (-333.483) (-333.441) (-334.277) * (-332.897) (-334.284) (-335.221) [-334.662] -- 0:00:54
127500 -- (-333.241) (-334.545) [-336.012] (-333.882) * (-334.716) (-333.400) (-336.038) [-334.372] -- 0:00:54
128000 -- [-333.263] (-334.166) (-335.789) (-335.112) * [-334.801] (-336.224) (-335.666) (-339.446) -- 0:00:54
128500 -- (-333.274) (-337.000) (-338.108) [-337.247] * (-336.384) (-334.146) (-336.625) [-334.917] -- 0:00:54
129000 -- (-335.972) (-334.969) (-336.595) [-334.660] * [-333.600] (-334.287) (-332.975) (-336.019) -- 0:00:54
129500 -- (-332.876) [-333.250] (-333.060) (-336.147) * [-334.594] (-335.402) (-333.644) (-333.963) -- 0:00:53
130000 -- (-334.688) [-332.056] (-337.012) (-337.677) * [-338.287] (-335.071) (-336.449) (-332.429) -- 0:00:53
Average standard deviation of split frequencies: 0.016836
130500 -- (-341.230) (-333.267) [-335.814] (-336.910) * (-335.237) (-333.571) (-333.966) [-334.217] -- 0:00:53
131000 -- [-334.179] (-333.413) (-334.411) (-337.397) * [-336.765] (-333.407) (-338.253) (-335.261) -- 0:00:53
131500 -- (-335.047) [-334.415] (-335.285) (-333.547) * (-335.994) (-334.388) [-333.985] (-334.835) -- 0:00:52
132000 -- (-337.675) [-332.495] (-334.402) (-335.199) * [-334.939] (-334.010) (-335.754) (-335.690) -- 0:00:52
132500 -- (-334.938) (-334.134) (-335.783) [-334.849] * (-335.467) [-335.101] (-333.407) (-337.724) -- 0:00:52
133000 -- (-337.093) (-338.248) [-333.060] (-337.574) * (-334.282) (-337.006) [-334.079] (-337.338) -- 0:00:52
133500 -- (-334.617) (-334.931) [-332.858] (-335.138) * (-336.098) (-333.859) (-333.387) [-334.164] -- 0:00:51
134000 -- (-333.474) (-333.290) (-332.840) [-333.550] * (-334.250) (-337.933) [-332.349] (-333.768) -- 0:00:51
134500 -- (-336.425) [-333.063] (-334.954) (-334.257) * (-334.400) (-339.452) [-334.033] (-333.138) -- 0:00:51
135000 -- (-336.465) (-338.270) [-334.353] (-335.400) * (-335.332) [-333.418] (-337.765) (-336.209) -- 0:00:51
Average standard deviation of split frequencies: 0.016108
135500 -- (-334.663) (-334.398) (-335.188) [-334.381] * (-334.637) [-334.969] (-334.154) (-333.103) -- 0:00:51
136000 -- (-332.534) (-335.364) [-338.617] (-338.007) * (-336.008) [-334.178] (-334.115) (-334.145) -- 0:00:50
136500 -- (-334.409) (-334.265) (-332.325) [-335.074] * (-335.774) (-332.997) (-335.406) [-333.246] -- 0:00:50
137000 -- [-333.525] (-334.051) (-334.494) (-338.314) * (-332.896) (-340.063) (-333.931) [-334.154] -- 0:00:50
137500 -- (-333.034) [-333.481] (-333.370) (-335.704) * (-333.304) [-334.395] (-333.317) (-333.010) -- 0:00:50
138000 -- [-334.319] (-337.680) (-336.451) (-334.432) * (-333.876) (-335.634) (-334.390) [-335.822] -- 0:00:49
138500 -- (-333.675) (-333.489) (-335.777) [-334.965] * [-334.917] (-334.264) (-337.272) (-335.602) -- 0:00:49
139000 -- (-337.698) [-334.047] (-335.082) (-333.520) * (-334.825) (-333.404) (-333.696) [-334.933] -- 0:00:55
139500 -- (-335.983) (-335.564) [-333.903] (-334.498) * [-333.961] (-333.667) (-333.827) (-334.546) -- 0:00:55
140000 -- [-333.598] (-336.804) (-336.511) (-332.259) * (-332.869) [-333.345] (-334.849) (-334.866) -- 0:00:55
Average standard deviation of split frequencies: 0.015968
140500 -- (-337.123) (-335.197) [-334.374] (-332.693) * (-334.259) [-335.114] (-334.324) (-336.039) -- 0:00:55
141000 -- (-335.225) (-335.881) [-334.150] (-332.760) * (-338.623) (-337.037) [-335.661] (-337.457) -- 0:00:54
141500 -- (-335.420) (-334.554) (-335.621) [-335.302] * (-335.957) (-337.658) (-334.023) [-332.886] -- 0:00:54
142000 -- [-334.251] (-333.811) (-335.320) (-338.883) * [-333.558] (-332.709) (-332.947) (-334.463) -- 0:00:54
142500 -- [-333.413] (-333.261) (-341.992) (-333.801) * (-338.135) [-335.828] (-334.655) (-335.240) -- 0:00:54
143000 -- [-334.395] (-336.021) (-333.939) (-332.332) * (-334.891) [-333.144] (-333.007) (-337.915) -- 0:00:53
143500 -- [-334.409] (-335.843) (-337.111) (-333.519) * (-333.924) (-334.236) [-333.438] (-334.594) -- 0:00:53
144000 -- [-332.452] (-334.452) (-335.588) (-333.147) * (-334.308) [-333.986] (-334.077) (-333.836) -- 0:00:53
144500 -- (-333.203) (-332.305) (-334.732) [-333.253] * [-335.071] (-335.109) (-334.107) (-336.333) -- 0:00:53
145000 -- [-335.629] (-334.968) (-335.119) (-334.124) * (-336.592) (-334.011) (-332.900) [-332.894] -- 0:00:53
Average standard deviation of split frequencies: 0.016654
145500 -- [-334.153] (-333.125) (-333.055) (-336.933) * [-334.161] (-333.076) (-333.942) (-337.464) -- 0:00:52
146000 -- (-337.236) (-336.549) [-336.224] (-334.259) * (-337.741) [-335.126] (-333.093) (-335.823) -- 0:00:52
146500 -- (-334.091) (-334.830) (-333.407) [-332.313] * [-334.723] (-338.888) (-334.434) (-334.990) -- 0:00:52
147000 -- (-333.319) (-335.033) [-335.006] (-333.099) * (-333.905) (-336.668) [-333.441] (-333.200) -- 0:00:52
147500 -- (-335.285) (-333.981) [-333.468] (-335.848) * (-333.511) (-333.622) [-334.115] (-334.438) -- 0:00:52
148000 -- (-334.836) (-333.177) [-334.148] (-334.449) * (-336.501) (-338.766) (-332.962) [-334.901] -- 0:00:51
148500 -- (-336.151) (-334.900) (-334.134) [-336.269] * (-334.695) [-334.806] (-337.547) (-335.126) -- 0:00:51
149000 -- (-337.210) (-333.510) (-334.802) [-337.672] * (-334.570) (-332.950) [-335.115] (-338.157) -- 0:00:51
149500 -- (-335.079) (-333.380) (-333.913) [-334.541] * (-333.360) (-333.483) [-332.733] (-334.201) -- 0:00:51
150000 -- (-336.421) (-332.446) (-335.999) [-334.765] * (-333.663) [-333.515] (-335.084) (-335.685) -- 0:00:51
Average standard deviation of split frequencies: 0.018947
150500 -- (-335.155) (-340.633) (-337.751) [-332.892] * (-334.182) [-333.908] (-336.461) (-333.848) -- 0:00:50
151000 -- (-336.097) [-332.866] (-337.094) (-334.698) * (-334.018) (-334.285) (-337.062) [-332.421] -- 0:00:50
151500 -- (-336.511) [-332.589] (-340.179) (-333.338) * (-332.838) (-335.538) [-335.564] (-337.569) -- 0:00:50
152000 -- [-340.340] (-332.299) (-336.166) (-335.986) * (-336.259) (-333.104) [-332.625] (-333.683) -- 0:00:50
152500 -- (-333.892) (-332.711) (-333.280) [-334.019] * (-333.565) [-332.238] (-335.244) (-332.865) -- 0:00:50
153000 -- [-334.615] (-332.315) (-333.169) (-334.883) * (-333.652) [-334.486] (-335.851) (-334.265) -- 0:00:49
153500 -- (-333.477) (-333.152) (-335.664) [-334.979] * (-333.700) [-334.014] (-333.315) (-335.379) -- 0:00:49
154000 -- [-337.739] (-335.580) (-334.245) (-334.689) * [-334.396] (-341.916) (-335.889) (-332.764) -- 0:00:49
154500 -- (-335.903) [-333.925] (-334.271) (-335.109) * [-334.130] (-332.949) (-333.948) (-332.589) -- 0:00:49
155000 -- (-334.948) (-332.838) (-335.751) [-334.592] * (-333.400) (-337.453) (-333.429) [-332.844] -- 0:00:49
Average standard deviation of split frequencies: 0.018467
155500 -- (-334.838) (-333.626) [-336.996] (-337.732) * (-333.138) [-333.999] (-334.724) (-334.532) -- 0:00:54
156000 -- (-334.356) [-337.578] (-336.805) (-333.004) * [-333.816] (-335.119) (-333.590) (-337.673) -- 0:00:54
156500 -- (-333.035) (-332.904) (-339.195) [-334.476] * (-334.132) [-336.649] (-333.842) (-335.547) -- 0:00:53
157000 -- (-334.370) [-333.083] (-338.266) (-333.683) * (-333.722) (-333.677) [-333.225] (-339.629) -- 0:00:53
157500 -- (-337.102) [-333.547] (-334.073) (-335.966) * (-333.106) (-332.867) (-334.132) [-336.052] -- 0:00:53
158000 -- (-335.812) (-336.284) (-334.192) [-333.263] * (-336.133) (-333.532) [-336.641] (-335.613) -- 0:00:53
158500 -- (-335.211) (-334.182) [-336.275] (-334.457) * (-336.719) [-336.826] (-335.340) (-335.124) -- 0:00:53
159000 -- (-334.483) [-335.749] (-334.321) (-333.705) * [-334.056] (-335.909) (-335.489) (-335.550) -- 0:00:52
159500 -- (-333.874) [-335.585] (-336.179) (-335.436) * (-332.531) (-332.218) (-335.017) [-332.951] -- 0:00:52
160000 -- (-332.733) [-332.747] (-338.845) (-332.641) * (-333.775) (-332.229) [-336.003] (-332.790) -- 0:00:52
Average standard deviation of split frequencies: 0.017767
160500 -- (-333.433) [-333.777] (-338.691) (-335.204) * (-335.992) (-333.720) [-338.518] (-335.375) -- 0:00:52
161000 -- (-336.669) [-333.328] (-334.089) (-332.157) * (-335.002) (-333.396) (-334.121) [-335.072] -- 0:00:52
161500 -- [-333.361] (-333.663) (-336.888) (-334.039) * (-334.873) (-336.643) [-335.437] (-334.037) -- 0:00:51
162000 -- (-335.239) (-333.643) (-335.474) [-333.778] * (-332.653) (-334.264) (-333.799) [-333.051] -- 0:00:51
162500 -- (-335.425) (-333.008) [-337.220] (-336.646) * (-333.406) (-335.717) [-335.356] (-334.400) -- 0:00:51
163000 -- [-332.928] (-333.889) (-336.756) (-334.463) * (-333.798) (-335.866) [-334.690] (-334.753) -- 0:00:51
163500 -- (-335.280) (-333.967) (-333.836) [-333.150] * (-333.874) (-334.110) [-333.784] (-334.159) -- 0:00:51
164000 -- (-334.113) [-335.795] (-335.420) (-334.048) * (-333.953) (-333.718) (-333.833) [-333.754] -- 0:00:50
164500 -- [-333.285] (-334.518) (-335.501) (-338.841) * (-336.450) (-335.698) (-339.497) [-334.881] -- 0:00:50
165000 -- (-334.515) [-334.244] (-338.536) (-335.232) * (-338.470) (-333.250) (-339.065) [-334.812] -- 0:00:50
Average standard deviation of split frequencies: 0.016723
165500 -- (-335.435) (-332.523) [-333.665] (-336.432) * [-335.161] (-335.253) (-333.082) (-335.205) -- 0:00:50
166000 -- (-335.525) [-334.278] (-332.429) (-334.728) * (-337.118) (-332.452) [-333.296] (-335.012) -- 0:00:50
166500 -- (-333.311) [-333.164] (-333.329) (-335.755) * (-335.255) (-334.917) (-334.059) [-334.115] -- 0:00:50
167000 -- [-334.392] (-333.916) (-332.956) (-333.942) * [-334.626] (-333.749) (-336.051) (-333.999) -- 0:00:49
167500 -- (-337.310) [-335.782] (-335.183) (-334.165) * (-333.992) (-335.913) [-337.939] (-336.155) -- 0:00:49
168000 -- (-335.171) (-337.813) (-335.945) [-332.089] * (-332.457) (-336.856) [-342.207] (-335.710) -- 0:00:49
168500 -- (-335.256) (-335.674) (-336.629) [-335.299] * (-336.101) [-336.265] (-332.039) (-332.947) -- 0:00:49
169000 -- (-334.483) [-334.894] (-334.143) (-335.004) * (-334.800) [-333.000] (-333.429) (-335.965) -- 0:00:49
169500 -- (-336.018) (-335.600) [-333.477] (-333.221) * [-334.474] (-334.880) (-333.988) (-332.493) -- 0:00:48
170000 -- (-334.239) [-333.350] (-333.540) (-336.031) * [-334.800] (-332.657) (-333.708) (-332.694) -- 0:00:48
Average standard deviation of split frequencies: 0.019010
170500 -- (-334.327) (-333.081) [-334.449] (-337.459) * (-335.366) [-334.548] (-334.439) (-337.624) -- 0:00:48
171000 -- (-335.297) (-335.323) (-335.005) [-333.390] * (-333.012) (-334.955) (-336.991) [-332.801] -- 0:00:48
171500 -- (-336.204) (-335.145) [-332.348] (-335.875) * (-336.548) [-332.203] (-337.489) (-336.065) -- 0:00:48
172000 -- [-334.025] (-334.643) (-333.712) (-339.865) * (-332.956) (-332.803) [-334.666] (-336.339) -- 0:00:48
172500 -- [-333.223] (-336.442) (-335.538) (-333.799) * (-332.929) (-333.151) (-336.426) [-332.347] -- 0:00:52
173000 -- (-336.482) [-335.332] (-336.340) (-333.372) * [-334.503] (-333.441) (-332.862) (-333.963) -- 0:00:52
173500 -- (-337.922) (-333.406) [-335.902] (-333.952) * (-337.739) (-334.437) (-334.522) [-333.290] -- 0:00:52
174000 -- [-333.639] (-337.931) (-334.074) (-336.713) * [-334.274] (-334.572) (-332.942) (-333.084) -- 0:00:52
174500 -- (-335.195) (-333.458) (-333.269) [-333.880] * (-334.415) (-336.254) [-333.393] (-333.777) -- 0:00:52
175000 -- (-339.258) (-337.541) [-334.704] (-338.678) * (-335.557) [-334.928] (-333.614) (-333.425) -- 0:00:51
Average standard deviation of split frequencies: 0.018749
175500 -- (-335.021) [-335.540] (-335.538) (-335.784) * [-334.619] (-333.117) (-333.499) (-334.764) -- 0:00:51
176000 -- (-334.407) (-332.927) (-334.346) [-334.794] * (-338.015) (-336.027) [-336.724] (-336.801) -- 0:00:51
176500 -- (-332.415) (-333.220) [-334.230] (-335.319) * (-335.392) (-335.431) (-333.516) [-332.872] -- 0:00:51
177000 -- (-332.570) [-333.037] (-332.709) (-336.669) * (-334.992) (-333.482) (-332.510) [-335.045] -- 0:00:51
177500 -- (-333.222) [-333.406] (-333.879) (-340.249) * (-336.209) (-333.556) [-332.054] (-332.272) -- 0:00:50
178000 -- (-334.023) [-333.350] (-335.271) (-341.138) * (-338.101) (-335.578) (-332.752) [-333.028] -- 0:00:50
178500 -- (-337.030) (-334.965) (-336.179) [-338.578] * (-332.718) (-333.660) (-336.760) [-334.020] -- 0:00:50
179000 -- (-339.778) [-332.620] (-334.469) (-333.937) * (-334.209) (-333.597) [-333.664] (-334.590) -- 0:00:50
179500 -- (-332.984) (-334.679) (-336.576) [-336.843] * [-332.929] (-332.424) (-334.876) (-333.349) -- 0:00:50
180000 -- (-333.282) (-348.230) [-332.864] (-338.545) * (-334.605) [-334.375] (-335.514) (-333.143) -- 0:00:50
Average standard deviation of split frequencies: 0.019569
180500 -- [-332.735] (-335.501) (-332.754) (-338.121) * (-334.659) (-336.842) [-333.019] (-335.107) -- 0:00:49
181000 -- (-333.908) (-335.363) (-333.260) [-332.917] * (-333.973) [-334.131] (-333.039) (-335.784) -- 0:00:49
181500 -- (-341.206) [-337.100] (-336.013) (-332.866) * (-336.204) (-336.282) (-333.460) [-336.370] -- 0:00:49
182000 -- (-337.570) [-334.837] (-336.365) (-332.774) * (-333.725) (-334.610) (-333.471) [-333.338] -- 0:00:49
182500 -- (-333.990) (-336.832) [-333.122] (-334.809) * (-335.933) (-336.236) [-333.676] (-334.049) -- 0:00:49
183000 -- [-333.063] (-335.403) (-334.456) (-332.506) * (-334.086) [-333.194] (-334.357) (-338.368) -- 0:00:49
183500 -- (-335.268) (-333.392) [-337.511] (-332.160) * (-332.830) (-335.162) (-333.319) [-336.674] -- 0:00:48
184000 -- (-336.087) (-333.381) (-333.175) [-334.160] * [-332.963] (-334.646) (-333.269) (-337.525) -- 0:00:48
184500 -- (-332.494) (-334.216) [-333.503] (-337.208) * (-336.161) [-333.668] (-333.962) (-333.199) -- 0:00:48
185000 -- (-336.699) (-332.653) [-336.894] (-337.136) * (-336.583) (-334.335) [-333.676] (-334.287) -- 0:00:48
Average standard deviation of split frequencies: 0.020557
185500 -- [-334.251] (-333.993) (-333.832) (-335.617) * [-333.953] (-333.542) (-335.448) (-334.127) -- 0:00:48
186000 -- [-333.171] (-337.993) (-333.455) (-340.546) * (-333.290) (-332.831) (-335.121) [-338.795] -- 0:00:48
186500 -- (-334.337) [-336.390] (-333.095) (-333.574) * (-334.542) (-333.694) (-337.004) [-332.573] -- 0:00:47
187000 -- (-333.701) [-335.767] (-335.078) (-338.671) * (-334.099) (-334.887) (-334.707) [-334.894] -- 0:00:47
187500 -- (-333.482) [-337.607] (-337.513) (-336.745) * [-334.001] (-335.706) (-333.380) (-334.138) -- 0:00:47
188000 -- (-334.018) [-332.716] (-334.221) (-337.638) * (-333.662) [-334.931] (-334.524) (-336.668) -- 0:00:47
188500 -- (-335.803) [-336.209] (-333.607) (-338.124) * [-334.601] (-338.109) (-335.230) (-337.287) -- 0:00:47
189000 -- (-334.574) (-335.248) (-333.723) [-334.012] * (-332.925) (-340.028) [-334.045] (-334.520) -- 0:00:47
189500 -- (-333.072) (-335.268) [-334.789] (-335.958) * [-333.187] (-335.355) (-334.168) (-332.157) -- 0:00:51
190000 -- (-334.582) [-334.879] (-338.331) (-335.664) * (-332.869) (-333.451) [-337.718] (-333.307) -- 0:00:51
Average standard deviation of split frequencies: 0.020070
190500 -- [-333.452] (-334.026) (-337.399) (-336.615) * [-336.213] (-334.644) (-334.318) (-334.611) -- 0:00:50
191000 -- [-333.343] (-335.987) (-332.948) (-334.599) * (-334.507) (-334.240) (-333.447) [-336.191] -- 0:00:50
191500 -- (-338.576) (-333.508) (-334.033) [-334.089] * (-336.037) (-335.173) [-333.266] (-333.160) -- 0:00:50
192000 -- (-339.588) [-334.908] (-336.379) (-333.958) * (-337.265) (-333.639) [-332.390] (-333.061) -- 0:00:50
192500 -- [-338.575] (-334.393) (-334.411) (-333.063) * (-332.685) (-336.687) [-332.612] (-336.357) -- 0:00:50
193000 -- (-337.223) (-334.851) (-334.505) [-335.507] * (-333.984) (-335.256) (-333.332) [-334.010] -- 0:00:50
193500 -- (-335.189) (-334.056) (-334.213) [-333.661] * [-333.429] (-334.753) (-336.408) (-332.129) -- 0:00:50
194000 -- (-333.797) [-333.830] (-335.005) (-332.362) * (-335.977) (-335.861) [-335.544] (-334.543) -- 0:00:49
194500 -- (-333.632) [-334.765] (-336.368) (-334.578) * (-333.285) (-335.640) (-333.796) [-338.043] -- 0:00:49
195000 -- [-332.672] (-336.069) (-334.468) (-335.199) * [-333.887] (-334.538) (-337.430) (-335.497) -- 0:00:49
Average standard deviation of split frequencies: 0.019091
195500 -- [-333.395] (-334.736) (-334.006) (-335.901) * (-332.934) (-335.533) (-333.695) [-335.898] -- 0:00:49
196000 -- (-333.787) (-337.121) [-332.294] (-333.527) * [-335.277] (-334.865) (-333.492) (-334.281) -- 0:00:49
196500 -- (-334.827) (-335.359) (-332.353) [-334.472] * (-334.832) (-334.194) (-334.486) [-335.941] -- 0:00:49
197000 -- (-335.929) [-335.893] (-332.623) (-337.053) * (-334.124) (-333.875) (-334.832) [-339.663] -- 0:00:48
197500 -- (-344.334) [-332.508] (-337.138) (-335.269) * (-333.322) (-335.573) (-335.975) [-334.510] -- 0:00:48
198000 -- (-335.777) (-336.786) [-336.738] (-336.188) * (-333.276) (-335.293) (-334.195) [-338.347] -- 0:00:48
198500 -- [-333.065] (-336.324) (-334.541) (-333.756) * (-332.893) (-335.818) (-334.250) [-335.606] -- 0:00:48
199000 -- (-335.817) (-335.932) [-333.876] (-334.594) * (-337.469) [-333.025] (-334.695) (-336.412) -- 0:00:48
199500 -- (-334.326) (-335.854) [-333.866] (-335.054) * (-335.480) [-333.317] (-337.935) (-336.139) -- 0:00:48
200000 -- (-334.114) (-335.537) (-336.637) [-337.570] * (-336.993) [-334.962] (-338.004) (-336.687) -- 0:00:48
Average standard deviation of split frequencies: 0.018517
200500 -- (-333.154) (-341.282) (-334.552) [-335.738] * (-333.580) (-334.991) (-334.274) [-334.005] -- 0:00:47
201000 -- (-334.534) (-340.842) [-334.215] (-333.989) * [-334.294] (-333.778) (-335.377) (-334.532) -- 0:00:47
201500 -- (-332.421) (-337.073) [-334.110] (-339.680) * [-334.077] (-333.654) (-333.237) (-336.172) -- 0:00:47
202000 -- (-336.587) (-336.381) (-335.785) [-334.383] * (-334.405) [-332.981] (-332.263) (-334.837) -- 0:00:47
202500 -- [-336.965] (-340.066) (-335.238) (-334.450) * [-334.220] (-333.910) (-335.945) (-336.651) -- 0:00:47
203000 -- [-333.937] (-335.499) (-339.076) (-333.432) * (-334.382) [-334.731] (-334.973) (-334.932) -- 0:00:47
203500 -- (-339.133) (-333.746) [-335.999] (-333.991) * [-333.167] (-336.721) (-339.570) (-333.856) -- 0:00:46
204000 -- (-337.163) (-332.351) [-333.190] (-338.541) * (-334.103) [-334.495] (-334.537) (-334.826) -- 0:00:46
204500 -- (-332.406) (-334.008) (-335.789) [-335.203] * (-336.782) (-333.705) (-335.640) [-332.971] -- 0:00:46
205000 -- (-336.114) (-333.138) [-333.792] (-333.626) * (-332.517) (-332.968) (-336.016) [-333.403] -- 0:00:46
Average standard deviation of split frequencies: 0.018053
205500 -- (-335.634) [-335.684] (-333.790) (-335.568) * [-332.714] (-335.874) (-333.343) (-334.533) -- 0:00:46
206000 -- [-333.864] (-336.392) (-336.566) (-332.170) * (-339.459) [-334.001] (-333.749) (-335.288) -- 0:00:46
206500 -- (-336.669) (-336.379) [-334.895] (-335.442) * (-333.508) (-334.343) (-333.229) [-334.143] -- 0:00:49
207000 -- (-335.536) (-333.848) [-333.239] (-334.667) * (-334.106) (-332.999) [-332.725] (-334.307) -- 0:00:49
207500 -- [-333.366] (-332.421) (-333.073) (-334.104) * (-337.119) (-335.008) [-333.402] (-334.115) -- 0:00:49
208000 -- [-333.172] (-332.723) (-333.877) (-335.293) * (-334.470) (-332.700) (-333.750) [-333.557] -- 0:00:49
208500 -- (-333.760) [-334.498] (-332.744) (-333.785) * (-336.136) (-333.431) (-333.729) [-333.285] -- 0:00:49
209000 -- [-337.808] (-334.945) (-333.647) (-334.875) * (-334.951) (-333.884) [-332.908] (-336.310) -- 0:00:49
209500 -- [-335.555] (-334.047) (-332.772) (-333.528) * (-338.716) (-335.860) [-332.644] (-337.157) -- 0:00:49
210000 -- (-332.653) [-333.834] (-341.860) (-333.195) * (-338.055) (-334.370) (-332.860) [-333.559] -- 0:00:48
Average standard deviation of split frequencies: 0.017528
210500 -- (-334.195) [-337.173] (-334.420) (-333.365) * (-334.191) (-335.312) (-335.999) [-334.020] -- 0:00:48
211000 -- (-333.804) (-333.324) [-334.854] (-334.786) * (-336.676) [-333.121] (-333.601) (-334.686) -- 0:00:48
211500 -- (-334.645) (-335.283) (-333.292) [-333.904] * (-334.661) [-332.803] (-332.962) (-340.977) -- 0:00:48
212000 -- (-334.284) (-334.353) (-338.720) [-332.633] * (-333.633) [-333.819] (-332.580) (-335.559) -- 0:00:48
212500 -- (-333.958) (-345.038) (-335.558) [-333.106] * (-332.655) [-336.933] (-334.134) (-334.102) -- 0:00:48
213000 -- (-335.503) (-337.148) (-333.951) [-335.382] * [-335.956] (-332.991) (-334.740) (-336.849) -- 0:00:48
213500 -- (-333.422) (-335.785) [-333.772] (-337.497) * (-332.991) (-333.989) (-335.845) [-336.648] -- 0:00:47
214000 -- [-337.797] (-332.945) (-333.108) (-333.698) * (-333.232) (-333.231) (-340.264) [-337.281] -- 0:00:47
214500 -- (-333.824) [-333.694] (-332.794) (-333.636) * (-334.610) (-333.101) [-338.349] (-337.163) -- 0:00:47
215000 -- (-335.440) (-334.358) (-332.719) [-333.575] * (-336.048) [-332.499] (-335.742) (-333.029) -- 0:00:47
Average standard deviation of split frequencies: 0.018551
215500 -- [-335.258] (-333.489) (-337.238) (-336.765) * (-334.706) (-332.598) (-338.717) [-335.765] -- 0:00:47
216000 -- (-333.886) (-332.858) [-335.323] (-333.391) * (-333.613) (-334.278) [-334.047] (-334.930) -- 0:00:47
216500 -- (-333.611) (-334.545) [-334.850] (-334.488) * [-332.696] (-334.092) (-333.746) (-334.421) -- 0:00:47
217000 -- (-333.327) (-339.532) [-335.466] (-334.432) * (-333.135) (-332.951) [-338.145] (-333.601) -- 0:00:46
217500 -- (-333.205) (-337.299) (-335.162) [-334.919] * [-334.463] (-332.604) (-335.661) (-335.119) -- 0:00:46
218000 -- (-332.940) [-334.269] (-340.621) (-335.287) * (-333.071) (-333.917) [-334.054] (-335.206) -- 0:00:46
218500 -- (-333.482) (-335.214) (-332.989) [-335.692] * (-335.706) (-333.831) (-334.271) [-334.955] -- 0:00:46
219000 -- [-334.826] (-333.320) (-335.342) (-333.049) * (-336.663) (-334.558) (-336.173) [-334.203] -- 0:00:46
219500 -- (-336.881) [-332.092] (-334.505) (-334.689) * (-335.021) (-334.511) [-332.491] (-333.435) -- 0:00:46
220000 -- [-335.600] (-334.541) (-336.165) (-332.984) * (-335.412) (-335.870) (-334.053) [-334.019] -- 0:00:46
Average standard deviation of split frequencies: 0.017921
220500 -- (-335.168) [-334.253] (-334.784) (-339.487) * (-334.782) [-334.208] (-332.802) (-334.934) -- 0:00:45
221000 -- (-335.009) (-334.417) (-334.410) [-334.188] * (-334.990) (-333.768) [-336.752] (-332.723) -- 0:00:45
221500 -- [-332.819] (-334.909) (-335.875) (-333.063) * (-334.780) (-332.429) (-335.898) [-333.262] -- 0:00:45
222000 -- (-333.882) [-335.460] (-337.771) (-334.112) * (-338.916) [-333.883] (-334.604) (-333.041) -- 0:00:45
222500 -- (-333.616) (-336.017) (-338.626) [-332.878] * [-336.672] (-335.198) (-336.734) (-337.144) -- 0:00:45
223000 -- [-334.849] (-333.651) (-340.655) (-337.755) * [-334.321] (-333.608) (-333.799) (-332.277) -- 0:00:45
223500 -- (-335.123) (-332.423) [-336.572] (-333.934) * (-333.502) (-332.878) (-333.345) [-332.566] -- 0:00:48
224000 -- (-339.844) (-332.854) (-335.649) [-334.169] * (-333.582) (-336.879) (-333.848) [-333.155] -- 0:00:48
224500 -- (-337.262) [-333.096] (-334.298) (-338.091) * (-333.781) (-335.695) [-333.685] (-338.512) -- 0:00:48
225000 -- (-332.986) [-333.469] (-332.768) (-335.467) * (-338.840) (-335.995) [-332.498] (-335.518) -- 0:00:48
Average standard deviation of split frequencies: 0.018077
225500 -- (-336.289) (-334.393) [-334.524] (-338.697) * (-334.370) [-335.255] (-333.826) (-334.600) -- 0:00:48
226000 -- (-339.618) (-332.927) [-333.513] (-333.873) * (-334.082) (-332.679) (-334.757) [-332.689] -- 0:00:47
226500 -- (-337.421) (-333.298) (-340.701) [-332.653] * (-342.110) [-334.356] (-336.370) (-333.276) -- 0:00:47
227000 -- (-334.916) (-333.344) (-335.262) [-333.489] * (-334.498) [-334.560] (-334.023) (-338.690) -- 0:00:47
227500 -- (-333.682) (-333.913) [-332.934] (-334.105) * (-340.014) (-336.221) (-333.222) [-334.680] -- 0:00:47
228000 -- (-335.080) [-333.612] (-333.484) (-333.802) * [-334.310] (-334.840) (-333.749) (-332.715) -- 0:00:47
228500 -- (-334.483) [-333.293] (-336.437) (-337.794) * (-334.512) [-332.643] (-333.385) (-332.899) -- 0:00:47
229000 -- (-332.773) (-335.162) (-336.604) [-334.214] * (-334.419) [-333.251] (-335.714) (-333.004) -- 0:00:47
229500 -- (-342.650) (-338.903) [-333.377] (-334.198) * [-337.195] (-334.188) (-335.636) (-334.162) -- 0:00:47
230000 -- (-333.506) (-337.383) [-333.934] (-332.554) * (-336.770) [-333.944] (-333.130) (-332.114) -- 0:00:46
Average standard deviation of split frequencies: 0.017825
230500 -- (-332.380) (-335.280) (-334.142) [-334.697] * [-335.452] (-336.236) (-333.379) (-333.661) -- 0:00:46
231000 -- [-332.383] (-332.842) (-335.822) (-337.476) * [-332.330] (-334.644) (-337.254) (-338.630) -- 0:00:46
231500 -- (-333.453) (-332.782) [-332.066] (-334.643) * (-332.460) (-336.173) (-335.008) [-333.709] -- 0:00:46
232000 -- (-334.123) [-334.383] (-333.567) (-333.956) * (-339.972) (-333.865) [-336.454] (-334.579) -- 0:00:46
232500 -- (-336.888) (-335.907) [-335.684] (-332.624) * (-338.949) (-336.708) [-335.048] (-334.150) -- 0:00:46
233000 -- (-336.357) (-335.701) (-333.705) [-334.073] * (-336.309) (-333.044) [-337.002] (-336.615) -- 0:00:46
233500 -- (-337.342) (-336.150) [-332.295] (-333.160) * (-333.129) (-333.389) (-337.584) [-334.846] -- 0:00:45
234000 -- (-337.832) (-333.736) (-333.876) [-336.107] * (-332.364) (-332.943) [-332.952] (-337.835) -- 0:00:45
234500 -- (-339.097) (-333.968) [-336.572] (-335.994) * (-334.310) [-334.966] (-334.603) (-335.759) -- 0:00:45
235000 -- (-334.776) (-335.789) (-336.846) [-333.442] * [-334.479] (-334.834) (-333.411) (-334.914) -- 0:00:45
Average standard deviation of split frequencies: 0.019864
235500 -- (-333.849) (-336.832) (-333.747) [-334.578] * [-333.848] (-338.013) (-333.216) (-333.309) -- 0:00:45
236000 -- [-334.894] (-339.536) (-333.785) (-335.112) * (-333.352) (-336.158) [-334.179] (-334.521) -- 0:00:45
236500 -- (-336.578) (-336.091) (-336.126) [-335.297] * (-333.428) (-335.036) [-332.081] (-335.402) -- 0:00:45
237000 -- [-335.452] (-335.368) (-336.214) (-334.423) * (-334.233) [-335.941] (-335.445) (-335.741) -- 0:00:45
237500 -- (-335.843) [-334.528] (-337.427) (-333.088) * (-336.255) (-334.290) (-333.501) [-335.290] -- 0:00:44
238000 -- [-335.487] (-336.155) (-338.575) (-334.573) * (-336.315) (-334.093) (-336.470) [-332.914] -- 0:00:44
238500 -- (-337.083) [-336.289] (-332.472) (-335.178) * [-336.248] (-338.632) (-334.362) (-338.414) -- 0:00:44
239000 -- (-336.297) (-335.212) [-333.806] (-333.700) * [-334.951] (-335.043) (-334.991) (-334.421) -- 0:00:44
239500 -- (-333.731) (-334.988) (-332.544) [-333.575] * (-335.667) [-333.589] (-335.400) (-334.904) -- 0:00:44
240000 -- (-333.170) (-338.466) [-335.486] (-334.482) * [-334.257] (-334.497) (-335.069) (-333.395) -- 0:00:44
Average standard deviation of split frequencies: 0.018550
240500 -- (-337.913) (-334.598) [-334.453] (-333.822) * [-333.331] (-332.793) (-332.471) (-334.070) -- 0:00:44
241000 -- (-332.554) (-333.781) [-336.032] (-335.656) * (-332.136) [-332.956] (-335.334) (-339.069) -- 0:00:47
241500 -- [-336.724] (-332.399) (-337.237) (-336.340) * [-332.929] (-333.391) (-338.285) (-334.685) -- 0:00:47
242000 -- [-333.467] (-332.963) (-335.518) (-332.975) * (-336.287) (-334.878) (-333.837) [-332.075] -- 0:00:46
242500 -- (-334.642) (-336.759) [-333.892] (-335.946) * (-340.185) (-335.781) [-333.571] (-333.393) -- 0:00:46
243000 -- [-338.346] (-332.740) (-332.829) (-335.431) * (-334.535) (-336.098) (-332.150) [-333.464] -- 0:00:46
243500 -- [-336.617] (-334.355) (-335.595) (-336.193) * [-335.281] (-337.292) (-332.326) (-332.658) -- 0:00:46
244000 -- [-337.656] (-332.708) (-333.429) (-334.249) * [-335.410] (-333.949) (-333.424) (-335.642) -- 0:00:46
244500 -- (-335.663) (-334.117) (-335.256) [-334.262] * (-333.344) [-334.707] (-333.497) (-337.176) -- 0:00:46
245000 -- (-334.989) [-333.848] (-335.063) (-332.790) * [-332.833] (-340.325) (-333.831) (-338.220) -- 0:00:46
Average standard deviation of split frequencies: 0.018457
245500 -- [-334.972] (-335.284) (-333.747) (-334.159) * (-332.537) [-333.526] (-333.353) (-334.716) -- 0:00:46
246000 -- (-334.974) [-335.021] (-339.001) (-336.126) * [-333.924] (-333.865) (-335.702) (-333.942) -- 0:00:45
246500 -- [-334.654] (-337.706) (-335.373) (-338.279) * (-334.868) (-335.889) (-340.385) [-336.104] -- 0:00:45
247000 -- (-336.819) (-336.545) [-333.347] (-336.758) * (-333.943) (-333.548) [-335.426] (-334.342) -- 0:00:45
247500 -- (-333.938) (-332.855) (-337.790) [-333.103] * (-334.668) (-334.065) (-333.063) [-333.930] -- 0:00:45
248000 -- (-333.974) (-334.698) (-343.127) [-333.866] * [-336.294] (-333.998) (-334.208) (-335.270) -- 0:00:45
248500 -- (-332.545) [-333.886] (-337.343) (-333.911) * (-337.610) (-333.852) (-336.156) [-336.513] -- 0:00:45
249000 -- (-333.560) (-334.755) [-334.439] (-336.535) * [-334.713] (-337.161) (-333.113) (-333.355) -- 0:00:45
249500 -- (-333.401) (-333.624) [-332.834] (-333.696) * (-335.650) (-338.038) [-333.514] (-332.980) -- 0:00:45
250000 -- (-332.416) (-334.267) (-333.422) [-333.976] * (-332.500) (-333.426) [-332.939] (-333.760) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-332.453) (-339.617) [-335.486] (-340.747) * (-332.261) [-333.557] (-334.041) (-337.260) -- 0:00:44
251000 -- (-337.453) [-333.446] (-334.855) (-337.415) * (-334.361) (-332.706) (-336.996) [-333.082] -- 0:00:44
251500 -- (-336.876) (-337.182) (-335.839) [-334.601] * [-333.659] (-339.490) (-334.327) (-334.856) -- 0:00:44
252000 -- [-336.537] (-336.894) (-333.058) (-334.224) * [-332.602] (-338.299) (-333.553) (-335.514) -- 0:00:44
252500 -- (-336.824) (-332.204) (-333.489) [-334.551] * (-337.245) (-333.652) [-333.187] (-336.152) -- 0:00:44
253000 -- (-332.347) [-333.606] (-335.099) (-334.153) * (-334.159) (-336.270) [-333.542] (-335.674) -- 0:00:44
253500 -- (-333.997) (-333.360) [-336.035] (-339.962) * [-333.516] (-333.537) (-337.536) (-336.197) -- 0:00:44
254000 -- (-334.649) [-338.080] (-333.966) (-337.921) * [-333.586] (-334.594) (-336.669) (-336.650) -- 0:00:44
254500 -- [-334.123] (-338.257) (-333.763) (-335.376) * (-334.101) [-334.401] (-334.922) (-336.008) -- 0:00:43
255000 -- [-333.311] (-336.563) (-333.589) (-337.527) * (-336.329) (-333.133) [-333.216] (-335.431) -- 0:00:43
Average standard deviation of split frequencies: 0.018721
255500 -- (-333.561) (-335.081) (-335.023) [-332.945] * (-333.296) (-333.129) [-333.210] (-334.237) -- 0:00:43
256000 -- [-332.419] (-333.385) (-333.403) (-333.015) * [-334.305] (-335.113) (-340.614) (-333.757) -- 0:00:43
256500 -- (-334.094) [-336.061] (-333.072) (-333.778) * (-333.817) (-333.178) (-334.086) [-333.990] -- 0:00:43
257000 -- (-333.836) (-334.413) (-333.712) [-333.701] * (-333.618) [-333.324] (-334.657) (-337.673) -- 0:00:43
257500 -- (-334.097) (-336.356) (-332.334) [-332.461] * [-335.067] (-332.834) (-333.027) (-334.762) -- 0:00:43
258000 -- (-333.207) [-335.293] (-334.397) (-333.398) * (-335.908) [-335.316] (-332.104) (-333.084) -- 0:00:46
258500 -- (-334.551) [-333.030] (-333.504) (-333.466) * (-336.827) [-337.937] (-335.393) (-335.181) -- 0:00:45
259000 -- [-332.517] (-338.114) (-335.490) (-332.389) * (-333.939) [-333.330] (-335.127) (-334.490) -- 0:00:45
259500 -- (-332.306) [-338.666] (-335.550) (-334.313) * (-345.845) (-334.131) (-333.156) [-335.087] -- 0:00:45
260000 -- (-337.627) (-337.384) [-336.022] (-334.494) * (-340.000) [-334.704] (-334.530) (-333.643) -- 0:00:45
Average standard deviation of split frequencies: 0.019417
260500 -- (-336.140) (-336.387) (-335.600) [-333.775] * [-335.143] (-332.977) (-333.738) (-334.503) -- 0:00:45
261000 -- (-334.267) (-335.016) (-334.300) [-336.379] * (-333.277) (-332.434) [-334.083] (-334.153) -- 0:00:45
261500 -- [-333.375] (-332.930) (-334.590) (-336.829) * (-333.577) (-332.268) (-334.105) [-336.409] -- 0:00:45
262000 -- [-332.363] (-335.657) (-334.957) (-336.538) * [-332.437] (-334.156) (-336.076) (-335.798) -- 0:00:45
262500 -- (-334.263) (-332.680) (-335.815) [-333.249] * (-332.366) (-338.395) [-333.058] (-334.841) -- 0:00:44
263000 -- (-334.153) (-333.282) (-334.529) [-332.941] * (-334.240) (-333.594) [-333.266] (-335.089) -- 0:00:44
263500 -- (-332.178) (-332.840) (-335.012) [-332.619] * (-337.962) [-334.764] (-334.774) (-334.573) -- 0:00:44
264000 -- (-332.687) (-335.395) [-334.291] (-336.555) * [-333.421] (-335.250) (-332.557) (-336.868) -- 0:00:44
264500 -- [-332.976] (-335.529) (-333.686) (-336.336) * [-333.728] (-333.076) (-337.242) (-335.581) -- 0:00:44
265000 -- (-333.804) (-335.332) [-332.861] (-334.455) * [-332.901] (-333.330) (-334.768) (-333.402) -- 0:00:44
Average standard deviation of split frequencies: 0.019681
265500 -- (-333.998) (-335.021) (-340.930) [-335.941] * (-332.760) (-334.313) (-334.887) [-334.518] -- 0:00:44
266000 -- [-334.842] (-336.706) (-333.324) (-333.474) * (-333.752) (-334.519) (-333.337) [-334.578] -- 0:00:44
266500 -- (-335.234) (-335.377) (-337.331) [-332.631] * [-337.399] (-335.423) (-334.680) (-335.292) -- 0:00:44
267000 -- [-333.413] (-334.225) (-334.375) (-334.440) * [-333.031] (-333.658) (-335.268) (-334.020) -- 0:00:43
267500 -- (-333.996) (-333.323) [-332.452] (-333.298) * [-332.202] (-334.137) (-336.055) (-335.284) -- 0:00:43
268000 -- (-334.055) [-333.047] (-332.417) (-333.434) * (-334.250) (-333.716) (-336.265) [-339.634] -- 0:00:43
268500 -- (-333.561) (-334.080) [-334.373] (-336.480) * [-334.471] (-332.926) (-335.237) (-334.496) -- 0:00:43
269000 -- (-333.347) (-333.987) (-336.201) [-338.680] * [-333.424] (-333.075) (-335.138) (-339.219) -- 0:00:43
269500 -- (-335.044) (-333.528) (-333.367) [-334.163] * (-335.756) (-333.805) (-334.469) [-334.900] -- 0:00:43
270000 -- (-340.630) (-334.419) (-334.328) [-334.975] * (-334.405) (-334.117) (-333.964) [-334.400] -- 0:00:43
Average standard deviation of split frequencies: 0.018026
270500 -- [-335.711] (-332.666) (-333.633) (-335.912) * (-336.001) [-337.302] (-336.134) (-332.713) -- 0:00:43
271000 -- (-333.648) (-333.777) (-334.497) [-336.596] * (-334.757) [-334.296] (-337.754) (-334.783) -- 0:00:43
271500 -- (-332.755) [-333.713] (-332.269) (-335.307) * (-335.205) (-339.214) (-335.114) [-333.643] -- 0:00:42
272000 -- (-332.497) (-333.151) [-332.836] (-338.854) * (-334.283) (-334.633) (-335.585) [-333.637] -- 0:00:42
272500 -- [-333.259] (-334.223) (-332.781) (-338.169) * [-334.581] (-333.362) (-334.038) (-334.255) -- 0:00:42
273000 -- [-333.398] (-334.954) (-332.572) (-336.230) * (-334.179) (-336.110) (-333.542) [-333.523] -- 0:00:42
273500 -- (-334.148) [-334.508] (-336.415) (-333.738) * (-333.219) (-334.888) (-334.411) [-334.106] -- 0:00:42
274000 -- [-334.210] (-332.579) (-334.510) (-334.375) * (-334.110) (-335.798) (-334.377) [-333.172] -- 0:00:42
274500 -- (-334.562) (-333.256) (-335.379) [-335.055] * (-336.272) (-333.533) (-334.389) [-336.702] -- 0:00:42
275000 -- (-335.023) [-332.956] (-336.157) (-336.163) * (-338.712) (-334.411) [-333.675] (-339.944) -- 0:00:42
Average standard deviation of split frequencies: 0.018503
275500 -- [-333.347] (-333.827) (-332.523) (-334.116) * (-333.820) (-333.252) [-332.915] (-333.582) -- 0:00:44
276000 -- (-333.871) (-333.761) [-333.358] (-332.322) * (-334.760) (-334.669) [-332.379] (-334.425) -- 0:00:44
276500 -- (-333.996) [-334.425] (-342.163) (-333.448) * (-332.169) [-334.809] (-333.531) (-334.862) -- 0:00:44
277000 -- [-334.472] (-333.860) (-338.247) (-332.291) * (-333.557) [-334.636] (-333.840) (-332.587) -- 0:00:44
277500 -- (-335.286) [-335.451] (-333.561) (-332.921) * (-333.841) (-340.501) (-335.047) [-333.201] -- 0:00:44
278000 -- (-333.124) (-335.805) (-334.095) [-333.281] * (-337.299) [-334.739] (-334.730) (-332.916) -- 0:00:44
278500 -- (-336.336) (-334.340) (-340.443) [-332.975] * (-336.235) (-334.961) [-338.908] (-333.815) -- 0:00:44
279000 -- (-334.872) (-334.147) [-335.877] (-335.969) * (-333.790) (-338.768) (-332.772) [-333.233] -- 0:00:43
279500 -- [-334.541] (-333.156) (-334.820) (-335.109) * (-335.363) (-335.595) [-335.257] (-335.715) -- 0:00:43
280000 -- [-339.232] (-338.234) (-336.104) (-335.135) * (-338.796) (-337.152) [-336.120] (-337.068) -- 0:00:43
Average standard deviation of split frequencies: 0.016401
280500 -- [-334.795] (-335.390) (-333.818) (-335.514) * (-335.847) (-334.669) (-333.636) [-336.131] -- 0:00:43
281000 -- [-333.681] (-333.818) (-334.309) (-333.843) * (-336.350) (-334.031) (-334.530) [-333.227] -- 0:00:43
281500 -- (-333.576) [-335.339] (-335.364) (-333.155) * [-337.560] (-335.402) (-337.457) (-336.313) -- 0:00:43
282000 -- (-334.889) (-339.259) [-334.164] (-334.282) * (-336.439) (-336.730) (-337.667) [-335.680] -- 0:00:43
282500 -- (-334.035) [-337.617] (-336.746) (-334.915) * [-334.913] (-338.050) (-335.385) (-334.767) -- 0:00:43
283000 -- (-335.874) (-334.254) [-332.954] (-334.959) * [-334.824] (-333.897) (-337.077) (-335.892) -- 0:00:43
283500 -- (-337.859) [-333.801] (-332.955) (-333.233) * (-332.411) (-334.272) [-334.718] (-334.079) -- 0:00:42
284000 -- [-334.843] (-334.509) (-332.945) (-333.188) * (-334.536) (-335.033) (-335.560) [-332.929] -- 0:00:42
284500 -- (-332.930) (-334.295) [-332.462] (-335.719) * [-333.920] (-336.196) (-332.848) (-333.473) -- 0:00:42
285000 -- [-336.782] (-333.707) (-332.934) (-333.832) * (-334.131) (-333.132) (-334.961) [-334.946] -- 0:00:42
Average standard deviation of split frequencies: 0.017032
285500 -- (-337.864) (-332.574) [-334.082] (-336.215) * (-336.273) (-336.233) [-334.882] (-334.786) -- 0:00:42
286000 -- [-336.847] (-333.273) (-333.011) (-338.969) * (-334.209) (-334.884) (-333.661) [-336.291] -- 0:00:42
286500 -- [-333.545] (-333.019) (-337.314) (-338.554) * (-335.189) (-339.193) [-333.572] (-333.551) -- 0:00:42
287000 -- (-335.744) (-334.911) (-335.834) [-337.548] * (-335.059) (-334.800) (-333.311) [-333.285] -- 0:00:42
287500 -- (-332.589) (-338.247) (-334.788) [-333.730] * (-334.161) [-334.560] (-334.466) (-336.026) -- 0:00:42
288000 -- (-333.929) (-336.647) [-334.932] (-335.938) * [-334.222] (-333.977) (-337.179) (-333.966) -- 0:00:42
288500 -- (-336.387) (-337.194) (-336.572) [-334.836] * (-335.764) (-336.485) [-334.118] (-337.695) -- 0:00:41
289000 -- [-333.160] (-335.129) (-333.714) (-335.340) * (-336.972) (-334.286) [-333.984] (-335.128) -- 0:00:41
289500 -- (-332.496) (-338.445) [-334.618] (-335.721) * (-336.600) (-335.106) [-333.389] (-335.988) -- 0:00:41
290000 -- (-336.136) (-333.294) [-334.743] (-335.118) * [-334.008] (-334.976) (-333.923) (-334.675) -- 0:00:41
Average standard deviation of split frequencies: 0.017930
290500 -- (-333.956) (-336.287) (-334.154) [-335.452] * (-337.311) [-334.312] (-332.348) (-334.544) -- 0:00:41
291000 -- (-334.986) (-335.015) (-336.381) [-332.768] * (-336.208) (-339.933) [-335.168] (-335.813) -- 0:00:41
291500 -- [-335.161] (-335.613) (-335.141) (-334.624) * (-333.483) [-332.298] (-336.663) (-339.437) -- 0:00:41
292000 -- [-333.312] (-334.705) (-336.960) (-333.263) * [-333.412] (-333.338) (-333.758) (-338.333) -- 0:00:41
292500 -- [-333.327] (-333.085) (-337.331) (-333.691) * (-333.377) (-333.267) [-334.184] (-335.716) -- 0:00:43
293000 -- (-336.497) (-333.753) [-334.335] (-335.505) * (-332.728) (-333.323) (-335.841) [-333.219] -- 0:00:43
293500 -- (-334.489) (-332.935) (-337.231) [-335.121] * [-336.206] (-333.508) (-334.747) (-336.262) -- 0:00:43
294000 -- [-335.951] (-332.929) (-332.366) (-332.808) * (-332.158) (-334.481) (-336.010) [-333.887] -- 0:00:43
294500 -- [-335.886] (-336.895) (-334.688) (-334.803) * (-334.614) (-334.848) [-333.328] (-332.941) -- 0:00:43
295000 -- (-335.682) (-335.602) [-333.527] (-333.225) * (-334.916) (-334.100) (-332.491) [-332.814] -- 0:00:43
Average standard deviation of split frequencies: 0.016811
295500 -- (-333.199) (-333.153) (-333.753) [-334.171] * [-334.509] (-332.551) (-333.873) (-338.494) -- 0:00:42
296000 -- (-333.795) (-334.405) (-332.913) [-333.981] * (-332.987) (-334.355) [-333.347] (-335.616) -- 0:00:42
296500 -- (-337.440) (-335.111) [-333.027] (-334.164) * [-332.832] (-334.606) (-332.965) (-332.724) -- 0:00:42
297000 -- (-334.927) (-333.390) (-335.126) [-332.487] * (-335.534) (-337.617) [-334.710] (-334.762) -- 0:00:42
297500 -- (-334.093) [-334.120] (-335.935) (-333.935) * [-332.518] (-333.809) (-333.454) (-333.692) -- 0:00:42
298000 -- (-341.296) [-334.319] (-334.108) (-334.953) * (-334.344) [-334.520] (-332.611) (-332.771) -- 0:00:42
298500 -- (-337.643) [-333.662] (-335.161) (-333.053) * [-333.797] (-337.066) (-333.175) (-333.982) -- 0:00:42
299000 -- (-333.949) (-334.828) [-335.949] (-336.197) * [-337.344] (-337.689) (-334.623) (-337.680) -- 0:00:42
299500 -- (-337.537) (-332.670) (-334.890) [-332.436] * [-339.941] (-333.861) (-335.943) (-334.098) -- 0:00:42
300000 -- (-332.295) (-334.797) [-334.747] (-336.407) * (-334.789) [-333.666] (-335.348) (-334.584) -- 0:00:42
Average standard deviation of split frequencies: 0.016916
300500 -- (-334.129) (-335.952) [-335.365] (-332.488) * (-333.594) (-337.011) (-334.126) [-333.215] -- 0:00:41
301000 -- (-334.251) (-333.201) (-337.518) [-333.070] * [-335.709] (-337.269) (-334.820) (-339.075) -- 0:00:41
301500 -- [-332.871] (-333.350) (-334.070) (-334.833) * (-335.586) (-333.613) [-334.278] (-335.183) -- 0:00:41
302000 -- (-332.307) (-333.316) [-334.478] (-333.305) * (-333.944) [-332.345] (-333.678) (-336.280) -- 0:00:41
302500 -- (-334.528) (-334.385) (-332.751) [-336.165] * (-335.604) (-332.783) [-336.848] (-333.226) -- 0:00:41
303000 -- [-332.496] (-333.090) (-333.872) (-332.877) * (-333.090) (-334.064) [-335.734] (-334.057) -- 0:00:41
303500 -- (-337.672) [-333.674] (-335.703) (-335.952) * [-336.945] (-335.369) (-336.040) (-334.056) -- 0:00:41
304000 -- [-332.566] (-333.338) (-334.272) (-334.872) * (-338.805) (-334.296) [-333.617] (-334.985) -- 0:00:41
304500 -- (-332.427) [-333.692] (-333.622) (-334.982) * [-335.020] (-336.042) (-335.172) (-332.653) -- 0:00:41
305000 -- (-334.825) [-335.118] (-332.587) (-335.768) * (-334.399) (-337.991) [-333.049] (-333.877) -- 0:00:41
Average standard deviation of split frequencies: 0.016297
305500 -- (-333.084) [-332.823] (-333.129) (-338.356) * (-334.130) (-335.821) (-337.964) [-333.588] -- 0:00:40
306000 -- (-333.131) (-333.353) (-333.128) [-334.800] * (-333.366) (-338.605) (-333.824) [-333.172] -- 0:00:40
306500 -- (-335.426) (-333.629) (-333.050) [-336.052] * [-333.770] (-335.990) (-333.823) (-334.459) -- 0:00:40
307000 -- (-332.831) [-334.229] (-334.288) (-333.493) * [-334.000] (-334.658) (-334.834) (-334.979) -- 0:00:40
307500 -- (-333.264) [-334.475] (-335.187) (-333.657) * (-335.079) (-337.054) (-335.652) [-333.460] -- 0:00:40
308000 -- [-334.936] (-336.970) (-335.512) (-337.804) * [-335.735] (-334.943) (-333.295) (-333.956) -- 0:00:40
308500 -- (-337.486) [-333.598] (-337.136) (-338.585) * (-335.969) (-335.688) [-333.307] (-335.355) -- 0:00:40
309000 -- (-335.438) (-335.196) (-333.016) [-333.656] * (-333.006) (-339.690) [-332.682] (-333.602) -- 0:00:40
309500 -- [-337.377] (-334.001) (-335.933) (-333.901) * (-334.172) [-334.896] (-334.375) (-334.336) -- 0:00:42
310000 -- [-333.212] (-334.515) (-336.344) (-333.639) * (-332.924) (-333.422) [-332.600] (-339.037) -- 0:00:42
Average standard deviation of split frequencies: 0.017197
310500 -- (-332.674) (-333.057) (-338.217) [-335.235] * [-335.445] (-332.510) (-334.896) (-333.954) -- 0:00:42
311000 -- [-335.373] (-333.692) (-334.332) (-334.954) * [-332.701] (-333.084) (-333.752) (-332.800) -- 0:00:42
311500 -- [-338.065] (-335.925) (-332.855) (-333.821) * (-334.368) (-333.232) (-334.795) [-333.115] -- 0:00:41
312000 -- [-333.421] (-333.966) (-334.538) (-335.163) * (-333.883) [-332.669] (-333.332) (-333.500) -- 0:00:41
312500 -- (-336.009) (-333.431) [-335.132] (-335.740) * [-335.883] (-332.739) (-332.787) (-335.876) -- 0:00:41
313000 -- (-336.487) (-336.425) [-336.041] (-335.306) * (-332.670) [-334.284] (-337.741) (-337.181) -- 0:00:41
313500 -- (-332.951) (-334.605) (-332.299) [-335.609] * (-333.397) (-333.705) (-334.072) [-338.859] -- 0:00:41
314000 -- (-334.412) [-336.879] (-333.488) (-333.079) * (-335.684) (-333.680) (-333.330) [-339.354] -- 0:00:41
314500 -- (-335.758) (-337.441) (-332.574) [-333.005] * (-332.832) (-332.711) (-333.033) [-333.596] -- 0:00:41
315000 -- (-333.988) [-334.173] (-336.478) (-334.778) * (-337.080) (-333.997) (-335.778) [-332.433] -- 0:00:41
Average standard deviation of split frequencies: 0.016658
315500 -- (-334.633) (-338.594) [-332.819] (-337.017) * (-338.836) (-336.195) (-332.659) [-333.525] -- 0:00:41
316000 -- (-334.448) [-332.800] (-334.963) (-332.471) * [-337.418] (-337.130) (-334.035) (-333.314) -- 0:00:41
316500 -- (-334.603) [-332.899] (-336.109) (-332.566) * (-334.893) (-333.525) (-334.777) [-332.731] -- 0:00:41
317000 -- (-333.391) (-335.362) [-334.207] (-333.763) * (-339.480) (-334.894) [-333.976] (-334.045) -- 0:00:40
317500 -- (-334.067) [-335.506] (-334.099) (-334.264) * (-338.387) [-336.027] (-334.654) (-332.050) -- 0:00:40
318000 -- (-334.993) [-340.037] (-332.938) (-336.501) * [-335.380] (-335.303) (-335.411) (-332.965) -- 0:00:40
318500 -- (-336.543) (-335.666) [-337.125] (-333.832) * [-333.228] (-332.639) (-339.284) (-336.700) -- 0:00:40
319000 -- [-337.261] (-333.706) (-335.418) (-333.669) * [-334.053] (-333.315) (-333.767) (-333.217) -- 0:00:40
319500 -- (-337.342) [-335.852] (-336.706) (-333.718) * [-333.626] (-332.563) (-334.122) (-334.006) -- 0:00:40
320000 -- (-336.652) (-335.884) [-335.169] (-332.517) * [-337.304] (-335.408) (-336.710) (-333.849) -- 0:00:40
Average standard deviation of split frequencies: 0.017069
320500 -- (-336.519) (-334.657) [-339.026] (-333.034) * (-338.202) (-333.387) [-335.695] (-333.730) -- 0:00:40
321000 -- (-334.497) (-334.476) (-333.203) [-335.488] * (-337.312) [-333.913] (-334.974) (-332.956) -- 0:00:40
321500 -- (-333.513) (-334.076) (-332.742) [-333.225] * (-334.924) (-334.725) (-334.024) [-333.386] -- 0:00:40
322000 -- (-333.756) (-334.152) [-333.878] (-334.725) * (-336.778) (-337.031) [-338.668] (-334.182) -- 0:00:40
322500 -- (-336.118) (-337.267) [-336.798] (-340.017) * (-333.976) [-333.644] (-337.799) (-337.641) -- 0:00:39
323000 -- (-333.985) (-335.616) [-334.894] (-336.163) * (-333.284) (-332.601) (-334.964) [-334.517] -- 0:00:39
323500 -- (-334.665) (-334.233) [-335.589] (-338.935) * [-335.498] (-333.506) (-335.068) (-333.403) -- 0:00:39
324000 -- [-333.929] (-335.728) (-336.766) (-333.784) * (-338.015) [-332.515] (-333.399) (-334.556) -- 0:00:39
324500 -- [-334.264] (-337.025) (-338.821) (-332.951) * [-333.124] (-335.130) (-336.152) (-334.503) -- 0:00:39
325000 -- (-333.899) (-335.545) (-333.213) [-334.741] * (-335.849) (-338.350) (-334.517) [-336.512] -- 0:00:39
Average standard deviation of split frequencies: 0.017885
325500 -- [-335.013] (-334.107) (-333.064) (-335.872) * (-332.725) [-333.960] (-335.238) (-333.782) -- 0:00:39
326000 -- (-334.359) (-333.090) (-333.113) [-333.352] * (-334.158) [-335.529] (-334.960) (-338.203) -- 0:00:39
326500 -- (-336.484) (-333.648) (-336.183) [-333.076] * (-338.303) [-334.318] (-336.434) (-333.495) -- 0:00:41
327000 -- [-340.672] (-335.098) (-335.587) (-333.749) * (-334.764) (-336.648) [-334.830] (-333.934) -- 0:00:41
327500 -- [-332.886] (-335.779) (-335.286) (-335.571) * (-333.429) [-334.286] (-333.577) (-334.489) -- 0:00:41
328000 -- (-334.560) (-332.938) (-334.749) [-334.397] * (-335.182) (-333.159) (-332.713) [-334.243] -- 0:00:40
328500 -- (-333.035) (-334.998) (-338.484) [-334.362] * (-335.424) (-336.971) (-335.162) [-333.437] -- 0:00:40
329000 -- (-333.667) [-337.550] (-339.657) (-333.802) * (-344.595) (-334.338) (-335.341) [-333.572] -- 0:00:40
329500 -- (-332.570) [-336.206] (-333.507) (-332.837) * (-333.405) (-333.265) (-336.144) [-336.260] -- 0:00:40
330000 -- (-337.184) [-334.762] (-332.545) (-333.911) * [-333.075] (-336.873) (-334.418) (-333.853) -- 0:00:40
Average standard deviation of split frequencies: 0.018308
330500 -- (-333.042) (-332.378) (-335.947) [-334.153] * [-334.188] (-335.474) (-336.402) (-334.060) -- 0:00:40
331000 -- (-334.766) [-333.392] (-335.504) (-332.940) * (-333.342) [-333.750] (-332.703) (-335.986) -- 0:00:40
331500 -- (-335.174) (-333.594) (-335.072) [-333.739] * (-333.584) [-336.806] (-334.018) (-336.620) -- 0:00:40
332000 -- (-333.160) (-335.870) (-333.180) [-332.922] * [-335.871] (-335.194) (-333.881) (-336.196) -- 0:00:40
332500 -- (-334.360) (-337.355) [-332.897] (-336.938) * [-333.273] (-335.515) (-333.696) (-332.832) -- 0:00:40
333000 -- (-336.796) (-332.992) [-336.068] (-332.612) * (-337.818) (-332.840) [-334.902] (-337.736) -- 0:00:40
333500 -- (-333.999) (-334.426) [-332.820] (-343.050) * (-342.014) (-333.363) [-334.024] (-332.360) -- 0:00:39
334000 -- (-332.373) (-333.912) [-334.626] (-334.809) * (-337.246) [-333.696] (-332.572) (-340.150) -- 0:00:39
334500 -- (-335.056) (-333.796) [-333.552] (-334.875) * [-336.722] (-334.480) (-332.851) (-334.973) -- 0:00:39
335000 -- (-333.937) (-333.277) (-335.037) [-335.262] * (-338.965) (-335.759) [-333.594] (-334.415) -- 0:00:39
Average standard deviation of split frequencies: 0.018239
335500 -- (-334.058) [-334.704] (-332.982) (-344.224) * (-335.600) (-338.033) [-334.736] (-335.293) -- 0:00:39
336000 -- [-333.885] (-333.671) (-332.825) (-338.754) * [-338.393] (-336.480) (-337.159) (-338.162) -- 0:00:39
336500 -- (-334.765) (-332.947) [-333.282] (-334.457) * (-335.428) (-333.451) [-333.953] (-334.365) -- 0:00:39
337000 -- (-336.477) (-333.704) (-335.817) [-334.653] * (-335.717) [-337.416] (-335.876) (-336.976) -- 0:00:39
337500 -- [-335.122] (-334.155) (-337.137) (-333.154) * (-334.368) [-336.704] (-336.023) (-334.731) -- 0:00:39
338000 -- (-333.576) [-333.342] (-335.841) (-333.620) * (-337.267) (-334.974) [-333.870] (-333.820) -- 0:00:39
338500 -- [-332.323] (-336.125) (-336.044) (-334.608) * (-339.928) (-337.618) [-334.120] (-335.550) -- 0:00:39
339000 -- (-332.562) (-334.532) (-334.433) [-334.831] * (-333.627) (-338.436) [-338.229] (-336.317) -- 0:00:38
339500 -- [-336.022] (-335.791) (-336.273) (-332.615) * (-337.552) (-339.654) (-333.579) [-334.106] -- 0:00:38
340000 -- (-333.943) (-332.482) [-334.083] (-337.228) * [-333.381] (-338.034) (-337.846) (-332.605) -- 0:00:38
Average standard deviation of split frequencies: 0.017916
340500 -- (-339.623) (-332.819) [-335.716] (-336.537) * (-333.725) (-333.910) (-339.704) [-333.061] -- 0:00:38
341000 -- (-335.446) [-333.858] (-334.759) (-333.239) * (-333.936) (-333.425) [-337.564] (-334.660) -- 0:00:38
341500 -- (-336.178) [-335.661] (-332.643) (-335.524) * (-334.953) (-332.656) [-333.788] (-332.552) -- 0:00:38
342000 -- (-335.125) (-334.401) (-332.637) [-336.038] * (-333.558) (-333.676) [-334.286] (-334.667) -- 0:00:38
342500 -- [-334.995] (-333.606) (-334.647) (-335.625) * (-332.663) (-338.588) [-332.796] (-333.456) -- 0:00:38
343000 -- (-334.727) (-332.569) [-335.882] (-336.120) * (-335.158) (-335.573) (-332.662) [-333.869] -- 0:00:38
343500 -- (-333.515) [-333.683] (-341.027) (-332.586) * [-332.913] (-336.465) (-333.694) (-334.892) -- 0:00:40
344000 -- (-333.864) (-335.736) [-336.529] (-335.436) * (-336.130) (-334.417) (-335.270) [-334.086] -- 0:00:40
344500 -- (-334.992) [-333.856] (-333.345) (-335.155) * [-333.953] (-332.527) (-333.347) (-336.072) -- 0:00:39
345000 -- (-336.133) (-336.050) [-337.037] (-334.271) * (-333.841) (-334.565) [-335.249] (-332.649) -- 0:00:39
Average standard deviation of split frequencies: 0.018070
345500 -- (-335.522) (-336.847) (-337.664) [-335.132] * (-336.103) (-334.719) [-332.943] (-333.507) -- 0:00:39
346000 -- (-336.125) [-332.630] (-336.626) (-335.447) * [-334.830] (-333.574) (-333.456) (-334.441) -- 0:00:39
346500 -- [-333.028] (-335.234) (-336.036) (-339.126) * (-336.163) [-336.017] (-335.157) (-337.385) -- 0:00:39
347000 -- (-332.537) [-334.147] (-336.078) (-345.365) * (-332.847) (-333.822) (-333.100) [-333.959] -- 0:00:39
347500 -- (-334.362) [-334.629] (-335.241) (-335.994) * [-334.429] (-332.746) (-332.588) (-334.531) -- 0:00:39
348000 -- (-335.769) [-333.651] (-333.647) (-337.125) * (-335.719) (-333.375) [-334.205] (-333.298) -- 0:00:39
348500 -- (-335.667) (-333.857) (-333.929) [-334.854] * [-333.493] (-334.163) (-334.398) (-332.344) -- 0:00:39
349000 -- (-339.312) (-335.231) (-334.632) [-333.982] * (-332.791) (-332.956) (-334.022) [-333.251] -- 0:00:39
349500 -- (-339.864) (-338.408) (-333.121) [-333.753] * (-334.805) (-332.512) [-332.209] (-335.188) -- 0:00:39
350000 -- [-339.286] (-336.916) (-334.937) (-333.154) * (-334.957) [-334.774] (-336.230) (-337.576) -- 0:00:39
Average standard deviation of split frequencies: 0.018113
350500 -- (-337.324) (-337.822) (-333.856) [-333.736] * [-332.202] (-333.059) (-333.971) (-333.134) -- 0:00:38
351000 -- [-335.948] (-341.926) (-334.966) (-336.695) * (-333.846) (-334.357) (-334.404) [-333.356] -- 0:00:38
351500 -- (-336.007) [-336.283] (-336.229) (-334.983) * (-334.245) (-335.757) (-334.866) [-332.262] -- 0:00:38
352000 -- (-333.102) (-333.962) [-333.035] (-332.899) * (-334.014) (-333.958) [-333.597] (-338.766) -- 0:00:38
352500 -- (-337.525) (-334.211) (-342.604) [-334.973] * (-334.735) (-334.506) [-333.518] (-333.751) -- 0:00:38
353000 -- (-335.765) (-333.202) (-335.106) [-335.098] * [-337.597] (-334.581) (-335.060) (-335.627) -- 0:00:38
353500 -- [-336.552] (-337.284) (-342.101) (-337.600) * (-338.341) (-334.624) (-333.842) [-335.568] -- 0:00:38
354000 -- [-332.988] (-336.913) (-337.382) (-334.793) * (-339.533) (-337.818) [-333.468] (-332.822) -- 0:00:38
354500 -- (-332.769) (-335.814) (-335.834) [-335.428] * (-335.584) [-336.438] (-333.525) (-332.807) -- 0:00:38
355000 -- (-333.461) (-334.020) (-334.878) [-334.683] * [-333.576] (-333.443) (-334.468) (-333.616) -- 0:00:38
Average standard deviation of split frequencies: 0.018097
355500 -- (-334.490) [-333.519] (-334.902) (-335.422) * (-334.624) [-332.617] (-333.077) (-337.684) -- 0:00:38
356000 -- (-338.827) [-333.732] (-335.443) (-335.760) * (-332.836) (-335.861) [-333.386] (-333.439) -- 0:00:37
356500 -- (-335.554) (-332.663) (-332.846) [-332.916] * (-332.707) (-333.001) (-337.381) [-332.454] -- 0:00:37
357000 -- (-333.427) [-333.032] (-335.425) (-334.729) * (-334.613) (-334.491) (-333.658) [-335.099] -- 0:00:37
357500 -- (-335.130) [-334.537] (-337.096) (-336.012) * (-334.461) [-335.143] (-334.117) (-335.436) -- 0:00:37
358000 -- (-333.778) (-336.688) (-333.204) [-332.887] * [-335.771] (-336.833) (-335.596) (-334.742) -- 0:00:37
358500 -- [-332.985] (-334.620) (-332.927) (-334.810) * [-337.642] (-334.714) (-337.060) (-335.226) -- 0:00:37
359000 -- (-335.483) (-332.503) (-336.511) [-334.428] * (-332.898) (-333.768) [-332.190] (-332.817) -- 0:00:37
359500 -- (-336.556) [-335.792] (-333.384) (-333.579) * (-338.008) [-334.444] (-334.179) (-338.808) -- 0:00:37
360000 -- (-334.727) (-334.527) (-332.742) [-334.402] * (-335.613) (-335.384) (-333.037) [-333.117] -- 0:00:37
Average standard deviation of split frequencies: 0.018371
360500 -- (-334.449) (-336.350) (-332.425) [-332.833] * (-333.230) (-334.363) [-334.919] (-333.361) -- 0:00:39
361000 -- (-333.301) (-336.691) [-336.061] (-335.342) * (-336.099) (-337.047) (-334.624) [-332.459] -- 0:00:38
361500 -- (-334.071) (-336.385) (-336.689) [-332.930] * (-334.333) (-336.347) [-336.929] (-333.074) -- 0:00:38
362000 -- (-335.210) (-334.828) [-334.764] (-332.335) * (-332.933) (-333.404) (-337.160) [-334.733] -- 0:00:38
362500 -- [-335.328] (-334.639) (-333.744) (-335.384) * (-334.447) (-333.988) [-333.183] (-336.241) -- 0:00:38
363000 -- (-334.126) [-337.608] (-333.981) (-333.142) * (-333.553) (-332.334) [-334.913] (-333.137) -- 0:00:38
363500 -- [-333.924] (-335.100) (-333.115) (-335.950) * (-334.737) (-332.457) [-339.113] (-332.315) -- 0:00:38
364000 -- [-338.665] (-333.199) (-333.781) (-335.163) * (-335.126) (-334.366) (-333.274) [-332.862] -- 0:00:38
364500 -- [-333.704] (-335.582) (-332.790) (-332.793) * (-335.822) (-334.572) (-333.315) [-335.466] -- 0:00:38
365000 -- (-338.175) [-337.253] (-335.253) (-333.725) * [-333.878] (-336.407) (-333.183) (-335.081) -- 0:00:38
Average standard deviation of split frequencies: 0.017625
365500 -- [-334.549] (-335.442) (-334.456) (-332.378) * [-333.950] (-332.319) (-334.855) (-333.070) -- 0:00:38
366000 -- (-337.262) [-336.130] (-335.258) (-333.591) * (-332.441) (-332.785) [-336.733] (-335.537) -- 0:00:38
366500 -- (-335.809) [-333.849] (-333.860) (-334.817) * (-336.921) (-333.886) [-334.011] (-334.688) -- 0:00:38
367000 -- (-336.895) [-332.476] (-337.507) (-334.774) * (-334.439) (-334.138) (-332.645) [-339.025] -- 0:00:37
367500 -- (-333.934) (-332.690) [-333.271] (-333.790) * [-335.773] (-337.596) (-335.500) (-332.860) -- 0:00:37
368000 -- (-337.339) (-334.524) (-334.347) [-336.501] * (-334.901) (-337.656) [-334.044] (-333.887) -- 0:00:37
368500 -- (-335.096) (-335.136) (-334.242) [-333.339] * [-334.532] (-335.940) (-334.563) (-337.858) -- 0:00:37
369000 -- (-334.775) (-333.486) (-335.429) [-334.838] * (-336.797) (-333.675) (-334.141) [-333.153] -- 0:00:37
369500 -- (-333.341) (-333.917) (-332.852) [-333.381] * (-333.726) (-333.349) [-334.458] (-332.340) -- 0:00:37
370000 -- (-335.962) (-333.257) (-332.576) [-333.661] * (-332.695) [-334.118] (-333.044) (-333.341) -- 0:00:37
Average standard deviation of split frequencies: 0.017470
370500 -- (-332.560) (-333.881) (-332.659) [-332.909] * [-335.170] (-333.394) (-332.899) (-333.106) -- 0:00:37
371000 -- (-333.519) (-333.835) (-333.421) [-333.855] * (-335.233) (-336.331) (-336.327) [-334.805] -- 0:00:37
371500 -- [-333.662] (-334.905) (-337.898) (-335.485) * (-334.713) [-333.951] (-334.897) (-335.042) -- 0:00:37
372000 -- (-332.447) (-332.005) (-336.240) [-334.546] * (-332.211) [-332.521] (-333.855) (-333.392) -- 0:00:37
372500 -- (-332.750) [-334.225] (-336.954) (-334.518) * (-333.025) (-334.306) (-333.518) [-333.935] -- 0:00:37
373000 -- (-332.664) (-333.410) (-336.600) [-334.859] * [-335.460] (-338.229) (-333.583) (-335.119) -- 0:00:36
373500 -- [-334.491] (-334.583) (-335.274) (-334.507) * [-336.743] (-333.659) (-334.013) (-334.463) -- 0:00:36
374000 -- (-333.380) [-334.372] (-332.201) (-333.450) * (-333.593) (-333.514) (-333.870) [-336.091] -- 0:00:36
374500 -- (-333.352) (-332.724) (-333.177) [-332.421] * (-334.861) [-332.924] (-334.851) (-333.744) -- 0:00:36
375000 -- (-333.548) (-334.864) [-334.390] (-332.580) * (-333.611) [-335.382] (-333.650) (-333.296) -- 0:00:36
Average standard deviation of split frequencies: 0.017816
375500 -- (-334.867) (-335.489) (-333.038) [-332.292] * (-336.116) (-332.710) [-334.041] (-332.534) -- 0:00:36
376000 -- (-338.269) (-336.074) [-333.193] (-333.000) * [-337.378] (-336.274) (-335.844) (-332.631) -- 0:00:36
376500 -- (-335.702) (-335.310) (-337.367) [-333.929] * [-338.191] (-337.842) (-334.776) (-332.905) -- 0:00:36
377000 -- (-332.143) (-334.107) (-333.530) [-333.426] * (-333.789) [-335.210] (-336.410) (-337.505) -- 0:00:38
377500 -- [-333.003] (-334.086) (-332.673) (-333.321) * (-334.346) (-334.418) [-336.516] (-334.056) -- 0:00:37
378000 -- (-339.375) (-334.899) [-335.119] (-336.454) * [-332.175] (-333.951) (-337.487) (-335.726) -- 0:00:37
378500 -- (-333.714) (-334.980) [-334.116] (-332.854) * [-333.829] (-334.885) (-333.137) (-332.608) -- 0:00:37
379000 -- (-334.741) (-334.139) [-335.099] (-333.987) * [-333.082] (-336.454) (-335.815) (-333.914) -- 0:00:37
379500 -- (-334.037) [-333.506] (-335.632) (-334.954) * (-338.161) (-334.145) [-336.761] (-338.241) -- 0:00:37
380000 -- (-336.054) [-333.006] (-332.516) (-334.659) * (-333.127) (-332.835) (-337.270) [-335.170] -- 0:00:37
Average standard deviation of split frequencies: 0.017859
380500 -- [-333.760] (-332.644) (-339.013) (-333.468) * (-335.919) [-334.107] (-341.919) (-336.999) -- 0:00:37
381000 -- (-335.869) [-334.285] (-338.162) (-334.421) * (-335.651) [-337.069] (-333.088) (-335.376) -- 0:00:37
381500 -- (-334.929) (-334.738) [-334.706] (-334.330) * (-334.598) (-339.863) [-335.565] (-336.834) -- 0:00:37
382000 -- (-335.411) (-336.903) [-334.565] (-333.896) * (-335.727) (-340.982) [-335.682] (-334.729) -- 0:00:37
382500 -- [-333.691] (-332.953) (-333.611) (-337.261) * [-332.982] (-336.822) (-334.685) (-334.625) -- 0:00:37
383000 -- (-335.455) [-334.724] (-334.947) (-337.586) * [-332.902] (-334.846) (-333.526) (-335.589) -- 0:00:37
383500 -- (-335.259) [-333.762] (-337.387) (-335.095) * (-334.799) (-335.505) [-332.397] (-338.407) -- 0:00:36
384000 -- (-334.587) (-335.706) [-333.393] (-333.372) * (-335.051) (-338.364) [-333.556] (-333.146) -- 0:00:36
384500 -- (-337.328) [-335.846] (-333.853) (-334.181) * [-334.372] (-336.566) (-335.096) (-334.378) -- 0:00:36
385000 -- (-335.482) (-335.134) (-335.628) [-333.842] * (-337.112) (-335.550) [-332.868] (-333.796) -- 0:00:36
Average standard deviation of split frequencies: 0.017740
385500 -- (-335.191) (-337.206) [-333.869] (-335.091) * (-336.438) (-332.536) (-333.068) [-334.765] -- 0:00:36
386000 -- [-336.807] (-334.950) (-334.096) (-333.304) * [-336.044] (-334.216) (-334.048) (-334.989) -- 0:00:36
386500 -- (-333.537) [-335.966] (-336.797) (-335.902) * (-336.293) [-332.696] (-338.916) (-332.810) -- 0:00:36
387000 -- [-333.052] (-334.124) (-335.647) (-334.152) * [-333.796] (-333.756) (-336.398) (-333.725) -- 0:00:36
387500 -- [-333.697] (-336.183) (-336.056) (-336.437) * (-333.751) [-333.274] (-337.533) (-334.687) -- 0:00:36
388000 -- (-334.065) (-336.090) (-336.051) [-335.264] * [-335.594] (-334.038) (-334.049) (-336.306) -- 0:00:36
388500 -- (-333.942) [-334.676] (-334.645) (-333.962) * (-334.499) (-337.947) (-332.811) [-335.804] -- 0:00:36
389000 -- [-333.768] (-336.342) (-335.301) (-333.564) * [-332.750] (-336.874) (-333.448) (-337.039) -- 0:00:36
389500 -- (-336.359) [-333.562] (-333.477) (-334.718) * (-339.386) (-335.152) (-332.751) [-334.224] -- 0:00:36
390000 -- (-335.310) [-333.103] (-334.690) (-333.730) * [-334.166] (-335.327) (-334.221) (-333.394) -- 0:00:35
Average standard deviation of split frequencies: 0.018100
390500 -- (-337.793) [-335.352] (-336.158) (-334.097) * (-332.815) (-333.759) (-335.522) [-334.219] -- 0:00:35
391000 -- [-333.177] (-336.741) (-336.770) (-335.651) * (-338.483) (-333.205) [-333.680] (-341.998) -- 0:00:35
391500 -- [-333.971] (-338.078) (-333.918) (-334.283) * (-334.568) (-333.811) [-333.798] (-335.339) -- 0:00:35
392000 -- (-337.324) (-334.161) [-333.057] (-333.178) * (-334.060) (-332.931) (-334.173) [-339.549] -- 0:00:35
392500 -- (-334.915) [-333.571] (-333.512) (-333.452) * (-334.943) (-335.597) (-337.579) [-337.380] -- 0:00:35
393000 -- (-334.925) (-333.873) (-338.862) [-333.688] * (-336.427) [-334.515] (-336.062) (-333.467) -- 0:00:35
393500 -- (-334.882) (-333.695) [-334.278] (-335.176) * (-335.511) (-339.649) [-332.775] (-332.448) -- 0:00:35
394000 -- (-334.737) [-333.579] (-334.663) (-336.534) * (-333.284) (-333.560) [-333.592] (-333.228) -- 0:00:36
394500 -- (-333.308) (-333.805) (-332.737) [-332.793] * [-334.112] (-334.706) (-334.184) (-339.245) -- 0:00:36
395000 -- [-333.319] (-333.496) (-333.623) (-334.164) * (-336.980) [-334.621] (-336.451) (-334.364) -- 0:00:36
Average standard deviation of split frequencies: 0.017480
395500 -- (-332.409) (-334.616) [-333.225] (-342.789) * (-334.282) (-333.247) (-333.398) [-334.950] -- 0:00:36
396000 -- [-337.182] (-333.804) (-335.924) (-335.569) * [-336.689] (-338.194) (-334.350) (-335.542) -- 0:00:36
396500 -- (-341.473) [-333.398] (-335.044) (-334.737) * (-333.267) [-333.131] (-338.505) (-334.019) -- 0:00:36
397000 -- [-339.210] (-336.284) (-333.923) (-336.436) * (-339.247) [-333.621] (-332.328) (-337.316) -- 0:00:36
397500 -- (-343.633) (-337.033) [-333.550] (-336.051) * (-332.896) (-333.858) [-332.805] (-335.112) -- 0:00:36
398000 -- (-344.458) [-333.655] (-333.926) (-338.090) * (-335.105) (-333.126) [-333.730] (-334.201) -- 0:00:36
398500 -- (-334.347) (-334.252) [-335.087] (-333.032) * [-333.284] (-334.122) (-332.941) (-333.772) -- 0:00:36
399000 -- (-338.277) (-332.807) [-333.583] (-333.310) * (-332.368) (-333.853) (-333.116) [-335.635] -- 0:00:36
399500 -- (-332.769) (-335.548) (-337.997) [-334.741] * (-332.766) [-333.877] (-333.660) (-333.632) -- 0:00:36
400000 -- (-335.116) (-335.186) (-333.539) [-333.993] * (-333.693) [-332.969] (-335.355) (-334.343) -- 0:00:36
Average standard deviation of split frequencies: 0.018206
400500 -- (-334.206) [-337.126] (-336.859) (-333.494) * (-335.277) (-337.596) (-334.014) [-333.659] -- 0:00:35
401000 -- (-335.502) (-334.283) (-333.249) [-332.516] * (-332.737) (-334.321) [-333.330] (-334.613) -- 0:00:35
401500 -- [-333.804] (-333.938) (-333.111) (-332.918) * (-334.679) [-334.671] (-332.511) (-334.703) -- 0:00:35
402000 -- (-335.709) (-334.534) [-333.035] (-335.844) * (-335.124) (-333.906) (-333.198) [-332.965] -- 0:00:35
402500 -- (-335.200) [-334.084] (-333.333) (-335.438) * (-334.911) (-332.390) [-332.229] (-336.580) -- 0:00:35
403000 -- (-334.839) (-337.349) [-334.233] (-334.523) * [-334.295] (-337.535) (-333.857) (-333.580) -- 0:00:35
403500 -- (-335.238) (-335.284) (-333.863) [-336.489] * [-333.289] (-332.378) (-332.769) (-336.198) -- 0:00:35
404000 -- (-332.786) (-336.048) [-333.396] (-337.075) * (-333.023) (-334.195) [-333.013] (-333.435) -- 0:00:35
404500 -- (-333.821) (-335.411) (-337.590) [-332.741] * (-333.420) [-333.608] (-334.566) (-336.921) -- 0:00:35
405000 -- (-335.083) [-334.751] (-335.154) (-332.759) * (-336.490) (-333.403) (-333.300) [-337.338] -- 0:00:35
Average standard deviation of split frequencies: 0.017539
405500 -- [-334.093] (-336.949) (-338.802) (-336.362) * [-332.115] (-333.495) (-335.680) (-335.242) -- 0:00:35
406000 -- (-335.185) (-333.672) (-337.558) [-333.621] * (-333.748) (-333.968) (-336.533) [-338.001] -- 0:00:35
406500 -- (-337.454) (-334.477) [-334.270] (-336.143) * [-333.190] (-336.824) (-338.969) (-333.822) -- 0:00:35
407000 -- (-337.008) [-334.921] (-333.174) (-338.982) * [-333.765] (-334.344) (-342.632) (-335.727) -- 0:00:34
407500 -- (-334.981) (-333.454) (-334.145) [-335.312] * [-333.295] (-333.294) (-333.990) (-332.837) -- 0:00:34
408000 -- (-335.406) [-334.595] (-336.900) (-334.482) * (-334.188) (-332.979) (-335.320) [-333.670] -- 0:00:34
408500 -- (-336.711) (-335.411) (-336.045) [-334.400] * (-333.684) [-334.773] (-333.423) (-337.372) -- 0:00:34
409000 -- [-335.290] (-337.557) (-339.488) (-333.740) * (-333.682) (-332.549) [-333.192] (-333.142) -- 0:00:34
409500 -- (-334.483) (-335.151) (-335.315) [-335.893] * (-335.674) (-334.064) [-333.826] (-333.454) -- 0:00:34
410000 -- (-333.742) (-336.048) (-333.493) [-333.852] * (-334.028) (-334.236) [-334.631] (-334.686) -- 0:00:34
Average standard deviation of split frequencies: 0.017410
410500 -- (-336.884) [-332.235] (-334.203) (-334.210) * (-333.080) [-335.536] (-332.991) (-334.464) -- 0:00:34
411000 -- (-333.515) (-334.116) (-333.477) [-334.379] * (-336.166) (-334.533) [-336.555] (-336.401) -- 0:00:35
411500 -- (-332.571) (-336.219) [-335.218] (-332.996) * (-333.314) (-333.594) [-334.816] (-338.321) -- 0:00:35
412000 -- (-333.068) [-335.330] (-336.376) (-336.509) * [-336.029] (-338.598) (-336.010) (-333.903) -- 0:00:35
412500 -- (-333.090) (-334.306) (-334.410) [-333.529] * (-334.639) (-334.142) [-332.666] (-333.098) -- 0:00:35
413000 -- (-333.556) (-333.235) [-332.990] (-334.668) * (-334.750) (-332.973) [-333.891] (-333.233) -- 0:00:35
413500 -- (-337.079) (-335.456) (-332.263) [-334.681] * (-337.041) (-333.405) (-332.125) [-335.471] -- 0:00:35
414000 -- (-336.289) [-332.781] (-339.531) (-333.113) * (-332.401) (-335.026) [-333.409] (-335.752) -- 0:00:35
414500 -- (-334.608) (-332.491) [-334.385] (-334.349) * (-334.815) [-333.427] (-334.946) (-338.488) -- 0:00:35
415000 -- (-333.598) [-332.832] (-335.068) (-334.780) * [-335.748] (-337.093) (-334.270) (-337.780) -- 0:00:35
Average standard deviation of split frequencies: 0.016103
415500 -- (-335.395) [-333.713] (-335.518) (-337.454) * (-332.434) (-333.970) [-332.431] (-334.615) -- 0:00:35
416000 -- (-334.303) (-332.493) [-334.973] (-334.929) * [-333.173] (-337.060) (-335.650) (-334.634) -- 0:00:35
416500 -- (-334.422) (-335.353) [-332.915] (-334.871) * [-335.857] (-334.656) (-333.416) (-333.685) -- 0:00:35
417000 -- (-340.396) (-333.438) [-339.367] (-334.439) * [-339.496] (-334.246) (-334.652) (-336.627) -- 0:00:34
417500 -- (-342.940) [-334.138] (-334.815) (-334.734) * (-332.769) (-335.589) [-332.307] (-337.371) -- 0:00:34
418000 -- (-337.977) (-336.275) [-333.798] (-333.731) * [-333.809] (-338.951) (-335.374) (-333.109) -- 0:00:34
418500 -- (-334.935) [-333.982] (-334.395) (-333.143) * [-335.024] (-335.476) (-336.446) (-334.700) -- 0:00:34
419000 -- (-334.508) (-335.560) (-332.351) [-332.919] * (-337.951) [-333.257] (-335.502) (-337.962) -- 0:00:34
419500 -- (-334.256) [-332.511] (-332.328) (-333.233) * [-335.100] (-338.079) (-333.552) (-334.481) -- 0:00:34
420000 -- (-334.085) (-336.165) [-333.318] (-332.924) * [-335.078] (-337.171) (-337.142) (-335.141) -- 0:00:34
Average standard deviation of split frequencies: 0.016249
420500 -- [-334.539] (-334.870) (-335.127) (-333.360) * (-333.253) (-336.996) (-332.792) [-333.632] -- 0:00:34
421000 -- [-336.482] (-337.181) (-335.914) (-334.055) * [-334.024] (-335.685) (-336.060) (-334.740) -- 0:00:34
421500 -- (-340.140) (-332.441) (-333.452) [-334.730] * (-333.972) (-333.413) (-332.975) [-336.800] -- 0:00:34
422000 -- (-333.946) (-333.287) [-336.103] (-336.208) * (-334.444) [-334.698] (-335.720) (-334.777) -- 0:00:34
422500 -- (-335.530) [-332.289] (-336.634) (-334.969) * [-334.135] (-334.947) (-334.972) (-333.694) -- 0:00:34
423000 -- [-333.499] (-333.583) (-335.920) (-332.405) * (-335.801) (-336.380) [-333.102] (-332.843) -- 0:00:34
423500 -- (-336.163) (-335.784) [-332.717] (-336.445) * [-335.128] (-340.798) (-333.520) (-334.919) -- 0:00:34
424000 -- (-333.396) (-333.032) [-334.368] (-334.292) * (-337.632) [-336.586] (-334.574) (-333.372) -- 0:00:33
424500 -- (-332.991) [-334.694] (-336.209) (-339.019) * (-334.883) (-339.151) [-332.337] (-340.441) -- 0:00:33
425000 -- (-333.688) (-333.209) (-333.307) [-335.678] * (-335.012) (-337.009) (-332.629) [-336.564] -- 0:00:33
Average standard deviation of split frequencies: 0.015492
425500 -- [-337.109] (-335.229) (-338.068) (-335.689) * (-334.988) [-333.597] (-332.766) (-332.661) -- 0:00:33
426000 -- [-335.706] (-334.491) (-339.290) (-334.360) * (-333.224) [-334.223] (-333.844) (-337.238) -- 0:00:33
426500 -- (-337.388) [-334.767] (-336.050) (-337.068) * (-334.986) [-333.455] (-334.806) (-333.758) -- 0:00:33
427000 -- (-338.087) (-334.012) (-334.733) [-334.832] * (-336.558) (-333.222) (-338.346) [-333.163] -- 0:00:33
427500 -- (-334.532) [-333.506] (-334.058) (-334.698) * (-333.823) [-334.024] (-332.735) (-333.208) -- 0:00:33
428000 -- (-332.964) (-333.968) (-338.767) [-332.623] * [-333.283] (-341.509) (-333.815) (-333.197) -- 0:00:34
428500 -- (-337.043) [-333.412] (-338.206) (-333.734) * (-334.111) (-335.672) (-333.624) [-332.508] -- 0:00:34
429000 -- (-335.036) (-336.436) [-333.923] (-334.010) * (-334.036) (-338.357) [-333.786] (-332.660) -- 0:00:34
429500 -- [-336.329] (-332.619) (-333.131) (-334.081) * [-334.884] (-337.734) (-335.360) (-335.226) -- 0:00:34
430000 -- (-335.807) (-335.405) (-333.671) [-333.871] * (-334.074) (-334.196) [-336.835] (-337.296) -- 0:00:34
Average standard deviation of split frequencies: 0.015555
430500 -- (-335.662) (-335.571) (-333.050) [-332.433] * (-333.816) (-335.014) (-334.374) [-334.408] -- 0:00:34
431000 -- (-332.975) (-332.649) [-332.526] (-333.500) * [-333.835] (-332.421) (-340.143) (-332.968) -- 0:00:34
431500 -- (-332.751) (-332.731) [-333.841] (-333.382) * (-334.338) (-333.476) [-333.905] (-334.374) -- 0:00:34
432000 -- (-332.815) (-332.843) [-334.226] (-334.536) * (-333.420) (-335.302) (-334.297) [-337.020] -- 0:00:34
432500 -- [-333.115] (-333.632) (-338.388) (-339.670) * (-333.307) (-335.186) [-333.101] (-334.843) -- 0:00:34
433000 -- (-333.226) [-334.027] (-336.349) (-335.224) * [-332.762] (-332.213) (-333.914) (-337.348) -- 0:00:34
433500 -- [-333.740] (-332.911) (-332.926) (-333.478) * [-333.493] (-332.539) (-333.030) (-335.233) -- 0:00:33
434000 -- (-335.349) [-333.664] (-334.613) (-334.519) * [-335.868] (-333.740) (-335.531) (-333.602) -- 0:00:33
434500 -- (-336.383) (-335.475) [-335.080] (-335.048) * (-334.251) [-332.866] (-339.290) (-333.570) -- 0:00:33
435000 -- [-339.186] (-336.146) (-334.298) (-336.004) * [-334.086] (-333.015) (-335.830) (-332.078) -- 0:00:33
Average standard deviation of split frequencies: 0.014837
435500 -- (-337.641) [-334.261] (-332.997) (-334.683) * (-336.667) (-340.445) (-335.641) [-334.504] -- 0:00:33
436000 -- (-335.466) (-335.131) [-334.167] (-335.764) * [-336.130] (-336.897) (-336.743) (-335.135) -- 0:00:33
436500 -- (-333.453) (-333.692) [-334.908] (-336.042) * [-334.417] (-336.191) (-337.427) (-333.978) -- 0:00:33
437000 -- (-334.011) (-333.838) [-333.664] (-335.369) * (-336.390) (-335.814) (-336.905) [-333.657] -- 0:00:33
437500 -- [-332.815] (-335.627) (-337.270) (-334.866) * (-333.484) (-342.919) [-334.203] (-335.888) -- 0:00:33
438000 -- (-333.094) [-333.837] (-335.986) (-334.573) * [-333.463] (-338.872) (-335.547) (-335.119) -- 0:00:33
438500 -- (-333.679) (-335.419) (-333.993) [-335.679] * [-333.963] (-336.127) (-334.580) (-333.738) -- 0:00:33
439000 -- (-334.579) (-334.532) (-333.451) [-334.038] * (-334.912) [-333.609] (-338.787) (-335.393) -- 0:00:33
439500 -- (-332.228) (-332.944) (-333.008) [-333.201] * [-335.529] (-333.242) (-335.356) (-338.761) -- 0:00:33
440000 -- (-333.632) (-336.572) (-333.488) [-334.700] * (-335.599) [-333.819] (-335.125) (-333.282) -- 0:00:33
Average standard deviation of split frequencies: 0.014917
440500 -- [-334.961] (-338.876) (-335.377) (-337.177) * (-337.856) [-334.182] (-333.746) (-334.170) -- 0:00:33
441000 -- [-335.043] (-335.092) (-335.821) (-339.597) * (-333.417) (-333.552) [-334.576] (-333.837) -- 0:00:32
441500 -- [-335.604] (-334.925) (-338.134) (-332.760) * (-337.061) (-332.334) (-333.815) [-335.989] -- 0:00:32
442000 -- (-333.543) (-332.869) (-334.712) [-332.910] * (-333.133) (-332.294) [-333.129] (-333.244) -- 0:00:32
442500 -- [-338.819] (-334.581) (-332.130) (-334.157) * [-333.963] (-333.513) (-332.907) (-332.431) -- 0:00:32
443000 -- (-333.486) [-334.889] (-334.567) (-335.859) * (-334.293) (-332.803) [-335.768] (-334.579) -- 0:00:32
443500 -- (-332.474) [-334.436] (-333.863) (-334.908) * [-333.827] (-334.008) (-332.871) (-333.943) -- 0:00:32
444000 -- (-335.381) [-334.518] (-333.523) (-334.911) * (-333.781) [-335.027] (-332.358) (-333.567) -- 0:00:32
444500 -- (-333.306) (-332.680) [-335.389] (-337.434) * [-336.449] (-333.324) (-334.319) (-334.006) -- 0:00:33
445000 -- (-336.843) (-333.949) [-335.662] (-334.570) * (-334.411) (-332.940) (-333.830) [-333.323] -- 0:00:33
Average standard deviation of split frequencies: 0.014915
445500 -- (-344.227) (-333.065) [-337.394] (-335.590) * (-336.411) (-332.646) [-333.549] (-334.081) -- 0:00:33
446000 -- (-334.212) [-332.781] (-332.354) (-333.737) * (-339.029) (-336.388) (-333.852) [-333.018] -- 0:00:33
446500 -- (-335.627) (-333.654) [-334.941] (-332.361) * (-334.936) [-334.068] (-334.195) (-335.531) -- 0:00:33
447000 -- (-337.707) (-333.785) [-332.770] (-332.443) * (-334.507) [-332.136] (-333.416) (-336.388) -- 0:00:33
447500 -- (-332.620) (-335.156) [-333.852] (-336.540) * (-335.601) (-333.229) (-333.745) [-333.878] -- 0:00:33
448000 -- (-336.504) [-333.216] (-332.839) (-336.594) * (-332.903) (-333.051) [-333.790] (-336.291) -- 0:00:33
448500 -- (-332.813) [-334.141] (-332.195) (-336.893) * (-333.674) (-332.995) (-334.081) [-335.455] -- 0:00:33
449000 -- (-332.801) [-333.296] (-334.079) (-334.103) * [-333.466] (-337.891) (-333.687) (-335.757) -- 0:00:33
449500 -- (-335.416) [-334.062] (-336.057) (-336.388) * (-332.584) (-333.815) (-333.407) [-332.623] -- 0:00:33
450000 -- (-334.441) (-338.153) (-336.477) [-333.858] * (-333.013) (-334.722) [-339.583] (-332.566) -- 0:00:33
Average standard deviation of split frequencies: 0.014528
450500 -- (-334.202) [-335.915] (-334.293) (-335.199) * (-335.088) (-336.102) [-333.478] (-335.172) -- 0:00:32
451000 -- (-333.614) (-335.944) [-334.939] (-335.085) * (-336.402) [-334.274] (-334.556) (-335.591) -- 0:00:32
451500 -- (-334.489) (-335.082) (-336.378) [-333.987] * [-336.959] (-339.304) (-332.642) (-334.636) -- 0:00:32
452000 -- (-334.876) (-333.026) [-337.510] (-334.341) * (-340.711) (-333.806) (-338.560) [-335.177] -- 0:00:32
452500 -- (-336.455) [-332.771] (-336.214) (-339.149) * (-337.436) [-332.902] (-333.088) (-333.408) -- 0:00:32
453000 -- (-335.588) (-336.294) [-333.518] (-335.879) * (-332.775) [-334.054] (-337.030) (-332.870) -- 0:00:32
453500 -- (-333.027) (-335.593) [-333.438] (-336.459) * [-333.890] (-334.157) (-336.535) (-332.736) -- 0:00:32
454000 -- (-333.365) (-332.750) [-334.628] (-335.578) * (-333.729) (-333.668) (-333.797) [-332.926] -- 0:00:32
454500 -- (-335.699) [-335.339] (-333.283) (-333.576) * (-335.273) (-335.886) (-332.699) [-332.163] -- 0:00:32
455000 -- (-337.593) (-333.608) (-334.693) [-334.582] * (-333.191) (-333.704) (-333.911) [-333.553] -- 0:00:32
Average standard deviation of split frequencies: 0.015020
455500 -- [-333.659] (-332.693) (-334.667) (-334.058) * [-336.219] (-337.374) (-332.745) (-334.802) -- 0:00:32
456000 -- (-333.557) (-332.149) (-334.014) [-339.621] * (-332.736) (-336.030) [-336.572] (-336.036) -- 0:00:32
456500 -- (-335.359) [-332.454] (-333.929) (-336.332) * (-341.366) [-333.306] (-336.643) (-333.184) -- 0:00:32
457000 -- (-332.347) [-333.541] (-336.042) (-337.745) * (-338.524) (-334.282) [-333.994] (-334.871) -- 0:00:32
457500 -- (-335.577) [-334.156] (-334.782) (-333.418) * (-337.249) (-338.070) (-334.934) [-334.068] -- 0:00:32
458000 -- [-334.601] (-334.768) (-333.291) (-336.890) * [-333.805] (-334.367) (-337.333) (-335.083) -- 0:00:31
458500 -- (-332.653) (-333.877) [-337.921] (-334.132) * (-336.116) (-335.387) [-336.789] (-337.401) -- 0:00:31
459000 -- [-333.175] (-338.324) (-335.230) (-332.778) * [-334.951] (-334.040) (-333.713) (-334.080) -- 0:00:31
459500 -- (-333.498) [-335.008] (-332.632) (-334.360) * (-336.195) (-334.257) [-332.381] (-335.345) -- 0:00:31
460000 -- (-334.830) (-337.977) (-334.921) [-332.385] * (-334.731) [-334.386] (-333.657) (-334.117) -- 0:00:31
Average standard deviation of split frequencies: 0.015065
460500 -- (-334.822) (-332.888) (-333.048) [-334.142] * [-333.638] (-337.396) (-335.541) (-332.804) -- 0:00:31
461000 -- (-333.337) (-333.175) [-334.537] (-337.097) * (-334.627) (-337.420) (-334.640) [-333.506] -- 0:00:31
461500 -- (-334.263) (-335.669) (-333.892) [-333.639] * [-335.167] (-334.680) (-334.870) (-334.278) -- 0:00:32
462000 -- [-332.897] (-334.482) (-332.476) (-334.480) * (-332.601) [-336.414] (-333.671) (-339.535) -- 0:00:32
462500 -- (-333.269) (-337.354) (-334.373) [-332.844] * (-336.400) (-335.963) (-334.365) [-338.297] -- 0:00:32
463000 -- (-332.460) [-337.336] (-336.175) (-333.015) * (-335.065) [-338.209] (-332.369) (-337.882) -- 0:00:32
463500 -- (-332.504) (-338.401) [-334.938] (-334.412) * (-338.591) (-335.309) [-334.730] (-342.441) -- 0:00:32
464000 -- (-332.970) (-334.509) (-333.489) [-334.475] * [-333.014] (-337.772) (-341.392) (-335.730) -- 0:00:32
464500 -- (-333.301) (-339.509) [-334.709] (-333.683) * (-334.833) (-333.121) (-332.833) [-336.788] -- 0:00:32
465000 -- (-334.131) (-338.480) (-335.072) [-335.338] * (-333.044) (-332.859) (-337.430) [-333.116] -- 0:00:32
Average standard deviation of split frequencies: 0.014837
465500 -- (-334.191) [-334.012] (-336.293) (-333.940) * (-336.242) (-332.743) (-335.026) [-333.206] -- 0:00:32
466000 -- (-333.962) [-336.751] (-335.397) (-335.764) * (-335.493) (-336.022) (-333.219) [-333.867] -- 0:00:32
466500 -- (-333.649) (-333.270) (-335.503) [-334.914] * (-333.773) (-335.157) [-333.660] (-339.150) -- 0:00:32
467000 -- [-332.711] (-333.574) (-333.791) (-333.281) * (-336.133) [-333.481] (-333.859) (-332.816) -- 0:00:31
467500 -- (-335.695) [-332.402] (-336.698) (-332.494) * (-337.343) [-334.478] (-334.303) (-333.188) -- 0:00:31
468000 -- [-333.763] (-332.350) (-333.764) (-333.909) * (-334.890) [-332.756] (-333.067) (-337.976) -- 0:00:31
468500 -- [-334.215] (-332.981) (-332.899) (-332.903) * (-332.544) [-333.576] (-333.589) (-333.977) -- 0:00:31
469000 -- (-335.146) (-337.411) (-333.508) [-334.744] * (-335.091) [-334.781] (-334.382) (-335.525) -- 0:00:31
469500 -- (-334.123) (-338.685) (-333.418) [-333.190] * (-336.033) (-334.326) [-334.301] (-335.670) -- 0:00:31
470000 -- (-338.913) [-336.758] (-334.018) (-334.106) * (-336.823) [-338.612] (-334.130) (-335.513) -- 0:00:31
Average standard deviation of split frequencies: 0.014245
470500 -- [-335.660] (-332.725) (-333.317) (-333.523) * (-336.308) (-336.475) (-336.554) [-334.973] -- 0:00:31
471000 -- (-334.976) [-332.969] (-335.089) (-335.471) * (-334.101) (-333.559) [-336.384] (-333.606) -- 0:00:31
471500 -- (-335.511) (-335.471) (-333.428) [-335.622] * (-334.903) (-334.736) (-332.849) [-335.010] -- 0:00:31
472000 -- (-333.829) (-333.792) [-335.625] (-333.247) * [-334.861] (-335.325) (-335.136) (-336.625) -- 0:00:31
472500 -- (-334.874) [-334.045] (-336.628) (-332.352) * [-333.878] (-335.826) (-336.267) (-337.858) -- 0:00:31
473000 -- (-333.774) (-335.203) (-335.790) [-334.127] * (-334.376) (-336.697) (-333.936) [-335.152] -- 0:00:31
473500 -- [-333.750] (-336.031) (-337.945) (-335.276) * [-334.412] (-334.393) (-334.098) (-334.109) -- 0:00:31
474000 -- (-335.477) (-335.582) [-333.388] (-334.958) * (-335.916) (-333.477) (-333.739) [-335.119] -- 0:00:31
474500 -- [-334.372] (-335.069) (-335.633) (-332.905) * (-335.739) (-334.580) [-334.762] (-336.204) -- 0:00:31
475000 -- [-334.485] (-335.156) (-335.550) (-333.677) * (-337.471) [-333.195] (-334.503) (-334.872) -- 0:00:30
Average standard deviation of split frequencies: 0.013617
475500 -- (-333.706) [-334.517] (-335.457) (-332.712) * (-332.371) (-333.207) [-336.563] (-336.132) -- 0:00:30
476000 -- (-333.540) [-333.972] (-336.179) (-333.410) * (-333.217) (-335.642) [-334.361] (-334.113) -- 0:00:30
476500 -- (-332.514) (-334.367) (-334.670) [-335.022] * (-333.653) (-338.336) [-335.433] (-334.921) -- 0:00:30
477000 -- (-332.123) (-333.520) [-333.176] (-338.725) * (-332.600) (-333.802) [-333.342] (-334.318) -- 0:00:31
477500 -- (-333.270) (-337.019) (-336.428) [-333.692] * (-334.325) (-332.529) (-334.617) [-334.407] -- 0:00:31
478000 -- (-335.221) (-336.137) (-337.265) [-333.941] * (-335.885) (-335.617) (-333.307) [-332.790] -- 0:00:31
478500 -- (-332.375) (-334.832) [-337.023] (-334.275) * (-335.263) (-334.437) (-337.611) [-332.110] -- 0:00:31
479000 -- (-334.512) [-336.565] (-335.899) (-334.587) * (-332.797) [-333.275] (-335.991) (-334.477) -- 0:00:31
479500 -- (-336.622) [-334.757] (-334.606) (-332.945) * (-334.540) (-334.513) [-333.401] (-332.679) -- 0:00:31
480000 -- (-333.354) [-335.024] (-335.453) (-332.760) * (-334.078) (-334.501) (-332.342) [-334.664] -- 0:00:31
Average standard deviation of split frequencies: 0.014480
480500 -- (-335.016) [-335.145] (-332.706) (-332.755) * (-335.706) (-335.030) [-333.494] (-334.997) -- 0:00:31
481000 -- (-333.761) [-334.248] (-336.373) (-334.076) * (-336.198) (-334.469) [-332.350] (-335.868) -- 0:00:31
481500 -- [-332.933] (-334.775) (-335.530) (-333.478) * (-338.562) (-334.320) (-332.361) [-333.814] -- 0:00:31
482000 -- (-335.149) (-338.104) [-334.106] (-336.301) * (-337.263) (-335.844) [-332.663] (-333.388) -- 0:00:31
482500 -- (-334.096) [-334.787] (-334.150) (-332.887) * (-335.231) [-335.098] (-337.893) (-335.922) -- 0:00:31
483000 -- (-334.786) (-333.837) [-333.658] (-332.152) * [-338.899] (-333.732) (-334.438) (-333.283) -- 0:00:31
483500 -- [-335.419] (-333.765) (-334.805) (-333.283) * (-334.029) (-335.774) (-333.978) [-334.030] -- 0:00:30
484000 -- (-333.535) (-333.589) [-337.727] (-333.348) * [-332.811] (-333.174) (-332.810) (-333.879) -- 0:00:30
484500 -- (-333.243) [-336.457] (-335.285) (-335.779) * (-335.915) (-337.193) [-334.332] (-333.123) -- 0:00:30
485000 -- (-332.615) [-335.449] (-335.668) (-333.968) * (-333.839) [-333.434] (-332.700) (-335.877) -- 0:00:30
Average standard deviation of split frequencies: 0.015120
485500 -- [-333.582] (-336.874) (-333.786) (-335.168) * (-333.625) (-332.234) (-337.608) [-335.659] -- 0:00:30
486000 -- [-333.807] (-334.906) (-333.973) (-336.415) * [-332.828] (-334.772) (-335.331) (-336.690) -- 0:00:30
486500 -- (-333.561) (-333.787) [-336.239] (-332.995) * (-334.794) [-333.186] (-332.339) (-336.529) -- 0:00:30
487000 -- (-334.303) (-334.737) (-334.224) [-332.636] * (-334.349) (-332.813) (-332.827) [-333.976] -- 0:00:30
487500 -- (-334.667) [-333.866] (-333.571) (-333.827) * (-332.393) [-333.950] (-339.323) (-334.011) -- 0:00:30
488000 -- (-334.128) (-333.570) (-333.331) [-335.567] * (-334.318) (-333.376) (-339.168) [-333.846] -- 0:00:30
488500 -- (-337.044) (-336.834) [-336.306] (-334.065) * (-334.439) [-333.655] (-334.355) (-339.558) -- 0:00:30
489000 -- (-339.365) [-334.867] (-333.164) (-335.322) * (-334.500) [-333.290] (-333.196) (-334.087) -- 0:00:30
489500 -- [-334.690] (-334.776) (-333.896) (-338.338) * (-334.225) [-333.343] (-336.896) (-332.723) -- 0:00:30
490000 -- (-334.261) (-336.753) (-333.911) [-335.096] * (-338.151) (-340.800) (-333.626) [-336.066] -- 0:00:30
Average standard deviation of split frequencies: 0.014531
490500 -- (-334.963) [-337.138] (-333.615) (-333.250) * (-335.215) [-334.729] (-334.056) (-340.338) -- 0:00:30
491000 -- (-338.920) (-332.746) [-335.729] (-334.388) * [-332.565] (-334.053) (-338.098) (-338.374) -- 0:00:30
491500 -- (-333.371) (-333.929) (-335.056) [-334.012] * [-332.872] (-335.902) (-333.968) (-338.839) -- 0:00:30
492000 -- (-336.799) (-339.625) (-334.004) [-332.615] * (-334.825) (-333.647) [-337.039] (-334.352) -- 0:00:29
492500 -- (-335.166) [-333.071] (-334.220) (-335.533) * [-334.888] (-332.681) (-335.935) (-334.875) -- 0:00:29
493000 -- [-332.624] (-333.276) (-332.685) (-335.003) * (-334.830) [-332.251] (-334.218) (-333.263) -- 0:00:29
493500 -- (-337.013) (-336.460) [-333.858] (-332.560) * (-333.658) [-335.648] (-337.316) (-335.158) -- 0:00:29
494000 -- (-333.262) (-334.328) [-335.988] (-333.058) * [-334.865] (-334.350) (-336.879) (-335.882) -- 0:00:30
494500 -- [-335.522] (-336.632) (-334.835) (-336.351) * (-334.883) (-334.182) (-333.026) [-334.645] -- 0:00:30
495000 -- (-336.573) (-334.000) [-333.934] (-336.005) * (-333.431) (-334.555) [-332.874] (-332.928) -- 0:00:30
Average standard deviation of split frequencies: 0.014791
495500 -- (-335.206) (-332.948) [-336.227] (-333.572) * (-334.515) (-337.650) (-333.028) [-337.148] -- 0:00:30
496000 -- [-332.663] (-332.315) (-336.041) (-332.801) * (-332.825) (-336.840) [-334.120] (-333.449) -- 0:00:30
496500 -- [-333.640] (-335.128) (-333.686) (-333.528) * (-335.442) (-332.878) [-332.785] (-334.659) -- 0:00:30
497000 -- [-335.507] (-339.381) (-334.056) (-334.942) * (-333.499) [-335.233] (-336.516) (-335.515) -- 0:00:30
497500 -- [-333.555] (-347.023) (-337.878) (-332.744) * [-334.118] (-333.227) (-336.768) (-332.930) -- 0:00:30
498000 -- (-333.836) (-333.041) [-333.588] (-334.216) * (-333.524) (-333.336) (-334.365) [-334.374] -- 0:00:30
498500 -- (-333.504) [-334.813] (-335.669) (-338.909) * (-332.692) [-334.106] (-335.340) (-333.720) -- 0:00:30
499000 -- [-334.401] (-335.130) (-334.937) (-334.141) * (-333.321) [-333.537] (-337.681) (-332.361) -- 0:00:30
499500 -- [-334.338] (-332.878) (-333.481) (-334.370) * (-340.038) [-332.975] (-337.449) (-337.690) -- 0:00:30
500000 -- (-338.374) [-332.121] (-334.476) (-334.543) * (-335.544) [-334.370] (-338.035) (-333.468) -- 0:00:30
Average standard deviation of split frequencies: 0.014418
500500 -- (-337.361) [-332.773] (-332.827) (-336.188) * (-334.395) [-333.599] (-339.205) (-333.795) -- 0:00:29
501000 -- (-337.360) [-336.786] (-333.775) (-337.227) * (-333.345) (-335.453) (-336.678) [-334.160] -- 0:00:29
501500 -- [-334.442] (-333.795) (-335.373) (-334.392) * (-335.299) (-337.269) [-332.250] (-332.637) -- 0:00:29
502000 -- [-335.322] (-333.106) (-336.263) (-334.335) * (-334.670) (-334.667) [-332.234] (-335.237) -- 0:00:29
502500 -- (-335.170) [-333.961] (-339.814) (-333.742) * (-334.391) (-332.532) [-333.222] (-337.513) -- 0:00:29
503000 -- (-333.759) (-334.295) [-336.557] (-333.933) * (-335.583) (-332.791) [-337.439] (-335.704) -- 0:00:29
503500 -- [-334.620] (-336.696) (-334.214) (-335.359) * (-335.377) [-335.202] (-332.567) (-333.687) -- 0:00:29
504000 -- [-335.622] (-335.384) (-332.537) (-334.200) * (-336.968) (-334.259) (-335.055) [-332.727] -- 0:00:29
504500 -- (-333.630) (-335.122) (-333.746) [-333.676] * [-333.726] (-332.811) (-336.082) (-335.134) -- 0:00:29
505000 -- (-333.750) (-332.995) [-334.817] (-334.599) * (-335.736) (-336.617) [-335.057] (-340.730) -- 0:00:29
Average standard deviation of split frequencies: 0.014577
505500 -- (-337.196) (-333.880) [-336.423] (-336.228) * (-332.747) (-334.907) (-336.740) [-333.957] -- 0:00:29
506000 -- [-335.420] (-334.227) (-337.966) (-335.186) * (-332.608) (-333.275) (-333.707) [-334.265] -- 0:00:29
506500 -- (-336.437) (-337.331) [-333.286] (-333.115) * [-335.809] (-337.279) (-335.110) (-334.255) -- 0:00:29
507000 -- [-332.966] (-332.612) (-334.022) (-334.283) * [-335.032] (-333.057) (-332.566) (-340.768) -- 0:00:29
507500 -- (-334.376) (-337.659) [-333.966] (-332.357) * (-333.358) (-334.154) [-333.044] (-334.204) -- 0:00:29
508000 -- (-332.675) (-333.933) [-337.290] (-332.151) * (-333.153) (-335.645) [-336.310] (-332.691) -- 0:00:29
508500 -- (-333.552) [-332.689] (-341.127) (-332.898) * (-338.092) [-333.571] (-334.713) (-334.675) -- 0:00:28
509000 -- [-336.169] (-334.792) (-337.230) (-333.947) * (-334.426) (-334.231) (-333.542) [-334.324] -- 0:00:28
509500 -- (-333.722) (-334.512) [-333.721] (-333.740) * (-335.089) [-335.665] (-332.592) (-336.372) -- 0:00:28
510000 -- (-334.911) (-332.523) [-333.157] (-333.176) * (-334.881) [-333.955] (-333.613) (-335.790) -- 0:00:28
Average standard deviation of split frequencies: 0.014173
510500 -- (-332.936) (-335.658) [-334.103] (-333.367) * (-332.699) (-335.185) [-333.216] (-336.371) -- 0:00:28
511000 -- (-332.913) [-334.748] (-335.087) (-332.793) * (-338.312) (-335.206) (-335.942) [-336.292] -- 0:00:29
511500 -- [-337.926] (-334.877) (-335.678) (-333.075) * (-333.598) (-334.123) [-333.092] (-333.260) -- 0:00:29
512000 -- (-337.876) [-333.822] (-335.870) (-333.299) * (-334.648) [-336.201] (-334.499) (-333.401) -- 0:00:29
512500 -- [-333.018] (-334.000) (-334.664) (-332.956) * (-332.889) (-333.167) (-336.144) [-332.992] -- 0:00:29
513000 -- (-335.935) (-335.570) [-333.614] (-337.203) * (-333.547) [-335.963] (-336.890) (-336.243) -- 0:00:29
513500 -- (-336.960) [-335.361] (-337.514) (-340.735) * (-334.392) (-333.237) [-336.456] (-334.703) -- 0:00:29
514000 -- (-334.841) (-334.513) (-335.334) [-335.116] * (-333.976) (-334.898) (-332.669) [-334.185] -- 0:00:29
514500 -- (-335.142) [-337.209] (-333.875) (-333.204) * [-332.839] (-339.847) (-333.358) (-334.265) -- 0:00:29
515000 -- (-334.728) [-335.000] (-336.217) (-334.302) * (-332.732) (-336.799) [-334.607] (-333.360) -- 0:00:29
Average standard deviation of split frequencies: 0.013761
515500 -- [-335.047] (-333.627) (-335.543) (-332.532) * (-333.233) (-335.256) (-333.801) [-334.208] -- 0:00:29
516000 -- (-335.736) (-334.837) [-335.868] (-334.919) * (-333.667) (-337.258) (-333.904) [-333.215] -- 0:00:29
516500 -- (-334.488) (-334.017) (-333.918) [-332.661] * [-335.952] (-332.907) (-333.434) (-334.292) -- 0:00:29
517000 -- [-333.990] (-333.228) (-333.129) (-334.062) * (-333.422) [-336.923] (-335.281) (-334.832) -- 0:00:28
517500 -- [-333.445] (-332.658) (-332.787) (-334.033) * [-335.088] (-338.386) (-333.319) (-336.428) -- 0:00:28
518000 -- [-332.257] (-333.623) (-334.719) (-334.685) * [-337.243] (-335.209) (-332.517) (-333.099) -- 0:00:28
518500 -- [-335.405] (-337.126) (-336.027) (-333.263) * (-337.606) (-333.355) [-333.712] (-335.475) -- 0:00:28
519000 -- [-334.509] (-336.891) (-337.581) (-332.562) * (-332.998) (-335.444) [-332.794] (-332.871) -- 0:00:28
519500 -- (-332.850) (-336.488) [-333.231] (-333.913) * (-336.578) (-334.451) [-332.665] (-333.002) -- 0:00:28
520000 -- (-332.787) (-337.272) (-334.058) [-332.754] * [-336.720] (-334.682) (-334.431) (-333.866) -- 0:00:28
Average standard deviation of split frequencies: 0.014090
520500 -- (-336.075) [-334.295] (-333.392) (-333.568) * [-337.259] (-332.870) (-335.469) (-335.288) -- 0:00:28
521000 -- (-333.538) (-333.506) (-334.508) [-335.412] * (-334.053) [-337.376] (-335.485) (-334.428) -- 0:00:28
521500 -- (-335.125) (-333.862) (-336.350) [-333.557] * (-333.537) (-332.783) (-335.712) [-335.495] -- 0:00:28
522000 -- [-334.293] (-338.909) (-335.639) (-333.780) * (-335.616) (-333.720) (-334.357) [-335.073] -- 0:00:28
522500 -- (-334.337) (-335.229) [-332.814] (-333.317) * [-335.314] (-333.652) (-334.983) (-336.091) -- 0:00:28
523000 -- [-334.857] (-332.946) (-335.097) (-336.744) * [-333.359] (-333.814) (-336.757) (-335.041) -- 0:00:28
523500 -- (-332.628) (-334.196) (-339.326) [-333.315] * (-332.708) (-336.056) (-335.938) [-332.475] -- 0:00:28
524000 -- (-333.699) (-333.858) [-334.359] (-334.952) * (-335.130) (-334.432) (-334.038) [-333.772] -- 0:00:28
524500 -- (-335.768) (-334.826) (-334.984) [-333.137] * (-336.202) (-338.742) [-335.392] (-333.088) -- 0:00:28
525000 -- (-337.423) (-334.081) [-332.680] (-333.673) * (-336.953) (-333.419) [-333.947] (-334.240) -- 0:00:28
Average standard deviation of split frequencies: 0.014234
525500 -- (-335.280) (-334.981) (-332.612) [-333.425] * (-335.734) (-337.403) (-334.838) [-333.774] -- 0:00:27
526000 -- (-333.452) (-335.280) (-333.441) [-335.235] * (-335.730) [-333.301] (-332.720) (-338.088) -- 0:00:27
526500 -- (-334.341) [-333.075] (-333.078) (-335.291) * (-338.238) [-340.514] (-333.769) (-332.959) -- 0:00:27
527000 -- (-333.629) (-334.211) [-335.680] (-334.002) * (-334.440) (-332.776) [-332.928] (-334.633) -- 0:00:27
527500 -- [-332.850] (-333.924) (-333.521) (-335.488) * [-332.798] (-333.097) (-334.822) (-336.055) -- 0:00:27
528000 -- (-334.785) [-336.709] (-337.788) (-332.976) * (-332.999) (-333.635) [-333.939] (-337.914) -- 0:00:28
528500 -- (-336.218) [-332.400] (-342.095) (-334.274) * (-333.714) (-332.234) [-332.868] (-333.905) -- 0:00:28
529000 -- [-334.437] (-334.932) (-339.359) (-336.496) * (-334.365) (-336.721) [-333.625] (-335.996) -- 0:00:28
529500 -- [-335.223] (-335.652) (-335.139) (-336.567) * (-332.823) (-335.664) (-333.388) [-337.635] -- 0:00:28
530000 -- (-332.709) (-335.664) (-339.420) [-335.763] * (-338.509) (-335.158) (-333.103) [-333.696] -- 0:00:28
Average standard deviation of split frequencies: 0.014265
530500 -- (-334.297) (-335.592) (-337.703) [-334.764] * (-337.664) [-336.077] (-333.468) (-333.613) -- 0:00:28
531000 -- (-333.303) (-335.472) (-335.859) [-334.681] * (-337.147) [-333.123] (-332.393) (-333.989) -- 0:00:28
531500 -- [-333.776] (-336.205) (-336.728) (-344.229) * (-336.039) [-332.790] (-332.758) (-335.602) -- 0:00:28
532000 -- (-335.898) [-333.452] (-334.463) (-340.480) * (-333.844) (-334.114) [-334.353] (-333.699) -- 0:00:28
532500 -- (-333.831) [-333.379] (-335.077) (-334.454) * [-334.116] (-334.824) (-338.131) (-338.637) -- 0:00:28
533000 -- (-336.737) (-333.926) (-335.187) [-336.985] * (-336.304) (-333.736) (-334.151) [-337.057] -- 0:00:28
533500 -- (-334.827) (-333.753) [-333.075] (-336.576) * (-333.109) (-332.475) (-334.672) [-333.805] -- 0:00:27
534000 -- [-335.875] (-338.962) (-334.789) (-334.823) * (-336.299) (-335.490) [-332.360] (-335.395) -- 0:00:27
534500 -- (-335.435) (-334.214) [-334.658] (-345.826) * (-333.907) (-333.745) [-333.032] (-332.857) -- 0:00:27
535000 -- (-335.657) (-335.074) (-333.543) [-333.968] * (-335.234) (-333.177) (-332.498) [-333.828] -- 0:00:27
Average standard deviation of split frequencies: 0.014848
535500 -- (-336.634) (-334.639) [-332.609] (-332.910) * (-336.615) [-333.221] (-333.941) (-335.065) -- 0:00:27
536000 -- (-334.742) [-334.632] (-333.891) (-334.101) * (-334.521) (-334.073) (-332.674) [-335.558] -- 0:00:27
536500 -- (-333.122) (-333.639) (-333.078) [-334.534] * (-334.224) [-333.269] (-332.793) (-337.145) -- 0:00:27
537000 -- (-334.004) [-332.223] (-334.614) (-336.645) * (-333.393) (-334.413) [-334.473] (-332.297) -- 0:00:27
537500 -- (-342.830) (-334.821) [-334.704] (-335.195) * (-333.201) [-333.742] (-334.936) (-336.675) -- 0:00:27
538000 -- (-334.659) (-332.723) [-332.049] (-335.599) * [-337.446] (-335.434) (-335.635) (-334.913) -- 0:00:27
538500 -- (-335.092) (-334.178) (-335.301) [-337.603] * [-334.326] (-337.698) (-335.292) (-334.170) -- 0:00:27
539000 -- [-335.865] (-336.817) (-333.545) (-335.214) * (-333.714) [-337.936] (-332.685) (-334.503) -- 0:00:27
539500 -- (-334.252) (-332.415) [-334.268] (-337.962) * [-334.754] (-339.136) (-333.838) (-337.726) -- 0:00:27
540000 -- (-333.500) (-334.583) [-332.073] (-338.690) * (-332.780) [-338.210] (-333.264) (-333.732) -- 0:00:27
Average standard deviation of split frequencies: 0.013232
540500 -- [-333.469] (-334.563) (-335.725) (-335.460) * (-336.361) [-336.592] (-335.671) (-333.128) -- 0:00:27
541000 -- (-334.241) [-333.715] (-335.420) (-336.495) * (-334.028) (-336.576) (-336.313) [-333.772] -- 0:00:27
541500 -- (-337.175) (-334.500) (-335.365) [-334.473] * (-334.536) (-334.199) (-333.533) [-333.457] -- 0:00:27
542000 -- (-336.649) (-333.834) [-334.860] (-333.793) * [-333.860] (-333.515) (-335.897) (-336.173) -- 0:00:27
542500 -- (-339.085) [-333.058] (-339.911) (-332.613) * (-333.628) [-332.817] (-335.699) (-336.726) -- 0:00:26
543000 -- (-333.131) [-334.032] (-335.723) (-335.309) * (-334.890) [-334.020] (-336.849) (-336.377) -- 0:00:26
543500 -- (-334.163) [-332.632] (-332.212) (-332.643) * [-332.681] (-333.123) (-335.632) (-334.294) -- 0:00:26
544000 -- (-334.809) (-332.239) (-335.809) [-334.296] * [-333.902] (-332.477) (-334.976) (-335.769) -- 0:00:26
544500 -- (-335.888) (-333.167) [-333.858] (-335.885) * (-334.010) (-336.771) (-333.568) [-337.390] -- 0:00:26
545000 -- (-333.952) (-334.012) [-334.150] (-335.502) * (-333.396) [-337.687] (-336.519) (-338.483) -- 0:00:26
Average standard deviation of split frequencies: 0.012544
545500 -- (-336.947) (-332.953) (-335.285) [-332.866] * (-333.059) [-336.889] (-335.714) (-334.658) -- 0:00:27
546000 -- (-334.554) (-338.875) (-333.709) [-333.385] * (-334.946) (-334.798) (-333.203) [-332.642] -- 0:00:27
546500 -- [-336.241] (-336.930) (-332.989) (-335.433) * (-335.249) [-333.650] (-333.819) (-332.414) -- 0:00:27
547000 -- (-338.695) (-334.537) (-332.912) [-333.169] * (-333.432) [-332.853] (-332.636) (-333.412) -- 0:00:27
547500 -- [-336.335] (-334.013) (-333.116) (-336.645) * (-333.991) (-336.452) (-333.264) [-333.100] -- 0:00:27
548000 -- (-335.632) [-332.861] (-333.159) (-335.088) * (-333.486) [-335.238] (-334.811) (-333.566) -- 0:00:27
548500 -- (-333.161) (-332.492) (-334.843) [-333.447] * (-334.927) (-334.590) (-334.717) [-332.911] -- 0:00:27
549000 -- (-336.795) [-332.187] (-333.177) (-334.153) * (-334.475) (-334.439) (-334.896) [-332.123] -- 0:00:27
549500 -- (-335.054) [-335.864] (-335.154) (-333.018) * [-334.938] (-334.048) (-339.078) (-337.859) -- 0:00:27
550000 -- [-337.479] (-336.031) (-333.932) (-337.148) * [-333.841] (-337.102) (-334.266) (-336.685) -- 0:00:27
Average standard deviation of split frequencies: 0.012186
550500 -- (-334.406) [-332.534] (-334.138) (-335.062) * (-333.643) (-339.833) (-334.303) [-335.992] -- 0:00:26
551000 -- (-333.922) [-333.475] (-333.563) (-332.912) * (-334.671) [-334.770] (-334.023) (-337.880) -- 0:00:26
551500 -- (-333.526) [-334.311] (-334.727) (-335.553) * (-335.610) [-336.222] (-335.222) (-334.070) -- 0:00:26
552000 -- (-335.262) (-336.098) [-332.898] (-335.320) * (-333.674) (-334.583) (-336.287) [-332.876] -- 0:00:26
552500 -- (-337.060) (-334.731) (-333.500) [-335.803] * (-332.711) (-332.589) [-334.897] (-337.199) -- 0:00:26
553000 -- (-336.038) (-335.626) [-332.559] (-337.860) * (-337.253) (-332.784) (-338.107) [-335.671] -- 0:00:26
553500 -- (-336.315) (-335.035) (-332.674) [-334.128] * (-339.367) (-348.159) (-339.429) [-333.752] -- 0:00:26
554000 -- (-336.464) [-334.839] (-335.354) (-333.953) * (-335.521) (-335.290) (-333.719) [-336.238] -- 0:00:26
554500 -- (-333.571) [-337.771] (-335.777) (-333.680) * [-335.626] (-335.533) (-334.571) (-335.619) -- 0:00:26
555000 -- (-336.888) (-335.018) (-336.523) [-334.215] * [-337.238] (-334.293) (-338.867) (-335.312) -- 0:00:26
Average standard deviation of split frequencies: 0.012518
555500 -- (-335.059) [-336.772] (-336.159) (-335.836) * [-333.194] (-341.134) (-336.809) (-333.910) -- 0:00:26
556000 -- (-334.193) (-336.252) [-336.942] (-335.348) * [-334.499] (-333.840) (-333.289) (-334.969) -- 0:00:26
556500 -- (-333.891) (-333.654) (-334.245) [-334.766] * (-338.429) (-335.311) (-338.911) [-334.750] -- 0:00:26
557000 -- [-333.917] (-334.327) (-334.292) (-332.903) * (-335.466) (-337.179) (-341.161) [-336.169] -- 0:00:26
557500 -- [-336.076] (-334.057) (-336.369) (-332.199) * (-335.122) [-332.471] (-343.799) (-333.421) -- 0:00:26
558000 -- (-333.987) (-334.532) [-335.828] (-333.805) * [-334.332] (-333.253) (-335.512) (-333.003) -- 0:00:26
558500 -- [-335.120] (-336.752) (-334.276) (-335.751) * (-334.180) (-336.997) (-333.874) [-335.183] -- 0:00:26
559000 -- (-336.075) (-336.775) (-340.390) [-333.480] * (-334.045) (-333.404) (-332.794) [-334.931] -- 0:00:26
559500 -- (-334.117) (-335.343) (-332.770) [-335.159] * (-332.961) (-333.947) (-334.794) [-333.612] -- 0:00:25
560000 -- (-334.061) (-334.867) [-333.710] (-334.089) * [-333.565] (-332.752) (-333.342) (-333.392) -- 0:00:25
Average standard deviation of split frequencies: 0.012167
560500 -- [-333.685] (-333.934) (-333.550) (-333.092) * (-336.274) (-334.846) [-333.279] (-332.811) -- 0:00:25
561000 -- (-333.820) (-333.384) [-332.433] (-333.900) * (-336.515) (-333.961) (-332.181) [-332.707] -- 0:00:25
561500 -- (-336.625) (-334.705) [-334.524] (-334.320) * (-335.945) [-333.139] (-336.393) (-332.384) -- 0:00:25
562000 -- (-336.787) (-336.425) (-334.031) [-334.884] * [-337.987] (-333.230) (-334.261) (-332.731) -- 0:00:25
562500 -- (-334.675) (-335.225) (-334.990) [-333.171] * (-335.502) [-332.959] (-334.999) (-335.963) -- 0:00:26
563000 -- (-335.804) (-334.875) (-335.114) [-336.100] * (-337.050) (-333.137) (-338.354) [-336.503] -- 0:00:26
563500 -- [-335.806] (-332.898) (-333.466) (-334.906) * (-334.670) (-332.563) (-334.926) [-332.863] -- 0:00:26
564000 -- (-332.228) (-334.194) [-332.421] (-337.782) * (-335.045) [-332.836] (-334.564) (-336.855) -- 0:00:26
564500 -- (-333.264) [-335.115] (-333.840) (-336.556) * (-333.682) [-334.294] (-333.905) (-334.754) -- 0:00:26
565000 -- (-333.885) [-334.586] (-334.313) (-336.593) * [-333.598] (-333.280) (-333.892) (-334.984) -- 0:00:26
Average standard deviation of split frequencies: 0.012123
565500 -- (-333.987) (-334.134) (-333.577) [-335.890] * [-333.457] (-334.873) (-334.144) (-333.790) -- 0:00:26
566000 -- (-335.691) [-334.539] (-333.444) (-333.584) * (-333.425) [-332.916] (-333.583) (-335.879) -- 0:00:26
566500 -- (-333.636) (-336.156) (-334.536) [-333.895] * (-333.800) [-337.960] (-333.416) (-332.559) -- 0:00:26
567000 -- (-334.763) (-337.183) [-332.352] (-333.684) * (-334.106) (-336.241) (-334.586) [-334.842] -- 0:00:25
567500 -- (-333.678) [-333.086] (-334.806) (-332.953) * [-338.017] (-336.568) (-335.277) (-337.604) -- 0:00:25
568000 -- (-333.793) (-332.643) [-335.110] (-333.157) * [-333.741] (-334.224) (-334.931) (-335.502) -- 0:00:25
568500 -- (-334.782) (-335.369) (-335.897) [-334.054] * [-334.746] (-333.598) (-333.777) (-334.937) -- 0:00:25
569000 -- (-338.030) (-335.170) [-333.818] (-332.906) * (-337.483) (-335.034) [-334.806] (-337.762) -- 0:00:25
569500 -- (-337.136) (-334.196) (-337.439) [-335.076] * (-335.253) (-332.597) (-333.574) [-334.138] -- 0:00:25
570000 -- (-337.418) [-334.324] (-335.920) (-333.509) * (-339.994) [-335.686] (-334.024) (-334.515) -- 0:00:25
Average standard deviation of split frequencies: 0.011703
570500 -- (-333.628) (-337.518) (-334.934) [-337.038] * (-337.707) [-332.952] (-333.005) (-335.031) -- 0:00:25
571000 -- (-333.781) [-336.034] (-334.542) (-335.097) * (-334.975) (-333.098) (-333.925) [-332.979] -- 0:00:25
571500 -- (-333.690) (-334.776) [-333.505] (-334.816) * (-334.497) (-333.340) (-336.485) [-333.436] -- 0:00:25
572000 -- [-333.165] (-336.771) (-332.417) (-336.961) * [-334.147] (-333.449) (-335.906) (-332.612) -- 0:00:25
572500 -- (-333.539) (-334.625) (-332.555) [-333.287] * [-336.109] (-332.919) (-334.134) (-332.626) -- 0:00:25
573000 -- [-332.901] (-335.524) (-335.668) (-334.157) * (-335.408) (-333.813) (-334.832) [-332.342] -- 0:00:25
573500 -- (-334.867) [-332.999] (-337.125) (-333.884) * (-335.106) (-333.936) (-335.727) [-332.275] -- 0:00:25
574000 -- (-333.708) (-333.023) (-336.863) [-335.872] * (-333.256) (-333.367) (-333.784) [-332.512] -- 0:00:25
574500 -- (-333.189) (-333.708) [-335.492] (-334.657) * (-333.472) (-333.647) (-333.569) [-337.953] -- 0:00:25
575000 -- (-333.111) [-333.863] (-333.428) (-335.944) * (-337.563) [-332.920] (-334.597) (-334.090) -- 0:00:25
Average standard deviation of split frequencies: 0.011503
575500 -- (-336.761) (-333.071) (-334.231) [-333.914] * (-334.172) (-334.332) [-333.364] (-332.722) -- 0:00:25
576000 -- (-334.610) [-332.522] (-333.396) (-332.866) * (-332.586) (-336.191) (-337.302) [-333.518] -- 0:00:25
576500 -- (-333.421) [-333.251] (-335.655) (-333.116) * [-334.391] (-332.968) (-334.560) (-333.503) -- 0:00:24
577000 -- (-334.049) (-335.015) [-332.776] (-332.847) * (-335.530) (-335.625) [-336.593] (-334.265) -- 0:00:24
577500 -- (-335.904) (-335.824) (-333.751) [-333.193] * (-333.945) (-334.622) [-334.722] (-334.253) -- 0:00:24
578000 -- (-332.770) [-334.594] (-333.454) (-336.247) * (-335.426) [-333.693] (-334.569) (-334.046) -- 0:00:24
578500 -- (-336.459) (-334.722) [-339.343] (-335.504) * [-338.204] (-334.396) (-336.601) (-335.128) -- 0:00:24
579000 -- (-334.329) (-334.799) (-335.768) [-336.077] * (-336.541) (-334.270) (-334.682) [-333.087] -- 0:00:25
579500 -- (-333.858) [-332.625] (-334.375) (-336.700) * (-338.952) (-333.501) [-334.565] (-338.936) -- 0:00:25
580000 -- (-332.467) [-333.888] (-336.128) (-334.259) * [-333.580] (-332.534) (-334.846) (-334.649) -- 0:00:25
Average standard deviation of split frequencies: 0.011986
580500 -- (-335.124) (-332.629) (-333.960) [-333.983] * (-333.828) (-334.450) [-334.967] (-335.282) -- 0:00:25
581000 -- [-336.867] (-335.993) (-333.749) (-335.342) * (-332.745) (-337.552) (-333.930) [-332.997] -- 0:00:25
581500 -- (-337.917) (-336.161) [-332.999] (-336.271) * (-332.715) (-332.786) (-332.403) [-338.323] -- 0:00:25
582000 -- (-336.237) (-337.889) [-334.293] (-338.583) * (-333.672) (-334.576) [-334.446] (-338.783) -- 0:00:25
582500 -- (-336.271) (-334.123) [-333.602] (-334.251) * (-334.805) (-333.744) (-335.598) [-337.481] -- 0:00:25
583000 -- (-344.288) [-333.627] (-333.432) (-334.900) * (-338.832) (-334.231) (-337.449) [-333.593] -- 0:00:25
583500 -- [-333.418] (-333.085) (-332.695) (-334.087) * (-334.558) (-334.552) (-336.108) [-334.724] -- 0:00:24
584000 -- [-337.210] (-333.332) (-334.173) (-334.577) * [-334.033] (-336.308) (-333.850) (-332.978) -- 0:00:24
584500 -- [-334.558] (-332.767) (-335.529) (-332.686) * (-334.703) [-334.205] (-335.870) (-334.043) -- 0:00:24
585000 -- (-332.757) (-334.780) (-337.206) [-332.280] * (-334.923) (-335.732) (-336.917) [-334.935] -- 0:00:24
Average standard deviation of split frequencies: 0.011262
585500 -- [-332.897] (-333.355) (-334.457) (-334.505) * (-335.341) (-335.090) (-333.016) [-335.573] -- 0:00:24
586000 -- (-335.140) (-332.760) [-333.951] (-334.560) * [-337.926] (-338.698) (-346.009) (-336.037) -- 0:00:24
586500 -- [-334.219] (-332.541) (-332.535) (-335.108) * [-333.351] (-335.288) (-333.867) (-336.626) -- 0:00:24
587000 -- [-334.151] (-338.314) (-333.424) (-338.404) * [-335.056] (-336.373) (-333.430) (-332.206) -- 0:00:24
587500 -- (-333.488) (-333.876) (-334.367) [-332.820] * (-333.319) (-335.437) (-333.576) [-334.297] -- 0:00:24
588000 -- (-333.621) (-332.334) (-337.527) [-336.058] * [-334.706] (-332.973) (-332.504) (-337.931) -- 0:00:24
588500 -- (-335.349) (-336.271) (-339.050) [-334.359] * (-335.973) [-333.661] (-332.612) (-334.840) -- 0:00:24
589000 -- [-335.209] (-336.068) (-336.165) (-335.020) * [-334.546] (-333.824) (-334.719) (-339.194) -- 0:00:24
589500 -- [-332.996] (-335.676) (-333.301) (-335.221) * [-336.666] (-343.656) (-333.467) (-335.030) -- 0:00:24
590000 -- [-335.198] (-333.229) (-334.743) (-335.539) * (-337.463) (-334.677) [-336.553] (-333.583) -- 0:00:24
Average standard deviation of split frequencies: 0.010819
590500 -- [-333.569] (-334.267) (-334.606) (-334.517) * (-335.394) [-335.800] (-332.908) (-334.464) -- 0:00:24
591000 -- (-333.132) [-336.241] (-335.622) (-332.693) * [-334.040] (-336.141) (-333.577) (-333.466) -- 0:00:24
591500 -- [-336.485] (-340.049) (-335.358) (-332.652) * (-335.774) (-342.899) (-333.653) [-335.137] -- 0:00:24
592000 -- (-332.986) [-333.585] (-334.504) (-333.689) * [-336.513] (-334.200) (-334.594) (-338.033) -- 0:00:24
592500 -- (-334.096) [-334.780] (-333.101) (-332.833) * [-335.971] (-339.612) (-337.250) (-333.693) -- 0:00:24
593000 -- (-333.725) (-340.180) [-334.503] (-333.428) * (-332.443) [-333.621] (-334.862) (-335.499) -- 0:00:24
593500 -- (-334.310) (-335.649) (-334.506) [-333.822] * [-336.508] (-342.500) (-333.642) (-336.232) -- 0:00:23
594000 -- [-336.504] (-334.762) (-336.000) (-333.280) * (-335.170) [-335.084] (-334.582) (-337.341) -- 0:00:23
594500 -- (-332.953) (-334.513) (-334.537) [-333.519] * (-336.051) [-338.476] (-333.734) (-334.427) -- 0:00:23
595000 -- (-333.467) [-333.942] (-332.654) (-332.568) * [-333.904] (-338.437) (-333.445) (-334.722) -- 0:00:23
Average standard deviation of split frequencies: 0.011073
595500 -- (-334.819) (-335.592) [-332.858] (-333.754) * [-335.251] (-333.646) (-332.330) (-332.709) -- 0:00:23
596000 -- (-335.277) (-335.836) (-338.987) [-333.319] * (-334.497) (-333.627) (-337.151) [-334.889] -- 0:00:24
596500 -- [-335.521] (-335.906) (-333.241) (-335.252) * (-335.192) (-334.477) (-337.593) [-335.063] -- 0:00:24
597000 -- (-334.666) (-336.288) (-335.287) [-335.694] * (-334.493) (-338.736) (-337.886) [-332.791] -- 0:00:24
597500 -- (-333.280) (-333.082) [-333.940] (-338.511) * (-336.249) [-332.816] (-335.563) (-332.814) -- 0:00:24
598000 -- (-333.104) (-333.580) [-333.664] (-332.399) * (-335.195) (-332.816) [-334.727] (-332.551) -- 0:00:24
598500 -- [-332.947] (-335.167) (-333.166) (-334.534) * (-333.772) (-333.270) [-336.127] (-336.213) -- 0:00:24
599000 -- [-335.158] (-332.632) (-333.403) (-334.880) * [-333.610] (-334.673) (-337.351) (-335.688) -- 0:00:24
599500 -- [-336.470] (-335.108) (-334.434) (-335.186) * [-333.981] (-337.042) (-334.283) (-336.141) -- 0:00:24
600000 -- [-333.271] (-338.898) (-333.377) (-333.993) * [-337.565] (-334.210) (-332.580) (-337.067) -- 0:00:24
Average standard deviation of split frequencies: 0.010756
600500 -- [-336.556] (-335.665) (-334.060) (-334.561) * (-336.808) [-335.604] (-333.658) (-336.663) -- 0:00:23
601000 -- [-338.780] (-333.767) (-336.936) (-334.628) * (-339.929) (-332.460) [-332.652] (-333.208) -- 0:00:23
601500 -- (-337.225) (-340.935) (-332.882) [-334.057] * (-335.153) (-334.851) (-332.998) [-332.424] -- 0:00:23
602000 -- [-334.417] (-334.225) (-334.051) (-334.953) * (-333.029) (-336.882) (-332.424) [-334.462] -- 0:00:23
602500 -- (-334.938) (-336.354) [-333.522] (-333.725) * (-334.177) (-333.227) (-332.775) [-334.116] -- 0:00:23
603000 -- (-334.784) [-338.359] (-333.469) (-336.454) * (-333.594) (-333.502) (-333.251) [-333.077] -- 0:00:23
603500 -- [-332.944] (-334.305) (-336.377) (-335.364) * (-333.836) (-333.541) (-337.917) [-334.765] -- 0:00:23
604000 -- [-334.870] (-333.849) (-335.116) (-334.538) * (-335.129) (-341.736) (-334.772) [-332.411] -- 0:00:23
604500 -- (-333.741) (-336.869) [-338.261] (-335.639) * (-333.603) [-334.902] (-336.415) (-333.036) -- 0:00:23
605000 -- (-333.176) (-335.104) (-334.214) [-333.927] * (-335.025) (-335.935) (-335.127) [-340.423] -- 0:00:23
Average standard deviation of split frequencies: 0.011063
605500 -- [-335.655] (-336.228) (-339.915) (-333.590) * (-334.576) [-337.882] (-335.679) (-339.286) -- 0:00:23
606000 -- (-333.842) (-339.015) [-332.804] (-332.891) * (-335.538) (-335.139) [-333.505] (-337.687) -- 0:00:23
606500 -- (-337.497) (-335.362) (-335.383) [-333.396] * [-335.775] (-335.460) (-335.058) (-333.050) -- 0:00:23
607000 -- (-336.755) (-333.107) (-333.876) [-336.011] * (-335.554) [-333.023] (-332.848) (-332.514) -- 0:00:23
607500 -- (-336.825) (-340.737) [-333.301] (-334.362) * (-334.116) (-333.357) [-333.945] (-337.542) -- 0:00:23
608000 -- (-337.350) (-335.137) [-334.420] (-333.118) * (-334.390) (-332.871) [-334.165] (-336.106) -- 0:00:23
608500 -- (-337.232) (-333.218) [-334.094] (-333.568) * (-333.840) (-333.232) [-332.995] (-339.027) -- 0:00:23
609000 -- (-332.449) [-334.254] (-332.882) (-332.918) * (-336.023) (-332.648) (-334.976) [-341.754] -- 0:00:23
609500 -- (-332.963) (-337.393) [-332.982] (-334.726) * (-333.811) (-335.311) (-335.780) [-338.631] -- 0:00:23
610000 -- (-335.791) [-336.502] (-332.550) (-333.387) * (-335.820) (-334.386) [-334.233] (-334.656) -- 0:00:23
Average standard deviation of split frequencies: 0.011279
610500 -- (-334.544) [-334.480] (-334.593) (-335.018) * [-334.680] (-333.670) (-336.530) (-334.597) -- 0:00:22
611000 -- (-332.689) (-332.296) [-332.900] (-334.040) * (-332.600) [-333.177] (-334.485) (-333.678) -- 0:00:22
611500 -- (-334.721) [-334.904] (-334.951) (-333.192) * (-333.058) (-333.783) [-333.554] (-336.729) -- 0:00:22
612000 -- [-337.296] (-332.834) (-337.930) (-332.764) * (-334.984) (-335.789) (-334.461) [-336.251] -- 0:00:22
612500 -- [-332.484] (-332.570) (-335.922) (-335.523) * (-334.650) (-336.244) [-333.619] (-333.399) -- 0:00:22
613000 -- [-336.113] (-333.653) (-338.117) (-335.646) * (-337.875) (-335.588) (-335.188) [-333.177] -- 0:00:23
613500 -- (-333.906) (-338.759) (-334.744) [-337.163] * [-333.283] (-335.676) (-335.752) (-335.667) -- 0:00:23
614000 -- (-336.190) [-332.968] (-334.722) (-341.745) * (-333.896) (-336.087) [-335.931] (-333.304) -- 0:00:23
614500 -- (-334.541) (-338.700) [-333.444] (-342.744) * (-336.126) [-333.850] (-339.449) (-333.545) -- 0:00:23
615000 -- (-332.874) (-334.391) (-334.312) [-338.023] * (-334.085) [-332.735] (-334.995) (-332.826) -- 0:00:23
Average standard deviation of split frequencies: 0.010714
615500 -- (-340.210) [-333.727] (-332.766) (-334.203) * (-336.537) [-333.422] (-339.408) (-336.250) -- 0:00:23
616000 -- (-334.926) [-335.446] (-333.996) (-333.725) * (-344.261) [-336.430] (-339.515) (-334.491) -- 0:00:23
616500 -- (-335.937) [-334.357] (-336.135) (-333.756) * [-336.820] (-333.318) (-333.414) (-332.933) -- 0:00:23
617000 -- (-338.472) (-335.061) [-333.808] (-338.873) * (-338.404) (-333.858) [-333.174] (-333.063) -- 0:00:22
617500 -- (-339.473) (-334.785) [-333.707] (-338.716) * (-335.302) (-334.799) [-333.257] (-333.358) -- 0:00:22
618000 -- (-332.584) [-336.677] (-335.971) (-336.325) * (-334.019) [-334.625] (-339.687) (-335.187) -- 0:00:22
618500 -- (-337.076) (-337.866) (-334.678) [-333.324] * [-333.187] (-336.543) (-340.831) (-335.152) -- 0:00:22
619000 -- (-336.126) [-334.194] (-334.883) (-332.487) * (-333.644) (-332.813) [-338.118] (-334.096) -- 0:00:22
619500 -- (-333.843) (-340.476) [-332.201] (-336.461) * [-332.825] (-333.753) (-333.967) (-334.067) -- 0:00:22
620000 -- (-332.833) (-336.232) [-332.975] (-335.258) * [-335.111] (-333.575) (-332.953) (-336.366) -- 0:00:22
Average standard deviation of split frequencies: 0.010886
620500 -- (-333.163) [-339.555] (-333.200) (-333.486) * (-333.674) [-334.101] (-334.451) (-338.405) -- 0:00:22
621000 -- (-334.573) [-334.080] (-336.890) (-334.173) * (-336.220) (-333.449) [-335.896] (-334.348) -- 0:00:22
621500 -- [-333.956] (-334.338) (-334.143) (-334.514) * (-336.184) [-333.558] (-334.830) (-335.525) -- 0:00:22
622000 -- (-334.608) (-334.546) [-333.814] (-337.576) * (-335.218) (-338.235) [-334.074] (-333.831) -- 0:00:22
622500 -- (-335.953) (-334.305) (-336.193) [-334.794] * (-332.977) (-334.653) (-334.858) [-334.218] -- 0:00:22
623000 -- (-334.778) [-336.664] (-335.586) (-335.070) * [-336.185] (-339.040) (-335.725) (-333.950) -- 0:00:22
623500 -- (-333.316) (-333.953) (-333.206) [-334.696] * [-337.024] (-339.224) (-333.815) (-336.676) -- 0:00:22
624000 -- (-332.327) (-333.617) (-333.152) [-334.485] * (-335.888) (-338.971) [-336.139] (-334.254) -- 0:00:22
624500 -- [-334.609] (-334.106) (-336.084) (-335.815) * (-333.799) (-338.889) (-343.334) [-332.794] -- 0:00:22
625000 -- (-334.511) (-332.154) (-337.188) [-332.237] * [-334.788] (-336.201) (-332.778) (-333.650) -- 0:00:22
Average standard deviation of split frequencies: 0.010543
625500 -- (-334.103) (-332.797) (-334.700) [-333.160] * (-333.400) (-334.823) (-334.927) [-332.973] -- 0:00:22
626000 -- (-334.846) [-334.846] (-335.300) (-333.844) * (-332.892) [-333.857] (-333.476) (-334.325) -- 0:00:22
626500 -- (-333.988) (-334.068) [-335.392] (-334.096) * (-332.946) (-336.567) [-333.762] (-334.416) -- 0:00:22
627000 -- (-333.656) (-334.696) (-337.256) [-335.443] * [-335.666] (-334.256) (-336.436) (-333.192) -- 0:00:22
627500 -- (-335.798) (-332.166) [-333.874] (-334.147) * (-334.402) (-334.132) [-332.415] (-332.491) -- 0:00:21
628000 -- (-332.333) [-334.021] (-334.579) (-333.572) * (-334.201) (-333.690) [-334.334] (-333.699) -- 0:00:21
628500 -- (-333.176) (-337.565) (-334.813) [-333.199] * (-335.831) (-335.616) (-335.670) [-335.051] -- 0:00:21
629000 -- (-333.144) (-337.328) [-334.155] (-332.845) * [-337.673] (-333.050) (-336.407) (-335.186) -- 0:00:21
629500 -- (-334.501) [-334.042] (-332.528) (-333.861) * (-334.398) [-335.284] (-334.770) (-332.362) -- 0:00:21
630000 -- (-333.914) (-334.022) [-333.237] (-336.932) * [-332.842] (-335.580) (-333.274) (-334.587) -- 0:00:21
Average standard deviation of split frequencies: 0.010797
630500 -- [-333.546] (-333.273) (-334.868) (-333.572) * (-332.368) [-332.488] (-333.188) (-332.498) -- 0:00:22
631000 -- (-332.882) (-335.078) [-334.974] (-332.486) * [-334.224] (-337.947) (-336.306) (-334.112) -- 0:00:22
631500 -- [-333.393] (-337.840) (-334.491) (-334.181) * [-334.703] (-338.315) (-336.517) (-337.978) -- 0:00:22
632000 -- [-332.445] (-337.178) (-335.320) (-335.292) * [-335.785] (-333.335) (-335.828) (-333.988) -- 0:00:22
632500 -- (-334.319) (-333.198) [-334.184] (-336.219) * (-341.088) (-333.859) [-333.905] (-335.196) -- 0:00:22
633000 -- (-338.074) (-335.034) [-333.977] (-334.268) * [-335.268] (-335.195) (-332.640) (-334.224) -- 0:00:22
633500 -- (-334.254) [-334.723] (-332.570) (-333.833) * [-336.005] (-337.021) (-332.643) (-333.528) -- 0:00:21
634000 -- (-334.524) (-334.808) [-333.234] (-333.532) * (-333.130) (-337.254) (-334.194) [-333.338] -- 0:00:21
634500 -- (-334.143) (-332.916) [-334.139] (-338.945) * (-338.679) (-336.814) (-334.051) [-334.159] -- 0:00:21
635000 -- [-333.644] (-334.154) (-334.027) (-333.624) * (-335.372) (-335.272) [-337.412] (-336.968) -- 0:00:21
Average standard deviation of split frequencies: 0.010726
635500 -- [-333.401] (-334.032) (-338.536) (-334.470) * [-333.578] (-334.900) (-333.526) (-336.679) -- 0:00:21
636000 -- (-336.334) (-333.866) [-337.593] (-335.550) * [-334.358] (-334.429) (-337.100) (-335.588) -- 0:00:21
636500 -- [-334.030] (-333.469) (-335.294) (-335.391) * [-332.494] (-332.167) (-337.343) (-333.887) -- 0:00:21
637000 -- (-339.748) (-336.321) [-333.183] (-335.965) * [-332.365] (-333.593) (-334.742) (-334.501) -- 0:00:21
637500 -- (-334.726) (-344.113) (-333.777) [-333.072] * (-332.741) [-334.298] (-332.490) (-337.110) -- 0:00:21
638000 -- (-335.511) [-334.312] (-335.399) (-332.730) * [-334.102] (-332.550) (-334.892) (-336.872) -- 0:00:21
638500 -- [-333.256] (-337.360) (-333.835) (-333.276) * (-334.184) (-335.476) (-334.733) [-335.192] -- 0:00:21
639000 -- (-334.997) (-334.214) (-334.506) [-333.805] * (-335.050) (-334.424) (-332.769) [-337.431] -- 0:00:21
639500 -- (-336.301) (-335.533) [-335.640] (-333.095) * [-335.204] (-333.660) (-334.941) (-335.449) -- 0:00:21
640000 -- (-335.011) [-337.628] (-336.320) (-333.822) * [-337.285] (-334.253) (-334.254) (-333.104) -- 0:00:21
Average standard deviation of split frequencies: 0.010691
640500 -- [-332.559] (-333.288) (-336.705) (-337.646) * [-335.995] (-333.391) (-334.100) (-335.962) -- 0:00:21
641000 -- (-334.098) [-332.691] (-335.208) (-334.907) * (-337.421) [-333.376] (-335.011) (-338.188) -- 0:00:21
641500 -- [-333.932] (-333.525) (-332.928) (-334.748) * (-335.821) (-334.907) (-333.077) [-333.727] -- 0:00:21
642000 -- [-332.560] (-333.968) (-332.700) (-334.913) * (-335.217) [-334.960] (-332.986) (-334.767) -- 0:00:21
642500 -- (-332.436) (-336.696) [-334.056] (-334.675) * (-333.331) (-338.003) (-332.636) [-333.791] -- 0:00:21
643000 -- (-336.048) [-333.817] (-332.727) (-335.272) * (-334.875) (-336.506) [-339.226] (-334.731) -- 0:00:21
643500 -- (-337.055) (-337.957) (-334.840) [-332.649] * (-336.248) (-334.500) (-339.605) [-333.166] -- 0:00:21
644000 -- (-334.350) (-339.999) (-334.759) [-333.798] * [-333.045] (-332.642) (-336.040) (-335.039) -- 0:00:21
644500 -- (-334.887) (-334.684) [-333.277] (-335.753) * (-342.763) [-333.539] (-334.670) (-332.230) -- 0:00:20
645000 -- [-333.193] (-336.922) (-333.556) (-336.162) * (-336.253) (-337.268) (-337.410) [-332.539] -- 0:00:20
Average standard deviation of split frequencies: 0.010560
645500 -- (-332.634) (-337.515) (-332.811) [-332.768] * (-333.205) (-333.479) (-334.360) [-333.976] -- 0:00:20
646000 -- [-335.111] (-335.824) (-334.564) (-333.642) * (-335.431) (-338.490) (-337.079) [-332.852] -- 0:00:20
646500 -- (-334.775) [-335.918] (-333.586) (-334.177) * (-340.509) (-342.732) [-332.785] (-340.972) -- 0:00:20
647000 -- (-333.455) [-336.521] (-333.758) (-337.549) * (-335.723) (-335.824) (-336.362) [-333.591] -- 0:00:21
647500 -- (-334.330) [-334.520] (-335.231) (-340.880) * [-334.063] (-334.049) (-334.147) (-333.565) -- 0:00:21
648000 -- [-335.408] (-332.533) (-333.967) (-342.452) * [-333.078] (-332.189) (-336.201) (-338.416) -- 0:00:21
648500 -- (-333.560) [-334.925] (-333.464) (-340.664) * [-334.536] (-335.408) (-335.329) (-334.946) -- 0:00:21
649000 -- (-335.786) [-332.558] (-335.296) (-339.722) * (-332.913) (-334.583) [-333.766] (-336.589) -- 0:00:21
649500 -- (-340.785) (-333.063) [-333.936] (-338.754) * (-338.024) (-334.111) (-334.936) [-335.673] -- 0:00:21
650000 -- (-337.612) (-334.112) [-334.206] (-335.827) * (-334.988) (-334.409) [-336.375] (-334.640) -- 0:00:21
Average standard deviation of split frequencies: 0.010143
650500 -- (-333.670) [-337.649] (-337.007) (-333.727) * (-335.020) (-333.574) [-336.499] (-338.939) -- 0:00:20
651000 -- [-333.453] (-336.567) (-333.957) (-334.025) * (-334.052) [-335.769] (-333.686) (-334.311) -- 0:00:20
651500 -- (-334.259) (-333.922) [-333.282] (-333.259) * (-333.257) (-336.271) (-332.406) [-333.180] -- 0:00:20
652000 -- (-338.524) (-333.230) (-333.348) [-333.750] * (-336.010) (-333.320) (-332.827) [-333.610] -- 0:00:20
652500 -- (-336.294) [-335.749] (-338.966) (-334.592) * (-336.494) (-337.835) (-345.956) [-333.386] -- 0:00:20
653000 -- (-333.162) (-335.701) (-335.144) [-333.209] * (-333.685) [-334.371] (-339.406) (-333.244) -- 0:00:20
653500 -- (-333.709) (-336.207) [-333.911] (-335.780) * (-335.247) (-340.705) [-336.004] (-333.687) -- 0:00:20
654000 -- (-333.184) (-334.425) (-334.135) [-335.560] * (-336.410) [-333.911] (-335.339) (-333.717) -- 0:00:20
654500 -- (-335.245) (-336.574) (-337.975) [-334.495] * (-336.228) (-333.630) (-337.240) [-333.735] -- 0:00:20
655000 -- [-333.365] (-334.075) (-333.843) (-335.758) * (-339.029) [-332.492] (-336.769) (-333.617) -- 0:00:20
Average standard deviation of split frequencies: 0.009901
655500 -- (-334.254) (-332.630) (-334.320) [-335.304] * [-333.438] (-332.434) (-337.013) (-335.047) -- 0:00:20
656000 -- (-334.923) (-335.889) [-332.553] (-334.362) * (-333.516) (-332.891) [-334.488] (-332.313) -- 0:00:20
656500 -- (-334.117) [-332.681] (-332.661) (-336.589) * (-335.791) [-336.016] (-332.662) (-333.213) -- 0:00:20
657000 -- [-335.740] (-332.922) (-335.733) (-333.882) * (-335.572) [-335.733] (-338.139) (-334.146) -- 0:00:20
657500 -- (-334.975) (-332.861) (-333.619) [-336.869] * (-333.533) (-336.917) [-333.159] (-338.257) -- 0:00:20
658000 -- [-333.503] (-333.136) (-335.244) (-335.322) * (-333.074) (-334.643) (-333.448) [-334.840] -- 0:00:20
658500 -- (-332.493) (-336.704) (-335.048) [-336.137] * (-335.160) (-334.609) [-334.708] (-339.555) -- 0:00:20
659000 -- (-332.858) [-333.032] (-335.475) (-334.335) * [-336.107] (-335.357) (-332.752) (-336.030) -- 0:00:20
659500 -- (-333.714) [-332.297] (-334.710) (-335.970) * (-336.130) [-335.872] (-334.424) (-335.171) -- 0:00:20
660000 -- (-332.044) [-336.537] (-334.699) (-334.257) * [-335.520] (-338.845) (-335.907) (-333.226) -- 0:00:20
Average standard deviation of split frequencies: 0.010425
660500 -- [-336.621] (-333.647) (-334.346) (-335.234) * [-333.143] (-334.748) (-336.886) (-333.027) -- 0:00:20
661000 -- (-336.541) (-333.939) [-335.775] (-336.571) * [-333.025] (-333.319) (-336.321) (-335.630) -- 0:00:20
661500 -- (-332.146) (-333.498) [-333.831] (-335.380) * [-332.320] (-335.201) (-338.327) (-335.675) -- 0:00:19
662000 -- (-333.789) (-335.457) (-334.239) [-332.948] * [-337.865] (-333.728) (-335.569) (-339.006) -- 0:00:19
662500 -- (-334.789) (-333.574) (-336.243) [-334.835] * [-333.866] (-335.448) (-333.255) (-335.578) -- 0:00:19
663000 -- (-333.926) (-337.534) [-335.237] (-336.901) * (-332.881) [-334.854] (-337.212) (-337.695) -- 0:00:19
663500 -- (-334.734) (-333.541) [-334.987] (-339.029) * (-335.527) (-335.207) (-339.436) [-335.421] -- 0:00:19
664000 -- (-336.306) (-333.136) (-334.284) [-333.865] * [-335.095] (-339.456) (-335.594) (-337.139) -- 0:00:20
664500 -- [-333.100] (-333.490) (-332.510) (-334.907) * (-339.309) (-332.983) (-345.736) [-334.272] -- 0:00:20
665000 -- (-337.229) (-333.118) (-334.409) [-339.231] * (-335.903) (-335.627) [-338.703] (-334.131) -- 0:00:20
Average standard deviation of split frequencies: 0.010106
665500 -- (-334.666) [-332.560] (-336.423) (-332.858) * (-333.710) (-333.319) (-334.539) [-333.728] -- 0:00:20
666000 -- (-336.963) (-336.715) [-335.748] (-335.239) * (-332.911) (-338.297) (-336.426) [-335.389] -- 0:00:20
666500 -- (-338.879) (-335.020) [-332.463] (-338.858) * (-335.255) (-332.665) (-338.702) [-335.978] -- 0:00:20
667000 -- (-335.087) [-335.050] (-333.255) (-332.999) * [-333.872] (-334.545) (-336.203) (-340.078) -- 0:00:19
667500 -- (-333.674) [-335.042] (-335.866) (-335.437) * (-334.533) (-339.391) [-334.152] (-339.660) -- 0:00:19
668000 -- (-333.714) (-335.061) (-334.210) [-333.335] * (-341.455) (-334.909) (-335.727) [-333.706] -- 0:00:19
668500 -- (-334.016) (-337.216) [-336.029] (-338.069) * [-336.219] (-333.270) (-333.044) (-335.966) -- 0:00:19
669000 -- (-334.395) (-336.372) (-335.709) [-335.265] * (-333.487) [-338.737] (-334.369) (-334.154) -- 0:00:19
669500 -- (-333.249) (-336.614) [-333.887] (-332.169) * [-334.992] (-335.837) (-337.512) (-333.757) -- 0:00:19
670000 -- [-333.337] (-334.044) (-333.296) (-333.864) * (-332.810) (-333.012) [-335.615] (-335.183) -- 0:00:19
Average standard deviation of split frequencies: 0.010582
670500 -- (-336.033) [-336.213] (-338.617) (-335.237) * (-332.493) (-334.095) (-335.765) [-334.364] -- 0:00:19
671000 -- (-333.596) (-337.560) [-334.711] (-336.345) * (-333.690) [-334.040] (-339.794) (-332.202) -- 0:00:19
671500 -- (-332.735) [-333.821] (-339.333) (-334.115) * [-333.442] (-333.274) (-332.379) (-334.124) -- 0:00:19
672000 -- [-333.839] (-336.159) (-336.969) (-333.738) * (-334.718) [-332.684] (-335.185) (-333.347) -- 0:00:19
672500 -- (-333.425) [-335.720] (-332.460) (-335.280) * (-334.089) (-332.935) (-337.385) [-335.458] -- 0:00:19
673000 -- (-335.533) (-335.560) (-334.260) [-337.864] * [-335.237] (-332.257) (-333.842) (-333.212) -- 0:00:19
673500 -- (-339.514) [-332.751] (-334.236) (-338.084) * [-334.793] (-335.071) (-333.572) (-333.977) -- 0:00:19
674000 -- (-334.190) (-332.847) [-333.569] (-333.537) * [-335.932] (-333.890) (-334.470) (-333.993) -- 0:00:19
674500 -- (-335.270) [-334.596] (-336.489) (-334.034) * (-332.729) (-332.918) (-336.577) [-336.578] -- 0:00:19
675000 -- [-334.292] (-338.302) (-335.197) (-334.860) * (-337.150) (-336.859) (-336.737) [-333.564] -- 0:00:19
Average standard deviation of split frequencies: 0.010538
675500 -- [-335.260] (-336.433) (-333.001) (-334.380) * (-334.087) (-332.988) (-336.239) [-336.043] -- 0:00:19
676000 -- (-335.337) (-334.798) [-333.604] (-333.870) * (-333.455) (-334.674) [-333.320] (-334.697) -- 0:00:19
676500 -- (-334.917) (-333.742) (-333.345) [-333.071] * (-333.968) (-335.055) [-335.193] (-333.541) -- 0:00:19
677000 -- (-332.847) (-333.854) (-334.744) [-336.569] * (-334.518) [-334.962] (-335.124) (-335.445) -- 0:00:19
677500 -- (-333.742) [-335.284] (-332.686) (-333.482) * (-333.307) (-332.151) [-336.518] (-337.716) -- 0:00:19
678000 -- (-334.926) [-333.611] (-332.852) (-333.631) * [-333.805] (-332.505) (-333.896) (-333.645) -- 0:00:18
678500 -- (-333.657) (-336.604) [-332.704] (-336.244) * (-333.662) (-334.830) [-334.582] (-336.640) -- 0:00:18
679000 -- [-333.370] (-334.533) (-333.180) (-334.291) * (-334.776) [-336.903] (-336.121) (-335.185) -- 0:00:18
679500 -- (-333.031) [-332.723] (-335.833) (-334.066) * (-336.482) (-332.396) (-335.361) [-333.913] -- 0:00:18
680000 -- (-339.370) [-334.047] (-334.819) (-334.266) * (-334.696) (-333.145) [-333.508] (-334.488) -- 0:00:18
Average standard deviation of split frequencies: 0.011285
680500 -- (-333.926) [-336.233] (-335.096) (-337.070) * (-335.590) (-333.733) (-333.073) [-333.456] -- 0:00:18
681000 -- (-335.231) (-335.752) [-333.672] (-336.568) * (-337.914) (-335.085) (-336.978) [-333.103] -- 0:00:18
681500 -- (-334.439) (-334.984) [-334.178] (-336.272) * (-336.273) (-334.163) [-333.862] (-334.291) -- 0:00:19
682000 -- [-335.491] (-334.606) (-332.908) (-336.018) * (-338.767) (-333.807) [-336.996] (-334.352) -- 0:00:19
682500 -- (-334.810) [-335.918] (-333.871) (-335.029) * [-334.654] (-335.426) (-335.207) (-332.874) -- 0:00:19
683000 -- (-335.210) (-336.395) (-335.050) [-337.467] * (-334.603) (-336.906) [-333.041] (-336.108) -- 0:00:19
683500 -- (-333.363) [-334.669] (-333.069) (-336.685) * [-334.684] (-333.388) (-332.160) (-336.054) -- 0:00:18
684000 -- (-334.137) (-334.007) (-332.327) [-334.356] * (-334.092) (-335.749) [-334.091] (-336.542) -- 0:00:18
684500 -- [-334.470] (-332.869) (-332.763) (-339.271) * (-337.270) (-337.665) [-333.001] (-332.202) -- 0:00:18
685000 -- (-334.312) [-332.614] (-333.055) (-337.416) * (-334.181) [-334.940] (-336.541) (-332.936) -- 0:00:18
Average standard deviation of split frequencies: 0.010613
685500 -- (-332.858) (-334.139) [-333.182] (-333.906) * (-335.041) (-334.468) [-332.190] (-333.487) -- 0:00:18
686000 -- (-337.331) (-339.515) (-332.534) [-332.139] * (-332.740) [-332.824] (-333.575) (-337.319) -- 0:00:18
686500 -- (-332.532) (-337.239) (-334.151) [-334.171] * (-336.270) (-335.245) [-334.058] (-335.724) -- 0:00:18
687000 -- (-334.307) (-336.813) (-332.206) [-333.658] * (-338.500) (-332.919) (-338.692) [-333.013] -- 0:00:18
687500 -- (-337.610) [-333.578] (-337.952) (-334.697) * (-336.005) [-335.386] (-336.612) (-334.663) -- 0:00:18
688000 -- [-334.567] (-337.225) (-337.346) (-332.305) * (-333.897) [-332.401] (-335.250) (-333.433) -- 0:00:18
688500 -- [-334.348] (-336.382) (-337.999) (-332.792) * [-334.971] (-332.840) (-334.269) (-334.579) -- 0:00:18
689000 -- [-334.998] (-338.583) (-334.299) (-337.758) * (-333.379) (-335.074) (-336.609) [-337.568] -- 0:00:18
689500 -- (-335.759) (-333.239) [-336.750] (-335.276) * (-341.760) (-333.541) (-333.511) [-333.673] -- 0:00:18
690000 -- (-333.565) (-335.881) [-332.921] (-335.652) * (-333.233) (-335.963) [-333.743] (-333.409) -- 0:00:18
Average standard deviation of split frequencies: 0.010617
690500 -- (-337.028) (-337.900) [-333.603] (-333.334) * (-337.941) (-333.016) [-333.874] (-336.660) -- 0:00:18
691000 -- (-337.657) (-334.581) (-337.049) [-334.486] * (-337.545) (-335.340) (-334.388) [-335.718] -- 0:00:18
691500 -- (-335.627) (-335.984) [-333.010] (-333.520) * (-340.149) (-336.435) (-336.286) [-334.734] -- 0:00:18
692000 -- (-333.700) [-333.779] (-335.160) (-332.865) * (-334.727) [-336.467] (-333.865) (-337.633) -- 0:00:18
692500 -- (-332.850) (-333.398) (-334.244) [-332.870] * (-334.219) (-334.456) [-333.979] (-334.237) -- 0:00:18
693000 -- (-334.377) (-332.998) (-335.293) [-333.325] * (-335.637) (-334.561) (-334.423) [-334.639] -- 0:00:18
693500 -- (-333.931) (-332.190) [-333.344] (-333.624) * [-335.303] (-334.076) (-333.160) (-335.423) -- 0:00:18
694000 -- (-339.747) [-334.647] (-332.015) (-335.384) * [-333.606] (-333.801) (-335.336) (-333.027) -- 0:00:18
694500 -- (-332.207) (-334.819) [-336.662] (-333.662) * [-335.786] (-337.024) (-334.794) (-332.512) -- 0:00:18
695000 -- (-332.207) (-334.191) [-334.327] (-333.051) * (-335.092) [-334.588] (-333.823) (-333.046) -- 0:00:17
Average standard deviation of split frequencies: 0.010239
695500 -- (-336.190) (-335.849) (-337.703) [-332.420] * (-336.859) (-337.132) [-332.581] (-333.441) -- 0:00:17
696000 -- (-332.595) [-333.646] (-332.808) (-334.107) * [-334.797] (-336.502) (-336.537) (-334.315) -- 0:00:17
696500 -- (-332.261) (-332.638) [-337.855] (-333.845) * (-334.865) (-334.346) [-335.108] (-333.280) -- 0:00:17
697000 -- (-333.977) [-335.104] (-336.182) (-335.992) * (-335.214) (-332.927) [-337.138] (-333.222) -- 0:00:17
697500 -- (-337.903) (-333.506) (-336.693) [-333.982] * (-334.447) [-334.554] (-334.781) (-337.874) -- 0:00:17
698000 -- [-334.085] (-333.432) (-333.036) (-332.670) * (-338.762) (-337.948) (-332.417) [-333.949] -- 0:00:17
698500 -- (-332.894) [-333.429] (-334.875) (-335.399) * (-334.269) [-336.806] (-333.122) (-341.932) -- 0:00:18
699000 -- (-333.726) [-336.970] (-338.516) (-336.445) * (-338.482) (-337.230) (-334.499) [-335.704] -- 0:00:18
699500 -- (-332.767) (-333.500) (-334.491) [-332.681] * (-334.280) (-334.402) [-333.687] (-334.829) -- 0:00:18
700000 -- (-333.462) (-333.231) [-333.428] (-332.270) * (-334.036) (-333.559) (-333.088) [-333.782] -- 0:00:18
Average standard deviation of split frequencies: 0.010171
700500 -- (-332.531) (-333.497) (-334.239) [-332.870] * (-333.240) [-333.522] (-332.429) (-339.144) -- 0:00:17
701000 -- (-337.528) [-334.543] (-335.800) (-332.359) * [-333.634] (-332.876) (-332.230) (-333.806) -- 0:00:17
701500 -- [-332.714] (-336.954) (-340.662) (-334.474) * (-334.489) [-333.003] (-334.225) (-337.156) -- 0:00:17
702000 -- (-337.077) (-335.142) (-333.078) [-334.211] * [-333.382] (-333.447) (-333.749) (-336.741) -- 0:00:17
702500 -- (-340.697) (-334.559) (-332.586) [-336.109] * [-333.792] (-334.393) (-336.952) (-333.649) -- 0:00:17
703000 -- [-340.547] (-334.313) (-333.138) (-336.322) * [-334.925] (-333.862) (-334.104) (-333.991) -- 0:00:17
703500 -- (-338.652) [-333.463] (-337.688) (-333.300) * (-333.632) [-332.085] (-333.175) (-336.705) -- 0:00:17
704000 -- [-334.746] (-334.215) (-333.333) (-333.995) * [-332.966] (-332.313) (-337.256) (-333.702) -- 0:00:17
704500 -- (-334.333) (-337.479) (-333.510) [-333.636] * (-333.756) (-332.626) (-335.251) [-334.069] -- 0:00:17
705000 -- (-336.179) (-333.834) (-336.367) [-334.021] * [-334.161] (-333.102) (-333.934) (-334.322) -- 0:00:17
Average standard deviation of split frequencies: 0.010605
705500 -- (-336.639) [-335.404] (-336.149) (-335.452) * (-334.638) (-332.697) [-332.896] (-334.570) -- 0:00:17
706000 -- (-334.769) (-332.451) [-332.914] (-333.873) * (-338.490) (-332.902) [-334.299] (-332.697) -- 0:00:17
706500 -- (-335.074) (-334.497) [-333.135] (-333.383) * (-333.024) (-332.362) [-334.654] (-336.265) -- 0:00:17
707000 -- (-333.494) (-333.215) (-333.356) [-339.406] * (-333.321) (-333.560) (-337.466) [-333.897] -- 0:00:17
707500 -- [-333.538] (-333.357) (-334.752) (-333.504) * [-333.733] (-333.843) (-333.720) (-336.229) -- 0:00:17
708000 -- (-333.961) (-333.715) (-334.483) [-332.770] * (-333.050) (-336.178) (-334.571) [-335.197] -- 0:00:17
708500 -- (-334.006) (-335.475) [-335.450] (-332.308) * [-334.482] (-333.502) (-334.770) (-334.092) -- 0:00:17
709000 -- (-332.601) (-334.129) (-338.073) [-332.491] * (-335.418) (-334.574) (-333.575) [-334.701] -- 0:00:17
709500 -- [-335.588] (-335.317) (-335.478) (-337.399) * (-333.789) (-334.382) [-333.739] (-337.755) -- 0:00:17
710000 -- (-332.719) [-335.926] (-335.518) (-335.385) * (-336.736) (-333.628) [-334.623] (-341.217) -- 0:00:17
Average standard deviation of split frequencies: 0.010418
710500 -- (-332.115) (-334.441) (-339.145) [-332.569] * (-332.891) (-335.380) (-335.122) [-339.308] -- 0:00:17
711000 -- [-332.911] (-335.588) (-333.808) (-333.010) * [-337.604] (-337.332) (-333.497) (-334.396) -- 0:00:17
711500 -- [-333.179] (-333.466) (-334.324) (-332.928) * (-338.440) [-332.492] (-333.375) (-332.268) -- 0:00:17
712000 -- [-332.737] (-334.889) (-333.443) (-335.948) * [-335.067] (-332.604) (-333.919) (-334.796) -- 0:00:16
712500 -- (-332.096) [-334.840] (-334.906) (-339.081) * [-334.319] (-334.698) (-334.499) (-332.663) -- 0:00:16
713000 -- (-334.370) [-337.032] (-332.781) (-332.974) * (-332.996) (-333.641) (-332.537) [-333.645] -- 0:00:16
713500 -- (-333.930) [-336.910] (-333.031) (-333.854) * (-336.655) (-332.962) [-336.335] (-332.975) -- 0:00:16
714000 -- (-334.224) (-335.398) [-339.057] (-333.372) * [-339.471] (-332.605) (-338.422) (-332.646) -- 0:00:16
714500 -- (-333.749) [-338.639] (-339.202) (-336.339) * [-337.294] (-332.968) (-333.794) (-333.172) -- 0:00:16
715000 -- (-334.569) (-336.955) [-335.663] (-334.886) * (-334.763) [-333.410] (-333.916) (-338.104) -- 0:00:17
Average standard deviation of split frequencies: 0.010147
715500 -- [-334.193] (-337.792) (-332.626) (-334.111) * (-336.103) [-335.146] (-332.917) (-332.832) -- 0:00:17
716000 -- [-333.073] (-337.071) (-333.141) (-332.902) * (-335.682) (-335.711) (-335.090) [-333.154] -- 0:00:17
716500 -- (-333.709) (-335.602) (-334.190) [-333.994] * (-335.245) (-335.608) [-333.348] (-333.735) -- 0:00:17
717000 -- (-335.050) (-336.045) (-336.164) [-337.584] * [-334.991] (-333.469) (-337.541) (-332.657) -- 0:00:16
717500 -- (-336.817) (-336.179) [-334.770] (-334.843) * [-332.213] (-335.761) (-333.835) (-333.634) -- 0:00:16
718000 -- (-335.180) (-333.849) (-333.899) [-333.335] * [-335.648] (-334.156) (-333.907) (-338.994) -- 0:00:16
718500 -- [-333.752] (-334.474) (-335.362) (-335.558) * (-334.191) [-333.722] (-332.486) (-337.531) -- 0:00:16
719000 -- [-334.857] (-332.937) (-336.611) (-333.576) * (-335.382) (-336.329) (-333.694) [-332.691] -- 0:00:16
719500 -- (-334.401) [-336.014] (-333.274) (-333.734) * (-334.785) (-334.846) [-334.730] (-333.182) -- 0:00:16
720000 -- [-334.205] (-334.284) (-334.698) (-340.520) * [-333.632] (-334.002) (-334.581) (-335.507) -- 0:00:16
Average standard deviation of split frequencies: 0.010262
720500 -- [-334.029] (-335.317) (-334.849) (-335.492) * (-332.969) (-335.436) [-333.423] (-334.616) -- 0:00:16
721000 -- (-333.899) [-335.254] (-336.978) (-335.023) * [-334.071] (-333.072) (-333.241) (-335.740) -- 0:00:16
721500 -- [-334.417] (-332.471) (-332.967) (-333.023) * [-333.444] (-335.608) (-337.530) (-334.663) -- 0:00:16
722000 -- (-336.376) (-333.421) (-337.275) [-336.186] * (-334.645) (-338.419) [-335.443] (-340.113) -- 0:00:16
722500 -- (-335.708) (-333.454) (-332.755) [-335.690] * [-333.857] (-338.303) (-334.236) (-335.454) -- 0:00:16
723000 -- (-332.775) (-336.394) [-334.450] (-334.274) * (-335.161) [-333.730] (-336.083) (-335.430) -- 0:00:16
723500 -- [-333.345] (-335.988) (-333.303) (-332.897) * [-333.282] (-334.287) (-335.541) (-335.262) -- 0:00:16
724000 -- (-333.787) [-338.473] (-335.170) (-332.994) * (-333.414) [-335.849] (-333.444) (-340.758) -- 0:00:16
724500 -- (-335.008) [-334.644] (-335.885) (-333.538) * (-335.084) [-333.705] (-334.055) (-340.873) -- 0:00:16
725000 -- [-337.891] (-333.403) (-333.916) (-333.655) * (-334.150) (-335.147) (-337.651) [-332.951] -- 0:00:16
Average standard deviation of split frequencies: 0.010186
725500 -- (-336.430) (-333.765) [-333.104] (-334.270) * (-334.758) (-336.802) (-340.318) [-334.255] -- 0:00:16
726000 -- (-336.917) (-334.452) (-333.174) [-332.885] * [-332.255] (-332.534) (-336.285) (-332.778) -- 0:00:16
726500 -- [-332.167] (-334.889) (-334.953) (-332.226) * [-333.836] (-333.077) (-336.247) (-332.729) -- 0:00:16
727000 -- [-334.664] (-334.754) (-333.927) (-332.325) * [-335.214] (-336.875) (-337.422) (-333.175) -- 0:00:16
727500 -- (-335.612) (-334.375) [-334.026] (-333.659) * [-332.439] (-336.891) (-332.680) (-332.727) -- 0:00:16
728000 -- (-341.994) (-333.586) (-333.748) [-333.110] * (-334.592) (-337.520) (-334.108) [-336.203] -- 0:00:16
728500 -- (-335.765) (-332.734) (-333.691) [-332.983] * [-334.456] (-334.167) (-334.221) (-335.950) -- 0:00:16
729000 -- [-335.526] (-334.640) (-338.664) (-333.719) * [-333.023] (-339.662) (-334.522) (-334.598) -- 0:00:15
729500 -- (-332.545) (-334.227) [-334.252] (-333.494) * [-335.019] (-337.673) (-338.516) (-334.833) -- 0:00:15
730000 -- [-333.747] (-334.173) (-333.995) (-337.317) * (-334.341) (-339.971) (-333.416) [-334.070] -- 0:00:15
Average standard deviation of split frequencies: 0.010403
730500 -- [-332.918] (-334.503) (-338.309) (-335.803) * (-334.055) (-338.727) [-333.050] (-334.425) -- 0:00:15
731000 -- (-333.601) (-335.842) (-335.733) [-332.532] * (-333.706) (-333.249) [-335.177] (-333.293) -- 0:00:15
731500 -- (-334.005) (-338.519) (-333.980) [-337.118] * (-335.553) [-334.274] (-335.732) (-333.294) -- 0:00:15
732000 -- (-338.132) (-338.641) [-333.379] (-336.924) * (-335.333) (-334.258) [-333.838] (-334.009) -- 0:00:16
732500 -- (-333.775) (-336.873) (-332.638) [-336.055] * [-336.897] (-338.285) (-334.015) (-332.835) -- 0:00:16
733000 -- (-333.709) [-333.131] (-333.317) (-334.609) * [-333.154] (-335.922) (-332.831) (-332.461) -- 0:00:16
733500 -- (-333.734) (-333.738) [-332.201] (-333.402) * [-334.166] (-333.334) (-337.553) (-333.803) -- 0:00:15
734000 -- (-334.410) (-336.937) (-333.587) [-333.738] * (-332.843) (-333.219) (-340.987) [-332.813] -- 0:00:15
734500 -- (-335.991) [-335.859] (-334.277) (-333.169) * (-336.362) (-334.009) (-333.547) [-332.856] -- 0:00:15
735000 -- (-336.905) [-334.984] (-333.343) (-335.236) * [-335.604] (-334.755) (-335.625) (-337.972) -- 0:00:15
Average standard deviation of split frequencies: 0.010568
735500 -- [-332.798] (-334.049) (-332.148) (-334.312) * (-333.688) [-334.419] (-339.043) (-333.862) -- 0:00:15
736000 -- (-335.601) [-333.557] (-335.095) (-335.345) * (-334.645) (-333.731) (-336.243) [-332.794] -- 0:00:15
736500 -- (-334.916) [-339.578] (-337.034) (-333.956) * (-338.264) (-332.806) (-332.962) [-332.632] -- 0:00:15
737000 -- [-336.273] (-335.341) (-333.907) (-333.934) * (-333.731) (-335.250) [-335.000] (-335.331) -- 0:00:15
737500 -- (-333.761) (-335.443) [-339.989] (-335.440) * (-333.121) (-335.031) [-332.500] (-334.842) -- 0:00:15
738000 -- [-333.684] (-333.307) (-335.312) (-333.005) * [-336.045] (-338.090) (-333.187) (-336.688) -- 0:00:15
738500 -- (-333.110) (-336.875) [-334.665] (-335.424) * (-332.994) (-338.883) [-335.809] (-334.475) -- 0:00:15
739000 -- (-333.234) (-334.018) [-335.604] (-333.630) * (-334.080) (-337.803) [-333.903] (-332.760) -- 0:00:15
739500 -- (-337.279) [-332.809] (-334.465) (-332.830) * (-334.011) (-335.227) [-335.993] (-334.385) -- 0:00:15
740000 -- (-339.272) (-334.168) [-333.982] (-333.773) * (-335.330) (-334.961) (-334.192) [-333.290] -- 0:00:15
Average standard deviation of split frequencies: 0.011138
740500 -- (-336.921) [-333.485] (-333.316) (-335.119) * (-333.290) (-333.432) [-338.176] (-335.386) -- 0:00:15
741000 -- (-333.782) (-334.302) [-332.603] (-335.210) * [-334.273] (-335.091) (-334.381) (-333.897) -- 0:00:15
741500 -- (-337.646) (-338.128) (-335.723) [-332.154] * (-333.877) (-333.707) (-333.922) [-333.214] -- 0:00:15
742000 -- (-333.853) (-333.318) (-334.584) [-335.660] * [-333.996] (-338.719) (-333.200) (-336.295) -- 0:00:15
742500 -- [-333.802] (-333.993) (-338.455) (-339.954) * [-333.159] (-334.774) (-333.181) (-339.668) -- 0:00:15
743000 -- (-334.616) [-336.678] (-334.129) (-339.067) * (-332.925) [-337.514] (-334.202) (-339.033) -- 0:00:15
743500 -- [-333.504] (-334.268) (-333.152) (-334.326) * [-332.634] (-333.269) (-335.605) (-333.867) -- 0:00:15
744000 -- (-334.069) (-335.143) (-333.813) [-335.959] * [-335.056] (-334.248) (-332.265) (-335.317) -- 0:00:15
744500 -- (-333.012) (-336.754) (-336.009) [-336.306] * (-333.418) [-335.690] (-336.431) (-332.304) -- 0:00:15
745000 -- (-334.067) (-336.271) [-333.266] (-333.103) * (-332.527) (-337.230) (-332.935) [-332.172] -- 0:00:15
Average standard deviation of split frequencies: 0.011189
745500 -- (-335.374) [-334.773] (-333.496) (-335.058) * [-336.245] (-336.048) (-334.601) (-333.213) -- 0:00:15
746000 -- (-336.901) (-338.168) (-334.567) [-334.800] * [-333.442] (-333.673) (-336.489) (-336.900) -- 0:00:14
746500 -- (-332.943) (-335.476) (-336.048) [-335.533] * (-334.698) (-335.501) (-337.857) [-334.414] -- 0:00:14
747000 -- [-334.109] (-336.426) (-335.192) (-338.039) * (-333.787) (-336.533) [-340.080] (-336.954) -- 0:00:14
747500 -- [-333.831] (-334.985) (-332.497) (-340.134) * (-335.321) [-334.107] (-335.070) (-335.725) -- 0:00:14
748000 -- (-333.877) [-335.389] (-332.711) (-337.375) * (-334.779) [-335.682] (-333.882) (-333.107) -- 0:00:14
748500 -- (-333.187) (-334.533) [-334.187] (-334.785) * [-333.158] (-336.068) (-332.596) (-332.372) -- 0:00:15
749000 -- (-339.603) [-333.824] (-335.667) (-336.765) * (-335.620) [-333.390] (-332.578) (-333.529) -- 0:00:15
749500 -- [-333.391] (-332.842) (-335.526) (-334.952) * (-336.133) (-335.420) [-334.845] (-333.426) -- 0:00:15
750000 -- [-332.843] (-338.583) (-335.728) (-334.944) * (-337.197) (-334.492) (-334.897) [-334.306] -- 0:00:15
Average standard deviation of split frequencies: 0.010519
750500 -- (-332.916) (-333.222) [-336.224] (-333.774) * [-333.104] (-333.134) (-335.969) (-334.292) -- 0:00:14
751000 -- (-333.978) (-336.351) [-339.567] (-334.749) * (-333.653) (-334.526) [-336.369] (-333.979) -- 0:00:14
751500 -- (-334.420) (-334.435) (-338.224) [-336.089] * (-334.212) [-334.515] (-334.279) (-333.286) -- 0:00:14
752000 -- [-335.623] (-333.802) (-336.289) (-335.581) * (-338.035) (-336.740) [-332.756] (-334.181) -- 0:00:14
752500 -- (-336.970) [-335.468] (-336.443) (-333.091) * (-338.720) [-333.913] (-333.334) (-333.443) -- 0:00:14
753000 -- [-334.701] (-334.590) (-333.259) (-336.178) * (-333.007) (-334.404) (-334.158) [-332.924] -- 0:00:14
753500 -- (-333.286) (-333.859) (-333.574) [-333.890] * [-333.005] (-333.760) (-335.051) (-336.962) -- 0:00:14
754000 -- [-333.683] (-333.796) (-334.064) (-332.618) * (-333.152) (-336.101) (-339.282) [-337.431] -- 0:00:14
754500 -- (-333.462) (-336.854) (-340.164) [-334.369] * (-335.342) (-335.527) [-334.825] (-335.649) -- 0:00:14
755000 -- (-335.892) [-336.244] (-339.726) (-334.387) * [-333.482] (-337.618) (-334.838) (-338.195) -- 0:00:14
Average standard deviation of split frequencies: 0.010600
755500 -- [-334.718] (-333.136) (-339.375) (-334.778) * [-333.036] (-336.682) (-333.989) (-339.703) -- 0:00:14
756000 -- (-335.980) (-334.365) [-336.610] (-334.460) * (-333.457) (-336.336) [-333.649] (-335.117) -- 0:00:14
756500 -- (-334.847) (-333.853) [-333.463] (-335.004) * (-339.118) (-336.601) [-332.929] (-335.142) -- 0:00:14
757000 -- (-334.913) (-336.734) [-333.077] (-335.064) * (-332.752) (-335.237) [-335.459] (-332.777) -- 0:00:14
757500 -- (-332.970) (-336.824) (-334.654) [-332.907] * (-334.046) (-333.565) (-333.286) [-332.704] -- 0:00:14
758000 -- (-335.100) [-333.648] (-336.696) (-332.420) * (-334.772) (-333.776) (-341.321) [-332.768] -- 0:00:14
758500 -- (-334.382) [-340.500] (-332.906) (-334.801) * [-335.384] (-333.545) (-340.260) (-333.546) -- 0:00:14
759000 -- [-334.654] (-334.529) (-333.875) (-334.118) * (-334.724) [-332.694] (-338.348) (-333.332) -- 0:00:14
759500 -- (-336.493) (-335.281) (-332.766) [-334.381] * (-334.798) (-334.419) [-333.222] (-332.701) -- 0:00:14
760000 -- (-334.900) (-334.496) [-333.001] (-334.798) * [-333.845] (-336.990) (-333.077) (-333.701) -- 0:00:14
Average standard deviation of split frequencies: 0.011000
760500 -- (-336.449) (-333.587) (-332.760) [-333.971] * (-341.471) (-333.244) (-335.680) [-334.314] -- 0:00:14
761000 -- [-333.999] (-335.722) (-335.442) (-341.015) * (-339.046) [-333.366] (-336.225) (-335.600) -- 0:00:14
761500 -- (-333.309) [-334.097] (-334.686) (-336.042) * (-334.960) (-337.213) (-333.011) [-337.367] -- 0:00:14
762000 -- [-333.846] (-333.269) (-336.079) (-334.467) * (-334.410) (-333.758) (-334.514) [-334.380] -- 0:00:14
762500 -- (-334.938) (-333.743) [-335.723] (-333.595) * (-332.005) (-333.140) [-339.610] (-336.898) -- 0:00:14
763000 -- (-333.140) [-334.352] (-337.249) (-339.650) * (-332.398) (-332.587) (-337.686) [-332.213] -- 0:00:13
763500 -- [-334.641] (-333.584) (-333.178) (-334.997) * [-332.658] (-332.569) (-336.906) (-335.489) -- 0:00:13
764000 -- (-333.606) (-335.936) [-334.940] (-336.228) * (-336.842) (-333.866) (-337.785) [-333.881] -- 0:00:13
764500 -- [-333.618] (-336.269) (-337.117) (-338.039) * (-335.716) (-336.029) [-337.892] (-337.380) -- 0:00:13
765000 -- (-339.251) [-333.500] (-338.632) (-334.203) * (-332.627) [-332.954] (-336.886) (-336.569) -- 0:00:13
Average standard deviation of split frequencies: 0.010607
765500 -- [-332.598] (-332.938) (-332.688) (-333.525) * (-336.821) (-332.957) [-334.301] (-334.152) -- 0:00:14
766000 -- (-340.004) (-333.655) [-334.776] (-335.485) * [-334.024] (-338.228) (-334.186) (-333.720) -- 0:00:14
766500 -- (-334.663) (-336.627) [-332.363] (-334.711) * [-333.512] (-333.672) (-332.594) (-338.119) -- 0:00:14
767000 -- (-337.139) (-335.827) (-332.890) [-334.090] * (-335.613) (-335.992) (-332.937) [-333.475] -- 0:00:13
767500 -- (-336.343) [-332.470] (-334.571) (-337.914) * (-336.288) (-336.078) [-333.588] (-335.096) -- 0:00:13
768000 -- (-339.921) [-333.216] (-338.256) (-334.232) * (-334.699) (-333.086) (-334.299) [-335.734] -- 0:00:13
768500 -- [-334.361] (-333.848) (-335.774) (-334.512) * (-332.449) [-333.452] (-333.834) (-335.791) -- 0:00:13
769000 -- (-336.697) (-335.929) (-337.926) [-335.324] * (-332.969) [-333.476] (-333.251) (-333.493) -- 0:00:13
769500 -- (-335.883) (-332.907) [-337.506] (-334.627) * [-333.335] (-333.760) (-333.880) (-334.464) -- 0:00:13
770000 -- (-335.476) [-333.117] (-333.959) (-337.234) * (-335.376) (-335.217) [-334.085] (-336.446) -- 0:00:13
Average standard deviation of split frequencies: 0.010147
770500 -- [-332.605] (-334.425) (-333.791) (-333.771) * [-333.340] (-334.932) (-333.029) (-334.012) -- 0:00:13
771000 -- (-332.603) [-333.447] (-334.723) (-334.453) * (-337.319) (-333.234) [-332.634] (-334.572) -- 0:00:13
771500 -- (-337.318) [-333.386] (-338.871) (-333.334) * [-334.955] (-333.473) (-333.196) (-332.770) -- 0:00:13
772000 -- [-332.701] (-332.665) (-337.403) (-335.003) * (-333.925) (-338.310) [-335.539] (-335.345) -- 0:00:13
772500 -- [-332.518] (-332.501) (-334.936) (-335.697) * (-333.582) [-335.305] (-335.705) (-334.938) -- 0:00:13
773000 -- [-333.178] (-334.525) (-334.188) (-336.809) * (-334.145) (-332.576) [-332.930] (-332.683) -- 0:00:13
773500 -- (-333.240) (-332.925) [-334.422] (-335.830) * [-334.135] (-333.858) (-333.103) (-333.614) -- 0:00:13
774000 -- (-333.832) (-334.009) (-336.907) [-335.442] * (-334.535) (-335.323) [-333.508] (-333.890) -- 0:00:13
774500 -- (-335.072) (-333.135) [-332.809] (-344.596) * (-338.234) (-341.367) [-334.702] (-332.584) -- 0:00:13
775000 -- (-333.805) [-333.243] (-334.480) (-339.010) * (-336.562) (-334.919) (-334.983) [-335.958] -- 0:00:13
Average standard deviation of split frequencies: 0.010327
775500 -- (-335.362) (-333.139) (-336.269) [-335.165] * (-335.065) [-333.916] (-335.079) (-332.257) -- 0:00:13
776000 -- (-333.366) (-335.446) [-336.558] (-335.139) * (-334.571) (-333.408) (-336.021) [-334.587] -- 0:00:13
776500 -- [-334.502] (-334.053) (-333.514) (-334.368) * (-335.476) (-337.037) [-337.850] (-335.304) -- 0:00:13
777000 -- [-334.994] (-335.994) (-335.213) (-334.177) * [-333.560] (-336.055) (-334.956) (-335.255) -- 0:00:13
777500 -- [-333.675] (-334.624) (-333.252) (-333.987) * (-334.290) [-333.395] (-334.735) (-333.196) -- 0:00:13
778000 -- (-333.870) (-334.767) (-334.494) [-332.770] * (-337.623) [-332.531] (-335.470) (-333.631) -- 0:00:13
778500 -- (-333.540) [-332.824] (-333.123) (-334.073) * (-338.812) [-334.804] (-335.700) (-333.215) -- 0:00:13
779000 -- (-336.095) (-337.059) (-335.647) [-333.820] * [-335.289] (-337.189) (-335.727) (-334.016) -- 0:00:13
779500 -- [-340.404] (-337.997) (-333.931) (-334.406) * (-337.677) (-335.480) (-334.842) [-332.501] -- 0:00:13
780000 -- (-332.817) [-340.860] (-333.574) (-333.659) * (-333.499) [-333.350] (-333.593) (-333.876) -- 0:00:12
Average standard deviation of split frequencies: 0.009742
780500 -- (-332.974) (-338.610) [-335.493] (-334.587) * (-332.865) (-333.178) [-334.189] (-333.295) -- 0:00:12
781000 -- (-332.860) (-337.757) (-336.446) [-333.737] * (-336.293) (-335.434) [-334.212] (-333.094) -- 0:00:12
781500 -- [-333.184] (-334.882) (-337.010) (-333.220) * (-334.723) (-334.085) (-334.485) [-332.566] -- 0:00:12
782000 -- [-332.667] (-337.646) (-335.778) (-334.767) * [-333.897] (-334.119) (-335.582) (-333.005) -- 0:00:12
782500 -- (-333.917) (-336.509) [-333.755] (-333.778) * (-334.243) [-333.031] (-337.988) (-334.429) -- 0:00:13
783000 -- (-332.938) [-332.914] (-337.442) (-337.819) * (-334.563) (-334.294) (-333.424) [-334.121] -- 0:00:13
783500 -- [-335.578] (-334.064) (-335.664) (-333.975) * (-335.288) (-336.417) (-332.535) [-336.557] -- 0:00:12
784000 -- [-335.344] (-332.969) (-332.379) (-337.076) * (-333.202) [-337.582] (-335.621) (-332.959) -- 0:00:12
784500 -- (-334.955) (-334.952) (-332.501) [-335.529] * (-333.145) (-337.216) [-334.681] (-337.960) -- 0:00:12
785000 -- (-335.612) (-336.647) [-334.730] (-335.109) * (-335.077) [-334.176] (-333.037) (-334.686) -- 0:00:12
Average standard deviation of split frequencies: 0.010271
785500 -- (-334.745) (-339.315) (-337.952) [-332.953] * (-334.430) [-332.870] (-333.473) (-338.130) -- 0:00:12
786000 -- [-335.593] (-335.910) (-337.128) (-334.966) * [-336.660] (-333.662) (-336.794) (-335.032) -- 0:00:12
786500 -- (-334.510) [-333.093] (-337.408) (-334.071) * (-334.408) (-335.454) [-332.430] (-337.208) -- 0:00:12
787000 -- [-334.804] (-334.797) (-335.831) (-332.449) * (-338.493) (-333.080) (-334.226) [-333.911] -- 0:00:12
787500 -- (-333.939) (-335.393) [-335.731] (-332.437) * (-338.409) (-333.147) [-333.751] (-334.103) -- 0:00:12
788000 -- (-336.576) (-335.124) [-334.017] (-332.851) * (-336.268) (-333.720) [-334.184] (-332.669) -- 0:00:12
788500 -- (-338.776) (-339.641) (-333.864) [-334.032] * (-336.199) (-333.474) (-334.995) [-333.952] -- 0:00:12
789000 -- (-336.502) (-336.042) (-334.419) [-333.732] * (-332.611) (-334.586) [-334.358] (-335.150) -- 0:00:12
789500 -- [-335.584] (-335.388) (-332.296) (-333.741) * (-334.814) [-333.955] (-336.766) (-333.236) -- 0:00:12
790000 -- [-335.392] (-338.751) (-332.320) (-336.680) * (-336.112) [-335.445] (-334.736) (-334.187) -- 0:00:12
Average standard deviation of split frequencies: 0.009420
790500 -- (-335.867) [-334.706] (-335.639) (-333.330) * (-335.599) [-333.431] (-337.378) (-336.083) -- 0:00:12
791000 -- [-334.090] (-334.753) (-335.389) (-335.329) * (-335.071) (-333.616) (-333.350) [-334.713] -- 0:00:12
791500 -- (-333.216) (-332.274) (-335.521) [-332.868] * (-333.914) (-334.874) [-335.051] (-335.072) -- 0:00:12
792000 -- (-333.487) (-332.606) [-333.618] (-334.458) * (-334.221) (-342.950) [-334.640] (-335.015) -- 0:00:12
792500 -- [-333.600] (-333.623) (-335.048) (-333.679) * (-333.750) [-333.224] (-334.360) (-338.177) -- 0:00:12
793000 -- (-335.748) (-338.124) (-336.287) [-336.140] * (-333.737) (-332.602) [-334.611] (-333.950) -- 0:00:12
793500 -- (-334.930) [-335.814] (-334.053) (-334.450) * [-334.138] (-333.403) (-334.343) (-335.662) -- 0:00:12
794000 -- (-335.421) (-335.805) [-333.535] (-334.227) * (-335.158) [-332.336] (-334.667) (-332.590) -- 0:00:12
794500 -- (-334.811) (-333.547) [-337.334] (-335.666) * (-336.429) (-333.133) (-335.284) [-334.213] -- 0:00:12
795000 -- (-334.847) (-334.295) (-333.086) [-333.282] * (-337.927) (-334.873) (-333.709) [-334.967] -- 0:00:12
Average standard deviation of split frequencies: 0.008725
795500 -- (-334.849) (-335.032) (-334.607) [-335.591] * (-333.334) (-333.396) (-332.237) [-333.630] -- 0:00:12
796000 -- (-332.709) [-335.142] (-335.456) (-333.126) * [-333.345] (-335.415) (-344.289) (-333.946) -- 0:00:12
796500 -- (-333.660) [-333.607] (-334.226) (-332.937) * (-336.096) (-333.090) (-336.893) [-332.815] -- 0:00:12
797000 -- [-332.974] (-334.313) (-335.661) (-340.561) * (-335.788) (-332.886) [-332.481] (-333.414) -- 0:00:11
797500 -- [-335.012] (-333.895) (-334.005) (-337.926) * (-334.884) (-333.850) (-336.402) [-338.931] -- 0:00:11
798000 -- (-335.501) [-333.732] (-334.535) (-340.369) * [-335.108] (-336.537) (-336.516) (-339.295) -- 0:00:11
798500 -- [-333.403] (-333.787) (-334.562) (-338.764) * [-332.560] (-334.815) (-336.966) (-335.860) -- 0:00:11
799000 -- (-334.491) [-334.636] (-334.568) (-340.756) * [-332.370] (-333.452) (-341.351) (-334.475) -- 0:00:11
799500 -- (-337.377) [-333.163] (-337.274) (-345.284) * (-333.759) (-332.763) [-337.276] (-334.299) -- 0:00:12
800000 -- (-333.262) (-333.872) [-335.813] (-335.727) * (-334.659) [-334.044] (-336.172) (-332.819) -- 0:00:12
Average standard deviation of split frequencies: 0.008910
800500 -- (-334.920) [-334.321] (-335.564) (-336.749) * (-334.956) [-334.672] (-334.762) (-333.941) -- 0:00:11
801000 -- (-333.905) (-333.709) (-334.682) [-332.982] * [-336.159] (-334.184) (-334.288) (-333.867) -- 0:00:11
801500 -- [-333.941] (-341.302) (-333.680) (-333.471) * (-333.988) (-338.444) (-335.207) [-333.082] -- 0:00:11
802000 -- [-335.296] (-335.192) (-336.583) (-334.231) * (-333.895) (-335.763) (-332.663) [-335.611] -- 0:00:11
802500 -- [-335.398] (-334.713) (-341.812) (-334.840) * [-333.819] (-335.114) (-333.703) (-336.229) -- 0:00:11
803000 -- [-332.632] (-333.495) (-332.968) (-333.920) * (-334.147) [-333.855] (-336.567) (-332.860) -- 0:00:11
803500 -- (-335.647) (-333.219) [-335.288] (-335.438) * (-334.837) (-333.950) [-339.922] (-332.880) -- 0:00:11
804000 -- (-337.737) (-336.943) (-333.001) [-335.275] * (-333.222) [-333.116] (-335.646) (-334.800) -- 0:00:11
804500 -- (-334.637) [-333.533] (-335.282) (-335.015) * (-334.400) (-333.250) [-336.236] (-335.654) -- 0:00:11
805000 -- (-335.728) [-336.555] (-333.184) (-334.337) * (-333.051) (-334.334) (-333.831) [-333.845] -- 0:00:11
Average standard deviation of split frequencies: 0.009124
805500 -- (-336.012) [-332.565] (-333.272) (-337.216) * [-333.206] (-337.216) (-335.580) (-335.275) -- 0:00:11
806000 -- (-338.025) (-336.289) [-334.627] (-334.528) * [-335.023] (-337.203) (-336.820) (-335.897) -- 0:00:11
806500 -- (-336.768) (-337.764) [-334.362] (-335.656) * (-333.010) [-334.357] (-335.508) (-333.841) -- 0:00:11
807000 -- (-337.868) (-335.540) (-333.673) [-334.956] * (-332.881) (-334.021) [-337.209] (-335.976) -- 0:00:11
807500 -- (-336.440) [-332.723] (-332.504) (-334.828) * (-336.668) [-333.192] (-342.020) (-334.404) -- 0:00:11
808000 -- (-337.661) (-333.105) [-333.354] (-335.472) * [-335.390] (-333.966) (-336.797) (-336.153) -- 0:00:11
808500 -- (-335.666) (-333.201) (-332.229) [-333.089] * (-333.970) (-333.283) [-335.278] (-335.481) -- 0:00:11
809000 -- (-337.057) (-332.621) (-338.620) [-336.936] * [-336.676] (-334.164) (-336.348) (-335.773) -- 0:00:11
809500 -- (-335.690) [-333.229] (-333.402) (-334.259) * (-335.255) [-332.915] (-335.691) (-342.865) -- 0:00:11
810000 -- (-333.414) (-332.988) (-334.025) [-336.033] * (-336.492) (-334.157) (-336.727) [-335.738] -- 0:00:11
Average standard deviation of split frequencies: 0.009071
810500 -- (-333.201) [-334.513] (-334.466) (-334.108) * [-333.680] (-334.532) (-335.204) (-334.738) -- 0:00:11
811000 -- (-333.708) [-333.753] (-333.101) (-332.322) * (-333.180) (-337.677) (-335.024) [-335.652] -- 0:00:11
811500 -- (-332.963) [-335.665] (-335.090) (-332.791) * (-333.722) [-333.211] (-338.728) (-338.026) -- 0:00:11
812000 -- [-336.132] (-335.697) (-334.416) (-334.041) * (-334.418) (-334.909) [-333.599] (-333.534) -- 0:00:11
812500 -- [-332.553] (-336.311) (-336.477) (-333.849) * (-332.771) [-332.209] (-338.920) (-338.897) -- 0:00:11
813000 -- [-332.656] (-333.924) (-334.452) (-335.680) * (-333.907) (-334.217) [-333.473] (-334.865) -- 0:00:11
813500 -- (-334.642) [-335.729] (-334.293) (-336.275) * (-335.020) (-334.375) [-334.657] (-335.615) -- 0:00:11
814000 -- [-335.579] (-333.464) (-337.908) (-336.693) * (-333.509) (-333.744) (-334.332) [-337.273] -- 0:00:10
814500 -- [-338.047] (-332.955) (-339.752) (-338.500) * (-340.418) [-332.835] (-335.386) (-334.837) -- 0:00:10
815000 -- (-336.087) [-332.448] (-339.348) (-339.606) * (-334.688) [-332.556] (-336.026) (-333.312) -- 0:00:10
Average standard deviation of split frequencies: 0.008396
815500 -- [-334.007] (-339.198) (-336.647) (-333.001) * [-335.268] (-336.411) (-335.474) (-333.440) -- 0:00:10
816000 -- (-333.749) (-335.682) (-333.367) [-335.083] * [-338.619] (-335.745) (-334.837) (-338.687) -- 0:00:10
816500 -- [-335.922] (-334.467) (-332.653) (-336.054) * [-333.814] (-332.788) (-336.214) (-332.683) -- 0:00:11
817000 -- (-334.640) (-335.661) [-335.683] (-332.336) * (-337.585) (-334.980) (-334.587) [-333.872] -- 0:00:10
817500 -- [-338.680] (-339.127) (-334.519) (-333.011) * [-334.646] (-335.658) (-334.864) (-334.847) -- 0:00:10
818000 -- (-335.116) (-336.733) (-333.226) [-333.872] * (-333.967) (-337.426) [-333.472] (-335.414) -- 0:00:10
818500 -- [-333.166] (-335.322) (-333.660) (-333.817) * [-335.609] (-336.738) (-335.094) (-334.099) -- 0:00:10
819000 -- (-335.058) (-333.315) (-333.236) [-337.474] * (-336.625) [-333.629] (-333.765) (-336.765) -- 0:00:10
819500 -- (-336.236) (-336.670) (-333.130) [-332.631] * (-335.414) (-333.936) (-333.175) [-334.937] -- 0:00:10
820000 -- (-335.487) (-335.473) (-332.387) [-332.801] * [-334.809] (-335.768) (-333.408) (-333.869) -- 0:00:10
Average standard deviation of split frequencies: 0.008655
820500 -- (-332.695) (-337.160) [-333.320] (-333.420) * (-334.402) [-332.694] (-341.490) (-334.161) -- 0:00:10
821000 -- [-332.750] (-336.182) (-335.443) (-332.774) * [-335.779] (-334.072) (-335.343) (-333.305) -- 0:00:10
821500 -- (-334.369) (-334.810) [-335.785] (-337.597) * (-333.759) (-334.395) [-334.433] (-334.984) -- 0:00:10
822000 -- (-334.932) (-336.339) [-335.258] (-335.209) * (-335.863) (-335.863) [-332.788] (-337.551) -- 0:00:10
822500 -- (-339.104) [-333.278] (-334.553) (-337.073) * (-334.629) (-334.198) (-337.812) [-336.155] -- 0:00:10
823000 -- (-337.326) (-334.373) [-334.050] (-333.805) * (-336.160) (-334.657) [-333.680] (-334.854) -- 0:00:10
823500 -- (-334.517) [-333.022] (-334.911) (-334.112) * (-335.565) (-338.802) [-337.223] (-333.505) -- 0:00:10
824000 -- (-335.818) [-334.350] (-335.464) (-334.753) * (-339.811) [-333.585] (-338.952) (-333.174) -- 0:00:10
824500 -- (-336.271) (-339.599) [-336.594] (-333.838) * (-333.913) (-334.347) (-336.823) [-334.292] -- 0:00:10
825000 -- (-333.560) (-334.057) (-334.582) [-332.759] * (-337.461) (-333.082) [-332.398] (-335.265) -- 0:00:10
Average standard deviation of split frequencies: 0.008789
825500 -- [-336.021] (-333.909) (-335.314) (-334.124) * (-335.652) (-334.080) (-336.350) [-334.412] -- 0:00:10
826000 -- [-338.265] (-336.379) (-334.351) (-336.186) * (-336.007) (-332.941) [-335.182] (-333.156) -- 0:00:10
826500 -- (-337.287) (-334.861) (-334.835) [-333.438] * [-334.248] (-333.070) (-336.282) (-334.858) -- 0:00:10
827000 -- (-333.997) (-334.402) (-333.193) [-332.925] * (-333.359) (-332.776) [-334.561] (-334.666) -- 0:00:10
827500 -- (-333.608) (-333.262) (-333.431) [-334.879] * (-333.932) (-333.850) (-334.085) [-332.996] -- 0:00:10
828000 -- (-334.754) (-334.269) (-335.925) [-335.583] * (-334.713) (-334.405) [-334.626] (-335.421) -- 0:00:10
828500 -- (-335.138) (-335.053) [-336.621] (-335.641) * (-334.999) (-332.861) (-334.349) [-334.741] -- 0:00:10
829000 -- (-336.650) (-338.317) (-338.688) [-334.048] * [-336.563] (-333.556) (-334.134) (-335.665) -- 0:00:10
829500 -- (-335.904) (-337.474) (-335.060) [-335.983] * (-336.042) (-333.713) (-333.552) [-335.799] -- 0:00:10
830000 -- (-333.617) (-335.774) [-332.806] (-332.896) * (-336.482) (-338.041) (-334.462) [-334.810] -- 0:00:10
Average standard deviation of split frequencies: 0.008853
830500 -- (-335.320) [-334.534] (-340.323) (-333.365) * (-336.242) [-334.565] (-332.719) (-340.145) -- 0:00:10
831000 -- (-333.595) (-337.575) (-332.870) [-334.010] * [-335.249] (-334.896) (-334.075) (-338.132) -- 0:00:09
831500 -- [-333.921] (-339.333) (-332.936) (-334.242) * (-333.532) [-333.540] (-339.278) (-338.709) -- 0:00:09
832000 -- (-333.599) [-334.358] (-338.394) (-332.881) * [-333.216] (-333.966) (-335.525) (-336.123) -- 0:00:09
832500 -- (-333.147) [-333.706] (-338.448) (-334.740) * (-334.400) (-335.666) (-332.882) [-334.661] -- 0:00:09
833000 -- (-332.623) [-333.468] (-332.674) (-334.980) * (-333.528) (-333.863) (-337.512) [-334.938] -- 0:00:09
833500 -- (-335.442) (-333.395) [-334.825] (-332.783) * (-333.360) (-336.464) [-332.340] (-333.444) -- 0:00:09
834000 -- (-335.063) (-334.426) [-334.893] (-334.854) * (-332.515) [-336.146] (-335.173) (-338.757) -- 0:00:09
834500 -- [-332.594] (-333.037) (-334.579) (-334.903) * [-332.689] (-336.069) (-333.688) (-334.825) -- 0:00:09
835000 -- (-333.784) [-332.082] (-333.617) (-334.420) * (-332.643) (-334.259) (-334.238) [-334.951] -- 0:00:09
Average standard deviation of split frequencies: 0.008872
835500 -- [-332.955] (-332.776) (-332.512) (-335.725) * (-334.000) [-336.723] (-334.921) (-334.586) -- 0:00:09
836000 -- (-335.262) (-333.449) [-332.815] (-334.503) * (-335.639) [-333.132] (-337.211) (-333.665) -- 0:00:09
836500 -- (-336.710) [-333.677] (-334.293) (-333.445) * (-332.656) (-332.555) (-336.183) [-335.520] -- 0:00:09
837000 -- (-335.445) (-333.830) (-333.186) [-333.724] * (-334.645) (-335.333) [-334.219] (-338.813) -- 0:00:09
837500 -- (-333.559) (-335.758) [-334.088] (-334.342) * (-336.416) [-335.715] (-333.679) (-333.413) -- 0:00:09
838000 -- [-333.963] (-335.082) (-336.673) (-336.940) * (-338.195) (-333.975) (-332.753) [-332.929] -- 0:00:09
838500 -- (-334.645) (-332.985) (-335.048) [-333.448] * [-338.892] (-335.753) (-336.948) (-334.224) -- 0:00:09
839000 -- (-333.862) [-335.728] (-333.532) (-337.412) * (-337.132) (-333.953) (-341.308) [-333.087] -- 0:00:09
839500 -- (-335.791) (-334.973) (-333.756) [-333.821] * (-336.685) (-334.223) (-340.511) [-332.811] -- 0:00:09
840000 -- (-336.239) (-338.285) [-335.192] (-333.166) * [-333.037] (-335.761) (-337.125) (-333.797) -- 0:00:09
Average standard deviation of split frequencies: 0.008785
840500 -- (-343.462) (-337.384) (-338.077) [-335.421] * [-333.629] (-342.156) (-336.733) (-333.899) -- 0:00:09
841000 -- (-337.027) [-335.277] (-334.501) (-339.973) * (-334.403) (-334.261) (-337.665) [-333.560] -- 0:00:09
841500 -- (-334.779) (-334.062) (-334.143) [-333.991] * [-333.086] (-338.244) (-334.016) (-333.754) -- 0:00:09
842000 -- (-333.755) (-340.102) (-332.857) [-334.155] * (-334.465) [-335.739] (-334.019) (-333.910) -- 0:00:09
842500 -- (-333.197) (-335.538) [-332.670] (-341.009) * (-334.543) (-338.392) [-336.549] (-332.383) -- 0:00:09
843000 -- (-337.090) (-335.697) [-334.911] (-335.695) * [-335.047] (-334.244) (-333.366) (-332.758) -- 0:00:09
843500 -- (-336.019) (-333.737) (-332.176) [-333.345] * [-335.703] (-333.699) (-333.541) (-333.172) -- 0:00:09
844000 -- (-335.889) (-335.106) (-333.866) [-333.826] * (-336.839) (-340.799) (-334.405) [-335.504] -- 0:00:09
844500 -- (-334.547) (-333.002) (-337.107) [-332.268] * (-336.284) (-335.206) [-334.171] (-337.215) -- 0:00:09
845000 -- (-334.445) (-333.251) (-333.025) [-336.097] * [-333.837] (-334.439) (-336.586) (-334.213) -- 0:00:09
Average standard deviation of split frequencies: 0.008247
845500 -- (-337.331) [-332.976] (-333.698) (-336.341) * (-334.128) [-334.460] (-332.959) (-338.935) -- 0:00:09
846000 -- (-334.433) [-334.302] (-338.075) (-334.768) * (-332.602) (-334.080) [-332.787] (-338.866) -- 0:00:09
846500 -- (-335.266) [-332.824] (-333.149) (-332.628) * [-333.074] (-334.731) (-333.979) (-336.719) -- 0:00:09
847000 -- (-333.568) (-333.033) (-338.213) [-334.754] * (-335.562) (-332.960) [-335.858] (-334.688) -- 0:00:09
847500 -- [-332.860] (-333.773) (-335.538) (-334.389) * (-334.941) [-334.530] (-335.095) (-334.427) -- 0:00:08
848000 -- (-332.581) (-333.587) [-333.606] (-333.322) * (-334.648) (-335.580) [-334.938] (-333.588) -- 0:00:08
848500 -- (-345.496) (-336.277) (-336.705) [-336.113] * (-333.429) (-335.501) (-333.169) [-333.290] -- 0:00:08
849000 -- [-333.282] (-334.388) (-334.068) (-339.297) * [-333.465] (-337.187) (-334.453) (-335.162) -- 0:00:08
849500 -- (-334.964) (-336.315) [-334.933] (-333.246) * (-334.320) (-339.765) [-332.474] (-336.051) -- 0:00:08
850000 -- (-334.195) (-334.903) [-337.253] (-332.483) * (-333.959) (-333.798) (-333.191) [-332.774] -- 0:00:08
Average standard deviation of split frequencies: 0.008460
850500 -- (-335.305) [-333.828] (-335.566) (-334.311) * [-338.120] (-333.863) (-332.716) (-334.361) -- 0:00:08
851000 -- (-336.047) [-333.556] (-334.821) (-335.945) * (-338.549) (-337.182) (-333.814) [-332.852] -- 0:00:08
851500 -- [-335.238] (-332.999) (-335.845) (-334.341) * [-334.407] (-337.535) (-333.032) (-334.286) -- 0:00:08
852000 -- (-333.820) (-339.639) [-333.256] (-335.580) * (-333.565) (-332.803) (-332.616) [-333.510] -- 0:00:08
852500 -- (-333.666) (-337.795) [-336.309] (-341.295) * (-337.444) (-337.480) [-333.070] (-336.041) -- 0:00:08
853000 -- (-337.129) (-333.582) [-333.456] (-333.441) * (-334.085) (-335.631) [-334.308] (-339.154) -- 0:00:08
853500 -- [-333.951] (-333.572) (-333.711) (-334.588) * (-334.740) (-335.512) (-336.049) [-334.901] -- 0:00:08
854000 -- (-335.815) (-334.760) (-336.423) [-333.612] * (-338.219) (-335.157) (-333.540) [-336.251] -- 0:00:08
854500 -- (-333.757) [-336.610] (-336.401) (-332.328) * [-333.033] (-340.179) (-336.056) (-334.904) -- 0:00:08
855000 -- (-334.906) [-334.006] (-332.968) (-337.410) * [-338.114] (-335.529) (-337.140) (-332.528) -- 0:00:08
Average standard deviation of split frequencies: 0.008995
855500 -- (-334.271) [-334.607] (-333.689) (-338.862) * (-332.551) [-332.554] (-338.248) (-336.345) -- 0:00:08
856000 -- (-337.902) [-337.709] (-333.902) (-333.977) * (-332.780) [-333.568] (-336.931) (-333.986) -- 0:00:08
856500 -- (-333.462) [-334.676] (-334.498) (-332.539) * [-335.257] (-334.211) (-333.386) (-334.422) -- 0:00:08
857000 -- (-334.072) (-336.384) [-334.388] (-335.003) * (-333.683) (-336.351) (-332.758) [-332.689] -- 0:00:08
857500 -- (-334.908) [-334.549] (-334.023) (-334.977) * (-334.576) (-334.121) (-333.787) [-335.211] -- 0:00:08
858000 -- [-332.686] (-332.940) (-338.249) (-334.625) * (-332.931) (-334.763) (-335.087) [-335.222] -- 0:00:08
858500 -- (-335.345) [-332.011] (-335.871) (-335.362) * (-334.882) (-335.813) [-336.139] (-339.236) -- 0:00:08
859000 -- [-334.995] (-335.198) (-340.865) (-333.741) * [-333.468] (-333.991) (-333.654) (-336.476) -- 0:00:08
859500 -- (-334.064) [-333.449] (-333.502) (-338.154) * (-333.229) [-333.629] (-334.632) (-335.288) -- 0:00:08
860000 -- (-333.909) [-333.292] (-336.633) (-335.038) * (-333.000) (-335.185) (-336.394) [-338.417] -- 0:00:08
Average standard deviation of split frequencies: 0.009275
860500 -- [-334.505] (-333.283) (-335.967) (-332.218) * (-335.121) (-334.160) (-336.281) [-334.137] -- 0:00:08
861000 -- (-334.725) [-337.603] (-332.440) (-336.634) * (-333.931) (-336.785) (-340.930) [-333.035] -- 0:00:08
861500 -- (-335.614) [-332.817] (-334.217) (-334.255) * [-336.247] (-332.899) (-340.483) (-333.762) -- 0:00:08
862000 -- (-332.751) (-337.566) (-333.391) [-333.787] * [-333.099] (-333.621) (-336.812) (-333.839) -- 0:00:08
862500 -- [-335.093] (-334.091) (-340.766) (-337.484) * (-332.693) (-333.419) (-336.983) [-333.214] -- 0:00:08
863000 -- (-333.649) (-333.951) [-333.543] (-336.545) * (-334.320) [-333.813] (-335.905) (-333.434) -- 0:00:08
863500 -- (-335.435) (-332.831) [-336.509] (-333.967) * (-334.362) (-334.348) [-334.967] (-336.964) -- 0:00:08
864000 -- (-334.634) [-334.247] (-335.735) (-334.289) * [-334.786] (-334.212) (-335.973) (-335.333) -- 0:00:08
864500 -- (-336.885) (-334.273) (-334.151) [-333.080] * (-334.915) [-332.683] (-335.730) (-333.367) -- 0:00:07
865000 -- (-335.163) (-334.925) (-334.135) [-333.017] * (-334.447) [-333.425] (-332.787) (-337.941) -- 0:00:07
Average standard deviation of split frequencies: 0.009399
865500 -- [-333.064] (-333.343) (-335.494) (-332.937) * (-332.930) (-337.384) (-335.206) [-334.316] -- 0:00:07
866000 -- (-335.223) [-333.087] (-333.633) (-334.052) * (-337.967) [-335.009] (-335.756) (-335.765) -- 0:00:07
866500 -- [-333.347] (-336.708) (-333.767) (-337.349) * (-335.317) (-333.809) [-333.176] (-334.350) -- 0:00:07
867000 -- (-333.692) (-335.698) (-338.542) [-334.029] * [-332.829] (-333.349) (-333.017) (-334.267) -- 0:00:07
867500 -- (-337.699) [-335.479] (-337.778) (-335.835) * (-334.041) (-332.958) [-335.208] (-335.540) -- 0:00:07
868000 -- (-332.821) [-333.272] (-336.466) (-338.339) * (-335.043) (-338.993) [-335.420] (-333.818) -- 0:00:07
868500 -- (-336.473) (-333.567) (-337.682) [-336.638] * (-336.505) (-333.757) (-333.511) [-332.562] -- 0:00:07
869000 -- (-334.778) (-332.549) [-332.789] (-338.741) * (-333.078) [-333.900] (-334.440) (-333.351) -- 0:00:07
869500 -- (-334.907) [-332.381] (-335.969) (-333.722) * (-333.930) (-337.217) [-333.305] (-332.534) -- 0:00:07
870000 -- (-335.170) (-334.212) [-333.982] (-336.190) * (-333.930) (-333.503) (-335.536) [-332.807] -- 0:00:07
Average standard deviation of split frequencies: 0.009746
870500 -- (-338.743) (-333.987) [-334.182] (-334.850) * (-334.282) [-334.577] (-335.272) (-334.317) -- 0:00:07
871000 -- (-339.739) (-336.027) (-336.205) [-336.315] * [-334.737] (-336.141) (-342.171) (-335.659) -- 0:00:07
871500 -- (-337.580) (-336.421) (-335.719) [-332.462] * (-334.591) (-333.842) [-335.572] (-332.984) -- 0:00:07
872000 -- (-335.084) (-337.708) [-333.170] (-334.986) * (-333.028) (-335.872) (-340.058) [-335.297] -- 0:00:07
872500 -- (-333.724) [-336.072] (-332.810) (-333.355) * (-335.251) (-336.535) [-335.172] (-335.663) -- 0:00:07
873000 -- (-333.037) (-333.476) (-333.785) [-332.786] * (-336.344) [-334.582] (-334.039) (-336.807) -- 0:00:07
873500 -- [-333.838] (-335.369) (-337.299) (-334.500) * (-333.145) (-342.798) [-335.151] (-332.895) -- 0:00:07
874000 -- (-335.859) (-335.488) [-335.912] (-333.851) * (-333.278) (-334.497) (-334.829) [-333.992] -- 0:00:07
874500 -- (-333.945) (-338.774) (-334.289) [-332.932] * (-334.777) (-337.281) [-334.860] (-332.733) -- 0:00:07
875000 -- [-333.464] (-337.752) (-338.328) (-335.074) * (-334.405) (-332.793) [-336.499] (-333.166) -- 0:00:07
Average standard deviation of split frequencies: 0.009615
875500 -- (-335.844) (-333.301) [-332.954] (-335.416) * (-333.533) [-333.926] (-335.569) (-333.420) -- 0:00:07
876000 -- (-336.049) (-333.308) (-335.016) [-334.312] * [-333.426] (-333.898) (-334.470) (-335.532) -- 0:00:07
876500 -- (-333.415) (-334.176) [-333.147] (-336.823) * (-336.184) [-339.658] (-336.585) (-333.450) -- 0:00:07
877000 -- [-334.628] (-334.975) (-334.338) (-338.233) * [-333.279] (-338.187) (-338.007) (-332.454) -- 0:00:07
877500 -- (-335.189) (-332.987) (-335.502) [-333.450] * (-337.393) [-335.333] (-334.066) (-333.295) -- 0:00:07
878000 -- (-334.890) (-332.763) (-334.838) [-335.054] * [-333.825] (-336.109) (-341.668) (-334.507) -- 0:00:07
878500 -- [-333.510] (-333.425) (-340.099) (-332.978) * (-332.785) (-334.638) (-335.505) [-333.247] -- 0:00:07
879000 -- (-332.961) (-337.604) (-335.416) [-333.715] * [-334.083] (-334.908) (-336.738) (-332.559) -- 0:00:07
879500 -- [-334.327] (-338.473) (-336.458) (-337.189) * (-333.250) [-335.187] (-337.431) (-333.327) -- 0:00:07
880000 -- (-334.826) (-334.433) (-335.793) [-334.095] * [-334.255] (-339.083) (-338.960) (-335.523) -- 0:00:07
Average standard deviation of split frequencies: 0.009350
880500 -- (-340.753) (-334.892) [-333.426] (-332.728) * (-335.158) (-334.995) (-339.312) [-333.959] -- 0:00:07
881000 -- (-334.076) [-333.135] (-334.774) (-332.303) * (-334.543) (-334.351) [-334.685] (-333.782) -- 0:00:07
881500 -- (-332.889) [-334.135] (-332.609) (-333.456) * [-335.347] (-334.359) (-337.908) (-336.060) -- 0:00:06
882000 -- (-333.385) (-333.599) [-332.557] (-334.289) * [-335.418] (-334.501) (-335.412) (-334.856) -- 0:00:06
882500 -- (-340.587) [-334.639] (-333.913) (-333.033) * (-334.054) [-334.140] (-336.458) (-336.732) -- 0:00:06
883000 -- (-334.824) (-335.210) (-335.480) [-334.599] * (-336.564) (-334.966) [-333.330] (-336.343) -- 0:00:06
883500 -- (-334.647) (-333.582) [-336.787] (-336.205) * (-332.887) [-334.795] (-333.663) (-335.302) -- 0:00:06
884000 -- (-334.667) (-332.188) [-334.845] (-333.118) * (-333.481) [-333.557] (-333.037) (-335.593) -- 0:00:06
884500 -- (-334.223) [-333.229] (-334.179) (-341.138) * [-332.716] (-335.362) (-335.419) (-334.811) -- 0:00:06
885000 -- (-333.857) (-334.476) (-332.733) [-338.420] * (-333.273) [-333.746] (-338.295) (-335.578) -- 0:00:06
Average standard deviation of split frequencies: 0.009116
885500 -- (-336.791) (-332.626) (-333.757) [-335.745] * [-332.581] (-345.473) (-334.289) (-334.064) -- 0:00:06
886000 -- (-337.425) (-332.658) (-333.154) [-333.177] * (-332.760) (-338.545) (-335.376) [-334.634] -- 0:00:06
886500 -- [-337.083] (-332.056) (-334.043) (-336.125) * (-334.177) (-334.111) (-335.288) [-334.357] -- 0:00:06
887000 -- (-334.836) (-333.502) (-333.699) [-335.448] * (-334.143) (-333.678) [-332.640] (-337.858) -- 0:00:06
887500 -- (-334.671) [-334.686] (-335.409) (-333.949) * (-334.398) (-337.566) [-332.595] (-335.369) -- 0:00:06
888000 -- [-336.807] (-337.294) (-341.357) (-336.678) * (-332.919) (-334.853) (-334.362) [-335.221] -- 0:00:06
888500 -- (-335.497) (-332.586) [-332.370] (-338.621) * (-336.844) (-334.073) [-333.585] (-335.195) -- 0:00:06
889000 -- (-336.244) [-333.130] (-332.369) (-334.744) * (-337.163) (-337.510) (-333.592) [-334.400] -- 0:00:06
889500 -- (-334.633) [-332.278] (-335.046) (-335.948) * (-334.904) (-333.958) (-334.137) [-332.114] -- 0:00:06
890000 -- (-333.660) (-333.477) (-335.841) [-332.769] * (-337.658) (-333.777) [-334.825] (-334.368) -- 0:00:06
Average standard deviation of split frequencies: 0.008715
890500 -- (-334.497) (-334.383) (-335.593) [-333.277] * [-336.672] (-340.370) (-335.530) (-333.369) -- 0:00:06
891000 -- (-336.610) [-335.863] (-343.154) (-335.259) * [-333.499] (-335.915) (-333.400) (-332.977) -- 0:00:06
891500 -- (-333.177) (-332.992) (-333.623) [-334.131] * (-333.158) (-333.535) [-333.318] (-333.935) -- 0:00:06
892000 -- (-333.185) (-334.746) (-335.362) [-334.679] * (-333.189) (-333.587) [-333.176] (-333.492) -- 0:00:06
892500 -- (-333.575) [-336.429] (-338.568) (-333.170) * [-334.486] (-335.600) (-333.042) (-335.436) -- 0:00:06
893000 -- (-334.309) [-336.345] (-336.092) (-335.321) * (-332.659) (-333.952) (-335.947) [-335.526] -- 0:00:06
893500 -- (-335.113) [-333.913] (-335.319) (-337.889) * [-333.617] (-334.056) (-339.010) (-337.819) -- 0:00:06
894000 -- (-335.963) (-333.646) (-333.235) [-333.027] * [-333.766] (-334.868) (-335.899) (-333.260) -- 0:00:06
894500 -- [-336.277] (-332.710) (-332.817) (-332.931) * [-334.839] (-332.967) (-336.224) (-333.445) -- 0:00:06
895000 -- (-334.599) [-332.823] (-332.397) (-333.575) * (-334.863) [-335.167] (-335.188) (-333.675) -- 0:00:06
Average standard deviation of split frequencies: 0.009014
895500 -- [-337.024] (-335.603) (-334.723) (-335.824) * (-337.691) [-334.821] (-334.766) (-339.836) -- 0:00:06
896000 -- (-335.336) (-334.336) (-333.206) [-333.807] * (-336.726) [-334.551] (-333.615) (-336.959) -- 0:00:06
896500 -- [-337.564] (-336.012) (-337.374) (-336.676) * (-335.876) (-333.656) [-332.566] (-332.669) -- 0:00:06
897000 -- (-335.573) (-335.171) [-334.205] (-335.011) * [-333.804] (-332.997) (-333.346) (-333.988) -- 0:00:06
897500 -- [-332.896] (-338.006) (-334.500) (-334.025) * (-335.823) (-334.217) [-334.228] (-332.489) -- 0:00:06
898000 -- (-332.414) (-334.596) [-336.127] (-336.852) * (-332.962) (-341.470) (-333.980) [-332.401] -- 0:00:06
898500 -- (-335.700) (-333.215) [-333.284] (-338.501) * [-335.576] (-333.993) (-332.805) (-334.109) -- 0:00:05
899000 -- (-335.519) [-332.822] (-332.748) (-341.677) * (-333.512) (-333.273) (-334.386) [-335.513] -- 0:00:05
899500 -- (-333.088) [-334.684] (-334.380) (-333.851) * (-335.626) [-333.055] (-334.252) (-334.227) -- 0:00:05
900000 -- (-333.863) (-336.001) (-333.313) [-333.835] * (-336.218) [-335.184] (-333.355) (-333.638) -- 0:00:05
Average standard deviation of split frequencies: 0.009247
900500 -- (-333.794) (-336.546) (-334.527) [-333.883] * (-334.784) (-335.842) (-333.686) [-334.674] -- 0:00:05
901000 -- [-335.180] (-333.942) (-335.392) (-334.963) * [-334.259] (-334.347) (-333.885) (-333.404) -- 0:00:05
901500 -- (-333.447) (-333.071) [-334.165] (-336.742) * (-334.623) (-334.444) (-333.191) [-333.630] -- 0:00:05
902000 -- (-333.897) [-335.910] (-335.451) (-336.008) * (-333.295) [-333.349] (-336.086) (-334.518) -- 0:00:05
902500 -- (-332.522) (-333.026) (-335.872) [-333.068] * [-338.252] (-333.406) (-332.906) (-335.829) -- 0:00:05
903000 -- (-332.340) [-333.626] (-336.720) (-334.356) * (-336.087) (-335.199) (-335.312) [-334.872] -- 0:00:05
903500 -- (-333.405) (-336.431) [-335.245] (-337.429) * (-334.958) [-334.271] (-335.907) (-333.648) -- 0:00:05
904000 -- (-333.617) (-335.338) [-335.694] (-335.288) * (-335.919) (-340.490) [-335.346] (-333.387) -- 0:00:05
904500 -- (-334.585) (-335.559) [-336.312] (-333.281) * [-338.455] (-336.649) (-333.759) (-333.297) -- 0:00:05
905000 -- (-340.132) (-333.059) [-338.134] (-334.086) * (-336.244) [-334.334] (-335.208) (-332.703) -- 0:00:05
Average standard deviation of split frequencies: 0.009088
905500 -- [-333.529] (-332.906) (-335.889) (-334.148) * (-336.171) [-334.227] (-340.153) (-336.164) -- 0:00:05
906000 -- (-333.720) (-333.817) (-335.079) [-333.208] * (-333.762) (-333.129) [-333.266] (-333.676) -- 0:00:05
906500 -- [-334.713] (-333.224) (-333.845) (-334.233) * [-333.405] (-336.492) (-335.089) (-334.759) -- 0:00:05
907000 -- (-338.486) (-335.847) [-336.116] (-332.947) * (-333.845) (-334.612) (-335.391) [-333.925] -- 0:00:05
907500 -- (-333.886) (-334.836) [-332.401] (-336.719) * (-335.439) (-339.146) [-335.794] (-335.528) -- 0:00:05
908000 -- (-333.004) (-341.844) [-336.273] (-333.828) * [-335.220] (-336.472) (-335.161) (-333.851) -- 0:00:05
908500 -- (-334.395) (-332.860) [-332.796] (-335.614) * (-336.442) [-334.839] (-335.488) (-336.142) -- 0:00:05
909000 -- (-332.805) [-332.971] (-336.164) (-332.798) * (-337.441) [-334.003] (-335.189) (-340.356) -- 0:00:05
909500 -- (-333.841) (-333.501) [-334.422] (-336.864) * (-336.296) (-332.524) [-333.244] (-336.720) -- 0:00:05
910000 -- (-335.515) [-333.958] (-334.649) (-336.080) * [-333.792] (-334.421) (-334.900) (-334.044) -- 0:00:05
Average standard deviation of split frequencies: 0.009007
910500 -- (-334.557) (-335.482) (-334.034) [-333.403] * [-335.176] (-332.763) (-335.679) (-338.585) -- 0:00:05
911000 -- [-334.277] (-334.413) (-337.916) (-332.396) * (-334.209) (-333.686) (-336.011) [-336.808] -- 0:00:05
911500 -- (-333.837) (-335.717) (-338.478) [-332.702] * (-334.054) (-334.118) (-337.634) [-332.583] -- 0:00:05
912000 -- (-334.691) (-334.555) (-335.699) [-335.324] * [-339.525] (-334.190) (-334.112) (-333.764) -- 0:00:05
912500 -- (-342.431) (-334.469) [-333.483] (-334.011) * (-335.106) (-333.975) (-334.553) [-332.625] -- 0:00:05
913000 -- (-335.349) [-333.083] (-333.319) (-334.634) * [-335.191] (-338.332) (-333.887) (-334.264) -- 0:00:05
913500 -- [-332.629] (-332.382) (-332.853) (-333.742) * (-338.176) [-333.383] (-333.281) (-334.563) -- 0:00:05
914000 -- (-332.182) (-333.589) [-334.678] (-334.352) * (-338.568) (-333.378) (-333.995) [-335.310] -- 0:00:05
914500 -- [-332.595] (-336.724) (-334.312) (-333.589) * (-336.748) [-334.711] (-338.490) (-337.125) -- 0:00:05
915000 -- (-333.460) (-332.914) [-333.880] (-333.916) * [-335.312] (-333.261) (-335.181) (-334.382) -- 0:00:05
Average standard deviation of split frequencies: 0.008920
915500 -- (-337.714) (-332.671) [-333.652] (-333.961) * (-334.388) (-335.421) (-336.342) [-333.797] -- 0:00:04
916000 -- (-332.643) (-333.199) [-334.017] (-333.474) * [-332.735] (-335.483) (-334.228) (-333.482) -- 0:00:04
916500 -- [-333.707] (-342.500) (-338.280) (-333.765) * (-333.341) (-337.578) (-335.375) [-333.356] -- 0:00:04
917000 -- (-333.678) [-334.881] (-334.617) (-333.097) * (-333.458) (-332.656) [-334.279] (-336.857) -- 0:00:04
917500 -- (-335.283) (-335.199) [-333.492] (-335.514) * (-332.720) (-338.721) [-333.234] (-335.375) -- 0:00:04
918000 -- (-333.414) [-334.982] (-333.269) (-334.003) * (-333.930) [-334.514] (-336.984) (-335.384) -- 0:00:04
918500 -- (-334.988) [-333.998] (-336.145) (-333.078) * (-334.407) (-333.938) (-334.210) [-336.121] -- 0:00:04
919000 -- (-332.900) (-337.140) [-334.779] (-334.004) * (-333.250) (-333.377) (-333.899) [-334.391] -- 0:00:04
919500 -- [-332.934] (-338.644) (-333.831) (-332.471) * (-335.551) (-332.846) (-334.466) [-335.567] -- 0:00:04
920000 -- (-333.477) [-333.408] (-337.976) (-334.833) * [-333.312] (-335.446) (-333.216) (-335.369) -- 0:00:04
Average standard deviation of split frequencies: 0.008329
920500 -- (-336.789) (-334.451) (-339.662) [-336.806] * [-332.520] (-336.132) (-336.905) (-334.620) -- 0:00:04
921000 -- (-333.426) [-336.844] (-339.000) (-335.586) * (-333.713) [-334.582] (-336.372) (-334.896) -- 0:00:04
921500 -- (-333.375) [-333.709] (-336.875) (-334.254) * [-333.714] (-332.881) (-335.062) (-334.241) -- 0:00:04
922000 -- (-336.355) (-337.672) [-337.611] (-333.891) * (-334.231) (-333.970) [-335.214] (-339.436) -- 0:00:04
922500 -- [-334.179] (-338.405) (-339.714) (-333.740) * [-334.719] (-336.804) (-336.245) (-333.346) -- 0:00:04
923000 -- [-333.801] (-335.093) (-332.785) (-343.989) * (-336.926) (-332.689) [-338.064] (-332.620) -- 0:00:04
923500 -- [-334.305] (-338.495) (-338.672) (-335.182) * (-334.103) (-332.576) [-333.237] (-335.003) -- 0:00:04
924000 -- [-334.942] (-334.556) (-335.598) (-334.987) * (-333.711) [-332.092] (-334.677) (-334.641) -- 0:00:04
924500 -- (-333.222) [-332.502] (-333.697) (-333.109) * [-334.678] (-335.193) (-332.868) (-334.386) -- 0:00:04
925000 -- (-334.811) (-333.882) [-333.948] (-335.004) * (-335.116) [-335.534] (-336.276) (-335.494) -- 0:00:04
Average standard deviation of split frequencies: 0.008417
925500 -- (-334.760) (-335.488) [-332.824] (-342.706) * (-334.058) (-335.294) (-334.104) [-334.267] -- 0:00:04
926000 -- (-335.750) (-333.788) (-336.304) [-333.265] * [-333.644] (-333.485) (-336.342) (-333.616) -- 0:00:04
926500 -- (-335.055) (-336.613) [-333.582] (-337.936) * (-335.928) (-334.672) (-332.216) [-334.397] -- 0:00:04
927000 -- (-337.637) [-336.432] (-334.881) (-335.942) * (-335.011) [-339.046] (-334.495) (-333.512) -- 0:00:04
927500 -- (-335.775) (-334.504) [-332.623] (-339.615) * (-333.048) [-339.624] (-333.201) (-334.508) -- 0:00:04
928000 -- (-333.088) (-335.683) (-333.499) [-338.878] * [-339.833] (-333.348) (-334.820) (-337.421) -- 0:00:04
928500 -- (-333.184) (-333.435) [-333.315] (-336.165) * (-336.057) (-335.753) (-335.447) [-333.532] -- 0:00:04
929000 -- (-332.781) (-335.923) [-333.189] (-334.281) * [-335.960] (-334.899) (-334.299) (-332.280) -- 0:00:04
929500 -- (-336.921) (-334.090) [-333.331] (-334.852) * (-333.117) (-334.467) [-334.093] (-335.558) -- 0:00:04
930000 -- (-333.498) (-336.921) (-332.768) [-333.582] * (-332.775) (-337.084) [-334.228] (-333.843) -- 0:00:04
Average standard deviation of split frequencies: 0.008577
930500 -- (-333.369) [-335.600] (-333.197) (-337.426) * (-333.663) (-335.408) (-333.928) [-335.130] -- 0:00:04
931000 -- (-338.540) (-336.779) [-332.660] (-334.360) * (-336.359) (-337.186) (-335.220) [-335.981] -- 0:00:04
931500 -- (-336.263) [-334.876] (-334.970) (-334.375) * (-339.900) (-333.504) (-334.545) [-334.367] -- 0:00:04
932000 -- (-334.839) [-332.432] (-340.997) (-333.238) * (-337.569) (-334.067) (-338.930) [-332.652] -- 0:00:04
932500 -- (-334.853) [-334.440] (-335.580) (-333.328) * (-333.182) (-334.710) [-334.491] (-332.702) -- 0:00:03
933000 -- (-334.877) [-333.871] (-335.267) (-333.195) * (-333.164) (-334.230) (-335.768) [-332.300] -- 0:00:03
933500 -- (-335.065) (-333.281) [-334.407] (-332.804) * (-332.503) (-333.998) (-335.122) [-333.031] -- 0:00:03
934000 -- (-333.854) (-333.545) (-334.162) [-335.158] * (-334.588) [-334.730] (-334.461) (-334.967) -- 0:00:03
934500 -- (-337.862) (-332.643) (-336.892) [-333.145] * (-333.671) (-332.648) [-334.455] (-338.277) -- 0:00:03
935000 -- (-335.266) [-333.811] (-334.760) (-333.131) * (-332.612) [-332.830] (-335.605) (-336.942) -- 0:00:03
Average standard deviation of split frequencies: 0.008293
935500 -- (-333.204) (-334.343) (-334.864) [-334.486] * [-332.870] (-333.030) (-336.344) (-337.043) -- 0:00:03
936000 -- [-333.956] (-335.292) (-334.016) (-334.789) * (-333.422) [-333.186] (-338.917) (-334.200) -- 0:00:03
936500 -- (-332.884) [-334.483] (-333.138) (-333.783) * (-335.440) [-334.950] (-332.835) (-335.772) -- 0:00:03
937000 -- (-335.734) (-333.996) (-333.694) [-333.843] * [-334.411] (-337.464) (-333.221) (-333.105) -- 0:00:03
937500 -- [-333.176] (-334.393) (-336.259) (-334.666) * (-332.863) [-334.350] (-334.410) (-333.331) -- 0:00:03
938000 -- [-334.513] (-334.050) (-334.387) (-336.045) * (-334.657) [-334.852] (-336.187) (-336.356) -- 0:00:03
938500 -- (-340.635) (-333.514) [-335.375] (-335.651) * (-334.106) [-334.428] (-334.714) (-332.877) -- 0:00:03
939000 -- (-334.693) (-339.797) (-334.179) [-334.035] * (-333.683) (-335.988) (-335.979) [-336.451] -- 0:00:03
939500 -- (-336.300) (-338.753) (-332.933) [-333.660] * (-339.475) [-333.887] (-335.963) (-334.312) -- 0:00:03
940000 -- (-334.347) [-335.738] (-332.891) (-334.206) * (-333.192) [-332.786] (-332.811) (-334.195) -- 0:00:03
Average standard deviation of split frequencies: 0.008553
940500 -- (-336.146) (-333.241) [-334.900] (-334.350) * (-333.295) (-333.649) (-334.279) [-333.024] -- 0:00:03
941000 -- [-333.611] (-335.063) (-333.953) (-337.082) * (-333.224) (-333.021) [-334.742] (-335.321) -- 0:00:03
941500 -- [-335.010] (-336.193) (-334.537) (-338.951) * (-335.881) (-332.643) (-334.660) [-334.587] -- 0:00:03
942000 -- [-334.527] (-335.576) (-337.177) (-332.187) * (-336.732) [-333.773] (-333.044) (-335.947) -- 0:00:03
942500 -- (-333.940) [-334.068] (-335.061) (-333.142) * [-339.864] (-334.355) (-334.682) (-342.452) -- 0:00:03
943000 -- [-333.948] (-336.540) (-334.438) (-334.906) * (-339.932) (-334.216) (-334.314) [-333.943] -- 0:00:03
943500 -- (-332.963) (-333.555) (-335.756) [-333.617] * (-333.710) (-333.781) (-334.068) [-333.596] -- 0:00:03
944000 -- (-336.310) (-333.716) (-333.088) [-334.965] * (-333.834) [-332.488] (-334.665) (-336.381) -- 0:00:03
944500 -- (-335.791) (-336.491) [-333.065] (-335.354) * (-332.661) (-333.308) (-332.772) [-334.309] -- 0:00:03
945000 -- (-335.439) (-334.375) (-336.251) [-332.560] * [-333.220] (-333.096) (-332.454) (-336.759) -- 0:00:03
Average standard deviation of split frequencies: 0.008770
945500 -- (-335.318) (-338.570) [-335.417] (-335.266) * [-336.252] (-335.934) (-332.463) (-334.806) -- 0:00:03
946000 -- [-335.496] (-334.984) (-334.800) (-335.608) * (-333.965) (-338.201) (-334.374) [-333.751] -- 0:00:03
946500 -- (-335.930) (-335.541) (-332.383) [-336.239] * (-333.085) (-334.761) (-333.621) [-332.753] -- 0:00:03
947000 -- (-337.027) (-335.813) (-335.531) [-333.313] * (-342.832) [-335.430] (-332.997) (-332.911) -- 0:00:03
947500 -- [-334.981] (-333.948) (-333.384) (-334.859) * [-337.586] (-334.311) (-333.313) (-338.820) -- 0:00:03
948000 -- (-334.461) (-336.765) [-334.200] (-333.697) * (-333.725) (-336.148) (-333.254) [-333.932] -- 0:00:03
948500 -- [-333.004] (-333.988) (-334.881) (-336.076) * (-335.866) (-340.826) (-333.991) [-333.797] -- 0:00:03
949000 -- (-332.772) [-335.245] (-337.275) (-333.737) * (-332.935) [-333.740] (-334.070) (-335.976) -- 0:00:03
949500 -- (-333.689) [-333.491] (-337.622) (-336.308) * (-333.765) [-332.698] (-333.472) (-333.562) -- 0:00:02
950000 -- (-333.770) (-334.442) [-334.637] (-334.031) * [-336.550] (-333.825) (-332.647) (-336.000) -- 0:00:02
Average standard deviation of split frequencies: 0.008430
950500 -- (-332.909) (-334.156) (-333.508) [-333.460] * (-334.021) (-337.082) [-333.792] (-334.970) -- 0:00:02
951000 -- (-335.342) (-340.579) (-338.218) [-334.492] * (-335.490) [-335.652] (-335.724) (-338.722) -- 0:00:02
951500 -- (-337.798) (-334.308) (-335.443) [-336.013] * (-333.819) (-334.294) (-333.055) [-334.069] -- 0:00:02
952000 -- (-342.778) (-334.848) [-334.195] (-333.941) * (-333.439) (-334.632) [-332.688] (-332.599) -- 0:00:02
952500 -- [-337.783] (-333.914) (-333.262) (-332.662) * [-332.841] (-336.305) (-332.822) (-335.271) -- 0:00:02
953000 -- [-333.895] (-337.029) (-335.131) (-332.866) * (-336.089) [-336.306] (-333.686) (-332.603) -- 0:00:02
953500 -- (-332.430) [-333.918] (-333.661) (-332.399) * (-333.956) [-332.941] (-334.488) (-335.770) -- 0:00:02
954000 -- (-334.595) (-332.584) (-334.339) [-334.886] * [-336.291] (-336.565) (-334.970) (-336.308) -- 0:00:02
954500 -- (-333.009) [-332.825] (-333.425) (-334.576) * (-336.242) (-334.557) [-333.124] (-336.083) -- 0:00:02
955000 -- (-335.598) (-332.968) [-333.743] (-335.084) * [-336.822] (-335.001) (-332.970) (-332.568) -- 0:00:02
Average standard deviation of split frequencies: 0.008087
955500 -- (-335.489) (-334.633) [-333.198] (-337.407) * (-336.578) (-332.811) [-332.253] (-332.128) -- 0:00:02
956000 -- (-333.186) (-334.866) [-332.850] (-333.528) * (-337.957) (-332.884) [-335.545] (-334.610) -- 0:00:02
956500 -- (-333.093) [-334.194] (-332.907) (-339.517) * (-332.947) (-333.180) [-336.306] (-333.555) -- 0:00:02
957000 -- (-334.425) (-333.413) [-332.461] (-335.643) * (-335.297) (-333.550) [-336.545] (-334.053) -- 0:00:02
957500 -- (-334.227) (-333.387) (-333.170) [-336.672] * [-334.146] (-335.458) (-336.136) (-333.813) -- 0:00:02
958000 -- (-332.292) [-334.145] (-333.893) (-335.315) * (-335.464) (-333.748) [-333.728] (-337.539) -- 0:00:02
958500 -- [-332.644] (-333.941) (-336.965) (-334.765) * (-340.164) (-332.976) (-333.226) [-334.571] -- 0:00:02
959000 -- [-333.956] (-333.109) (-334.875) (-333.600) * (-336.242) (-336.774) (-334.798) [-333.775] -- 0:00:02
959500 -- (-334.542) (-335.262) (-335.090) [-334.534] * (-335.838) (-334.640) [-333.997] (-333.059) -- 0:00:02
960000 -- [-335.624] (-341.806) (-334.914) (-337.217) * (-336.373) (-334.678) [-334.392] (-339.227) -- 0:00:02
Average standard deviation of split frequencies: 0.008277
960500 -- (-338.351) [-335.238] (-337.523) (-333.685) * (-333.748) (-333.276) (-335.080) [-333.089] -- 0:00:02
961000 -- (-337.232) (-332.037) [-333.018] (-333.222) * (-335.671) (-333.730) [-334.415] (-334.303) -- 0:00:02
961500 -- [-333.740] (-336.883) (-334.734) (-335.615) * (-334.774) (-332.853) (-337.967) [-334.781] -- 0:00:02
962000 -- (-333.777) (-337.563) [-333.506] (-333.499) * (-337.229) [-333.366] (-333.029) (-335.689) -- 0:00:02
962500 -- (-334.765) (-335.908) (-333.298) [-333.378] * (-333.559) [-332.582] (-335.075) (-336.998) -- 0:00:02
963000 -- (-336.187) [-333.298] (-334.765) (-336.431) * (-333.278) (-338.706) (-336.150) [-333.522] -- 0:00:02
963500 -- (-334.161) (-333.877) [-333.763] (-334.631) * (-335.205) (-335.358) [-335.433] (-333.959) -- 0:00:02
964000 -- (-338.051) [-337.112] (-336.266) (-336.404) * (-333.906) (-332.377) [-338.938] (-332.622) -- 0:00:02
964500 -- [-335.245] (-335.155) (-336.718) (-334.411) * (-334.150) [-335.085] (-332.814) (-332.878) -- 0:00:02
965000 -- (-334.529) (-336.135) [-332.848] (-332.396) * (-333.107) (-336.013) (-336.345) [-335.828] -- 0:00:02
Average standard deviation of split frequencies: 0.008198
965500 -- (-333.324) [-336.294] (-333.477) (-339.220) * (-336.642) (-333.536) [-333.859] (-336.813) -- 0:00:02
966000 -- (-335.354) (-337.340) (-337.413) [-333.301] * (-337.256) (-334.447) [-333.225] (-334.479) -- 0:00:02
966500 -- (-335.443) [-334.070] (-336.442) (-333.365) * (-334.054) [-332.789] (-333.368) (-334.270) -- 0:00:01
967000 -- (-333.802) (-337.700) (-332.899) [-332.856] * (-333.630) (-333.671) [-333.033] (-333.052) -- 0:00:01
967500 -- [-335.117] (-334.062) (-333.111) (-334.972) * [-334.206] (-335.986) (-339.235) (-335.276) -- 0:00:01
968000 -- (-335.945) (-336.015) [-335.878] (-337.828) * (-336.325) [-333.731] (-335.168) (-335.942) -- 0:00:01
968500 -- (-334.796) (-336.241) (-334.153) [-335.236] * (-337.103) (-332.790) (-333.939) [-335.366] -- 0:00:01
969000 -- [-333.887] (-336.813) (-333.724) (-335.450) * (-334.919) [-335.666] (-334.478) (-334.162) -- 0:00:01
969500 -- (-335.136) [-333.425] (-336.133) (-336.681) * [-332.719] (-335.380) (-336.211) (-334.370) -- 0:00:01
970000 -- (-333.080) [-335.021] (-337.895) (-332.498) * (-332.173) [-335.629] (-334.644) (-332.856) -- 0:00:01
Average standard deviation of split frequencies: 0.008321
970500 -- (-337.647) [-334.489] (-338.548) (-334.285) * (-332.561) (-333.323) (-334.588) [-334.013] -- 0:00:01
971000 -- [-333.409] (-335.698) (-332.893) (-337.102) * (-337.923) (-334.101) (-333.152) [-333.162] -- 0:00:01
971500 -- (-334.524) (-332.734) [-332.218] (-338.770) * (-339.102) [-334.578] (-334.734) (-333.900) -- 0:00:01
972000 -- (-334.528) [-336.685] (-332.605) (-335.504) * (-333.865) [-335.121] (-334.843) (-336.756) -- 0:00:01
972500 -- (-332.989) (-338.577) [-333.232] (-334.121) * (-334.467) (-334.653) (-332.200) [-334.070] -- 0:00:01
973000 -- (-333.601) (-336.494) [-333.685] (-335.603) * (-338.804) (-332.718) [-333.124] (-336.867) -- 0:00:01
973500 -- (-335.388) [-336.162] (-333.690) (-333.141) * (-335.197) [-332.692] (-334.884) (-334.738) -- 0:00:01
974000 -- (-334.923) (-338.790) (-336.463) [-334.324] * (-333.274) [-332.383] (-334.593) (-334.903) -- 0:00:01
974500 -- [-335.158] (-333.255) (-335.303) (-335.778) * (-338.241) (-332.958) (-335.803) [-336.344] -- 0:00:01
975000 -- (-334.617) [-333.588] (-335.608) (-334.559) * (-333.066) [-332.399] (-332.966) (-336.810) -- 0:00:01
Average standard deviation of split frequencies: 0.008469
975500 -- (-334.080) (-336.078) [-334.304] (-335.943) * (-333.535) [-332.389] (-340.138) (-335.443) -- 0:00:01
976000 -- (-336.641) (-333.171) (-334.270) [-334.579] * (-333.738) [-334.094] (-336.616) (-335.259) -- 0:00:01
976500 -- (-334.994) (-337.306) [-335.114] (-333.943) * [-333.340] (-333.173) (-334.596) (-333.724) -- 0:00:01
977000 -- [-335.455] (-336.250) (-332.501) (-334.247) * (-335.061) (-335.366) (-333.116) [-336.355] -- 0:00:01
977500 -- (-334.768) (-337.454) (-333.072) [-337.123] * (-334.867) (-336.156) (-333.928) [-336.021] -- 0:00:01
978000 -- [-337.634] (-337.613) (-338.323) (-333.880) * (-336.795) [-335.678] (-332.884) (-337.116) -- 0:00:01
978500 -- [-336.232] (-343.244) (-334.080) (-333.742) * [-334.922] (-333.207) (-333.048) (-336.162) -- 0:00:01
979000 -- (-336.444) (-332.323) [-335.679] (-337.035) * (-335.085) (-332.661) [-335.791] (-336.553) -- 0:00:01
979500 -- [-332.860] (-333.515) (-335.349) (-333.197) * (-340.095) (-333.939) (-334.143) [-337.557] -- 0:00:01
980000 -- [-338.685] (-333.100) (-337.322) (-336.232) * (-337.883) (-334.998) [-333.010] (-338.287) -- 0:00:01
Average standard deviation of split frequencies: 0.008973
980500 -- (-337.685) [-336.894] (-336.240) (-336.627) * (-333.369) (-337.399) (-334.182) [-339.466] -- 0:00:01
981000 -- (-335.788) [-334.405] (-336.660) (-335.224) * (-334.619) (-339.015) [-337.733] (-333.207) -- 0:00:01
981500 -- (-333.583) (-334.908) [-334.345] (-333.940) * (-333.840) [-335.023] (-337.821) (-334.662) -- 0:00:01
982000 -- (-332.873) (-337.238) (-334.385) [-334.655] * (-333.140) [-335.209] (-334.225) (-337.313) -- 0:00:01
982500 -- (-335.971) (-338.706) (-335.709) [-332.632] * (-335.156) [-333.739] (-334.028) (-338.540) -- 0:00:01
983000 -- (-332.957) (-333.995) (-337.043) [-332.971] * (-334.239) [-333.696] (-332.992) (-335.517) -- 0:00:01
983500 -- (-334.053) (-333.868) [-335.162] (-332.308) * [-333.946] (-332.961) (-333.520) (-335.782) -- 0:00:00
984000 -- (-335.174) (-332.711) [-335.635] (-335.187) * (-334.808) (-333.545) [-334.240] (-335.056) -- 0:00:00
984500 -- [-333.221] (-333.954) (-335.572) (-343.609) * [-332.352] (-338.062) (-334.370) (-338.387) -- 0:00:00
985000 -- (-337.264) (-336.096) [-332.284] (-338.021) * [-333.730] (-335.728) (-333.355) (-337.754) -- 0:00:00
Average standard deviation of split frequencies: 0.009179
985500 -- (-333.409) (-333.657) (-333.359) [-334.495] * [-333.743] (-336.631) (-334.686) (-337.823) -- 0:00:00
986000 -- [-335.713] (-332.992) (-333.821) (-333.694) * (-333.887) [-336.431] (-334.874) (-334.683) -- 0:00:00
986500 -- (-333.843) [-334.214] (-336.267) (-334.030) * (-333.172) [-334.471] (-336.843) (-336.849) -- 0:00:00
987000 -- [-332.415] (-333.226) (-337.197) (-334.055) * [-332.534] (-336.412) (-336.848) (-332.901) -- 0:00:00
987500 -- [-334.150] (-332.690) (-336.520) (-336.045) * [-332.652] (-333.934) (-338.248) (-333.225) -- 0:00:00
988000 -- (-334.211) (-333.389) (-333.085) [-332.647] * [-332.647] (-335.129) (-337.696) (-332.845) -- 0:00:00
988500 -- [-333.585] (-332.881) (-333.111) (-332.854) * (-333.533) [-336.064] (-340.536) (-333.531) -- 0:00:00
989000 -- (-332.985) (-333.153) [-334.202] (-333.817) * (-333.866) (-339.962) (-339.094) [-334.191] -- 0:00:00
989500 -- (-332.396) [-334.114] (-335.411) (-333.904) * (-333.913) (-336.822) [-333.271] (-333.119) -- 0:00:00
990000 -- (-334.270) (-333.374) (-335.131) [-333.922] * [-333.904] (-333.284) (-334.838) (-332.920) -- 0:00:00
Average standard deviation of split frequencies: 0.009136
990500 -- (-334.147) [-335.858] (-336.661) (-336.395) * (-333.567) [-334.092] (-334.266) (-333.539) -- 0:00:00
991000 -- (-334.973) (-335.524) (-333.221) [-338.416] * [-333.346] (-334.143) (-332.524) (-332.964) -- 0:00:00
991500 -- (-335.719) [-333.435] (-335.223) (-336.378) * (-333.277) (-335.579) (-335.695) [-332.857] -- 0:00:00
992000 -- [-334.892] (-332.334) (-333.146) (-338.702) * [-332.222] (-334.483) (-336.341) (-332.460) -- 0:00:00
992500 -- [-332.590] (-336.108) (-334.660) (-337.089) * (-336.022) [-335.020] (-339.129) (-333.899) -- 0:00:00
993000 -- (-335.382) (-336.501) [-332.650] (-334.581) * (-335.713) [-334.464] (-333.472) (-339.508) -- 0:00:00
993500 -- (-334.329) [-337.310] (-334.952) (-341.525) * (-336.306) (-335.647) [-333.612] (-339.557) -- 0:00:00
994000 -- (-343.500) [-336.862] (-336.490) (-340.210) * [-335.631] (-332.938) (-332.837) (-336.500) -- 0:00:00
994500 -- (-338.685) (-334.533) [-334.043] (-334.322) * (-341.773) (-339.440) [-335.736] (-334.677) -- 0:00:00
995000 -- (-337.187) [-335.413] (-332.399) (-334.764) * (-343.136) [-334.218] (-336.288) (-336.886) -- 0:00:00
Average standard deviation of split frequencies: 0.008993
995500 -- (-335.898) (-335.629) [-333.660] (-340.574) * [-336.730] (-334.176) (-336.370) (-332.812) -- 0:00:00
996000 -- [-336.895] (-333.974) (-335.541) (-332.998) * (-336.167) [-332.714] (-334.965) (-333.796) -- 0:00:00
996500 -- [-332.853] (-333.202) (-336.134) (-332.924) * (-338.131) [-334.212] (-340.729) (-333.971) -- 0:00:00
997000 -- [-332.986] (-333.624) (-333.996) (-332.469) * [-333.988] (-334.942) (-335.258) (-336.009) -- 0:00:00
997500 -- (-332.553) (-339.436) [-333.415] (-333.032) * (-332.727) [-333.247] (-342.165) (-336.493) -- 0:00:00
998000 -- (-332.676) (-333.715) [-334.391] (-335.811) * [-335.511] (-333.224) (-335.485) (-334.542) -- 0:00:00
998500 -- (-335.902) (-333.189) [-334.628] (-335.039) * (-333.500) [-337.925] (-334.822) (-333.951) -- 0:00:00
999000 -- [-333.213] (-338.505) (-334.241) (-335.541) * (-334.817) [-335.590] (-333.972) (-333.517) -- 0:00:00
999500 -- (-335.918) [-334.285] (-340.860) (-334.981) * (-335.553) (-336.643) (-333.892) [-333.302] -- 0:00:00
1000000 -- (-333.827) [-334.275] (-334.199) (-332.430) * (-335.805) [-335.979] (-335.960) (-333.774) -- 0:00:00
Average standard deviation of split frequencies: 0.009108
Analysis completed in 59 seconds
Analysis used 57.58 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -331.95
Likelihood of best state for "cold" chain of run 2 was -331.95
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
43.8 % ( 24 %) Dirichlet(Pi{all})
42.0 % ( 32 %) Slider(Pi{all})
78.4 % ( 55 %) Multiplier(Alpha{1,2})
78.0 % ( 46 %) Multiplier(Alpha{3})
27.0 % ( 23 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
69.9 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 24 %) Multiplier(V{all})
97.5 % ( 96 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
44.4 % ( 35 %) Dirichlet(Pi{all})
41.3 % ( 26 %) Slider(Pi{all})
78.8 % ( 50 %) Multiplier(Alpha{1,2})
77.9 % ( 57 %) Multiplier(Alpha{3})
27.0 % ( 30 %) Slider(Pinvar{all})
98.7 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166692 0.82 0.67
3 | 166781 166631 0.84
4 | 167116 166278 166502
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166493 0.82 0.67
3 | 166120 166334 0.84
4 | 167174 166976 166903
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -333.88
| 1 |
|2 2 2 1 11 2 2 1 |
| 1 11 1 2 1 1 1 2 1 |
| * 2 2 2 * * 2 2 2 1 2 * 1 |
| 22 2 2 2 11 1 2 2 2 1 2 2|
| 2 1 2121 1 2 2 1 111 221 1|
|1 1 11 1*1 1 1 2 1 1 122 * |
| 2 1 2 1 22 2 1 |
| 1 1 1 1 1 2 1 2 |
| 2 2 2 2 2 1 2 1 2 2 1 |
| 2 2 |
| 22 |
| 2 |
| 1 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -335.38
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -333.71 -336.26
2 -333.70 -336.44
--------------------------------------
TOTAL -333.71 -336.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898796 0.090310 0.362704 1.493182 0.871571 1322.83 1411.91 1.000
r(A<->C){all} 0.168155 0.019902 0.000007 0.441546 0.131600 168.02 247.53 1.000
r(A<->G){all} 0.162345 0.018712 0.000322 0.438521 0.126330 203.39 235.20 1.005
r(A<->T){all} 0.172096 0.021761 0.000050 0.467694 0.132409 131.31 246.90 1.000
r(C<->G){all} 0.164994 0.018867 0.000191 0.438531 0.129919 145.63 237.33 1.000
r(C<->T){all} 0.164587 0.019431 0.000029 0.448468 0.128983 260.00 285.97 1.000
r(G<->T){all} 0.167824 0.019140 0.000022 0.445604 0.134111 146.33 220.84 1.000
pi(A){all} 0.169690 0.000577 0.124637 0.218880 0.168772 1109.59 1305.30 1.000
pi(C){all} 0.270611 0.000786 0.216311 0.326100 0.270276 1367.34 1434.17 1.000
pi(G){all} 0.295371 0.000823 0.241044 0.352017 0.295428 981.32 1229.52 1.001
pi(T){all} 0.264328 0.000756 0.214262 0.319016 0.262608 1257.62 1334.26 1.000
alpha{1,2} 0.408025 0.235239 0.000169 1.324718 0.234785 1161.58 1331.29 1.002
alpha{3} 0.449584 0.225182 0.000155 1.397465 0.301613 1363.50 1387.18 1.000
pinvar{all} 0.993308 0.000058 0.978386 0.999993 0.995775 1083.81 1207.84 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .*.***
8 -- ..**..
9 -- .**...
10 -- ...*.*
11 -- .****.
12 -- ....**
13 -- .*.*..
14 -- .***.*
15 -- ...**.
16 -- ..*.*.
17 -- .*..*.
18 -- .*...*
19 -- ..****
20 -- .**.**
21 -- ..*..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 444 0.147901 0.008480 0.141905 0.153897 2
8 442 0.147235 0.009422 0.140573 0.153897 2
9 440 0.146569 0.006595 0.141905 0.151233 2
10 439 0.146236 0.017430 0.133911 0.158561 2
11 438 0.145903 0.003769 0.143238 0.148568 2
12 435 0.144903 0.001413 0.143904 0.145903 2
13 433 0.144237 0.013662 0.134577 0.153897 2
14 430 0.143238 0.004711 0.139907 0.146569 2
15 429 0.142905 0.012719 0.133911 0.151899 2
16 424 0.141239 0.001884 0.139907 0.142572 2
17 423 0.140906 0.004240 0.137908 0.143904 2
18 419 0.139574 0.021199 0.124584 0.154564 2
19 417 0.138907 0.010835 0.131246 0.146569 2
20 410 0.136576 0.013191 0.127249 0.145903 2
21 407 0.135576 0.007066 0.130580 0.140573 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097970 0.010032 0.000071 0.307937 0.066472 1.000 2
length{all}[2] 0.101784 0.009253 0.000001 0.294104 0.074030 1.000 2
length{all}[3] 0.099602 0.009389 0.000043 0.302301 0.071627 1.001 2
length{all}[4] 0.100640 0.010497 0.000016 0.311255 0.068062 1.000 2
length{all}[5] 0.098560 0.010087 0.000030 0.290531 0.067674 1.000 2
length{all}[6] 0.098981 0.009383 0.000050 0.295244 0.069646 1.000 2
length{all}[7] 0.094435 0.008655 0.000618 0.285014 0.060996 0.998 2
length{all}[8] 0.100525 0.010642 0.000025 0.318598 0.067550 0.998 2
length{all}[9] 0.095680 0.009562 0.000153 0.314108 0.065280 1.011 2
length{all}[10] 0.102978 0.010583 0.000163 0.302525 0.071129 0.998 2
length{all}[11] 0.098150 0.009333 0.000074 0.272382 0.073049 0.998 2
length{all}[12] 0.104470 0.011984 0.000018 0.317074 0.073530 0.999 2
length{all}[13] 0.101700 0.010252 0.000100 0.287573 0.066615 0.999 2
length{all}[14] 0.095795 0.009760 0.000245 0.312817 0.062429 0.998 2
length{all}[15] 0.102400 0.010523 0.000029 0.294936 0.072560 0.999 2
length{all}[16] 0.102967 0.009765 0.000398 0.297191 0.075224 1.001 2
length{all}[17] 0.094438 0.009146 0.000008 0.303946 0.061431 0.998 2
length{all}[18] 0.095707 0.010035 0.000094 0.297955 0.062948 0.998 2
length{all}[19] 0.099215 0.011513 0.000189 0.283686 0.069417 0.998 2
length{all}[20] 0.091181 0.008309 0.000210 0.256960 0.065007 0.998 2
length{all}[21] 0.102666 0.011264 0.000624 0.316442 0.067508 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009108
Maximum standard deviation of split frequencies = 0.021199
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
+
|------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------ C5 (5)
|
\-------------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 46 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 243
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 35 patterns at 81 / 81 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 35 patterns at 81 / 81 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
34160 bytes for conP
3080 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.029365 0.106949 0.077791 0.060250 0.024611 0.053652 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -344.445986
Iterating by ming2
Initial: fx= 344.445986
x= 0.02936 0.10695 0.07779 0.06025 0.02461 0.05365 0.30000 1.30000
1 h-m-p 0.0000 0.0003 197.4068 +++ 332.594545 m 0.0003 14 | 1/8
2 h-m-p 0.0001 0.0003 94.3653 ++ 330.747945 m 0.0003 25 | 2/8
3 h-m-p 0.0003 0.0017 34.8137 ++ 322.999055 m 0.0017 36 | 3/8
4 h-m-p 0.0000 0.0002 185.1434 ++ 321.219472 m 0.0002 47 | 4/8
5 h-m-p 0.0001 0.0003 148.7165 ++ 317.935472 m 0.0003 58 | 5/8
6 h-m-p 0.0000 0.0001 411.4512 ++ 315.913843 m 0.0001 69 | 6/8
7 h-m-p 1.6000 8.0000 0.0001 ++ 315.913843 m 8.0000 80 | 6/8
8 h-m-p 0.0160 8.0000 0.7803 -------------.. | 6/8
9 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913843 m 8.0000 120 | 6/8
10 h-m-p 0.0040 2.0204 0.8601 ----------Y 315.913843 0 0.0000 143 | 6/8
11 h-m-p 0.0160 8.0000 0.0025 +++++ 315.913841 m 8.0000 159 | 6/8
12 h-m-p 0.0167 0.7014 1.1808 -------------.. | 6/8
13 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913841 m 8.0000 197 | 6/8
14 h-m-p 0.0031 1.5733 0.7079 +++++ 315.913526 m 1.5733 213 | 7/8
15 h-m-p 0.5961 2.9803 0.1416 ++ 315.913444 m 2.9803 226 | 8/8
16 h-m-p 0.0160 8.0000 0.0000 Y 315.913444 0 0.0160 238
Out..
lnL = -315.913444
239 lfun, 239 eigenQcodon, 1434 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.099804 0.053603 0.103992 0.036342 0.016576 0.019166 0.000100 0.841665 0.152753
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 17.548992
np = 9
lnL0 = -338.863179
Iterating by ming2
Initial: fx= 338.863179
x= 0.09980 0.05360 0.10399 0.03634 0.01658 0.01917 0.00011 0.84166 0.15275
1 h-m-p 0.0000 0.0000 163.5377 ++ 338.793525 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0002 293.0630 +++ 331.915144 m 0.0002 27 | 2/9
3 h-m-p 0.0000 0.0001 50.4940 ++ 331.252476 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0004 143.5628 ++ 326.987935 m 0.0004 51 | 4/9
5 h-m-p 0.0001 0.0004 70.8765 ++ 324.115578 m 0.0004 63 | 5/9
6 h-m-p 0.0000 0.0002 650.1921 ++ 316.507880 m 0.0002 75 | 6/9
7 h-m-p 0.0000 0.0002 37.1290 ++ 315.913510 m 0.0002 87 | 7/9
8 h-m-p 1.6000 8.0000 0.0000 ++ 315.913510 m 8.0000 99 | 7/9
9 h-m-p 0.0011 0.5621 0.1336 -----------.. | 7/9
10 h-m-p 0.0160 8.0000 0.0014 +++++ 315.913493 m 8.0000 139 | 7/9
11 h-m-p 0.0761 8.0000 0.1517 ------------C 315.913493 0 0.0000 165 | 7/9
12 h-m-p 0.0012 0.5959 0.0027 +++++ 315.913490 m 0.5959 182 | 8/9
13 h-m-p 0.0160 8.0000 0.0331 ----------Y 315.913490 0 0.0000 206 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
15 h-m-p 0.0160 8.0000 0.0011 +++++ 315.913480 m 8.0000 246 | 8/9
16 h-m-p 0.0408 4.3646 0.2227 ------------Y 315.913480 0 0.0000 271 | 8/9
17 h-m-p 0.0160 8.0000 0.0000 +++++ 315.913480 m 8.0000 287 | 8/9
18 h-m-p 0.0090 4.5010 0.2160 -----------C 315.913480 0 0.0000 311 | 8/9
19 h-m-p 0.0160 8.0000 0.0001 -----------C 315.913480 0 0.0000 335 | 8/9
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/9
21 h-m-p 0.0160 8.0000 0.0012 +++++ 315.913468 m 8.0000 375 | 8/9
22 h-m-p 0.0435 4.5022 0.2180 --------------.. | 8/9
23 h-m-p 0.0160 8.0000 0.0012 +++++ 315.913455 m 8.0000 416 | 8/9
24 h-m-p 0.0465 4.6459 0.2134 -------------Y 315.913455 0 0.0000 442 | 8/9
25 h-m-p 0.0160 8.0000 0.0000 +++++ 315.913455 m 8.0000 458 | 8/9
26 h-m-p 0.0097 4.8289 0.2054 -----------C 315.913455 0 0.0000 482 | 8/9
27 h-m-p 0.0160 8.0000 0.0001 ------Y 315.913455 0 0.0000 501 | 8/9
28 h-m-p 0.0160 8.0000 0.0003 +++++ 315.913452 m 8.0000 517 | 8/9
29 h-m-p 0.0099 4.8150 0.2064 ------------C 315.913452 0 0.0000 542 | 8/9
30 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913452 m 8.0000 558 | 8/9
31 h-m-p 0.0097 4.8536 0.2049 -------------.. | 8/9
32 h-m-p 0.0083 4.1378 0.0013 +++++ 315.913444 m 4.1378 598 | 9/9
33 h-m-p 0.0160 8.0000 0.0000 Y 315.913444 0 0.0160 611
Out..
lnL = -315.913444
612 lfun, 1836 eigenQcodon, 7344 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.024392 0.082270 0.099852 0.068589 0.018326 0.066888 0.000100 1.747724 0.272133 0.146609 2.832107
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.847553
np = 11
lnL0 = -339.673605
Iterating by ming2
Initial: fx= 339.673605
x= 0.02439 0.08227 0.09985 0.06859 0.01833 0.06689 0.00011 1.74772 0.27213 0.14661 2.83211
1 h-m-p 0.0000 0.0000 140.5302 ++ 339.610958 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0010 102.8625 ++++ 332.215142 m 0.0010 32 | 2/11
3 h-m-p 0.0000 0.0002 59.4796 ++ 330.732996 m 0.0002 46 | 3/11
4 h-m-p 0.0003 0.0015 40.9291 ++ 327.715170 m 0.0015 60 | 4/11
5 h-m-p 0.0009 0.0046 26.4952 ++ 325.647066 m 0.0046 74 | 5/11
6 h-m-p 0.0001 0.0003 681.4793 ++ 322.381406 m 0.0003 88 | 6/11
7 h-m-p 0.0002 0.0012 243.3514 ++ 318.406014 m 0.0012 102 | 7/11
8 h-m-p 0.0100 0.0499 1.7096 ++ 315.913730 m 0.0499 116 | 8/11
9 h-m-p 1.6000 8.0000 0.0001 ++ 315.913730 m 8.0000 130 | 8/11
10 h-m-p 0.0018 0.8814 2.6943 +++++ 315.913585 m 0.8814 150 | 9/11
11 h-m-p 1.0217 8.0000 1.3545 ++ 315.913456 m 8.0000 164 | 9/11
12 h-m-p 1.6000 8.0000 0.8733 ++ 315.913446 m 8.0000 178 | 9/11
13 h-m-p 1.6000 8.0000 1.7143 ++ 315.913444 m 8.0000 194 | 9/11
14 h-m-p 1.6000 8.0000 0.2125 ++ 315.913444 m 8.0000 208 | 9/11
15 h-m-p 0.3990 8.0000 4.2595 ----------Y 315.913444 0 0.0000 234 | 9/11
16 h-m-p 0.6021 8.0000 0.0000 N 315.913444 0 0.6021 248 | 9/11
17 h-m-p 0.6234 8.0000 0.0000 Y 315.913444 0 0.6234 264 | 9/11
18 h-m-p 0.0015 0.7651 113.6037 +++++ 315.913444 m 0.7651 283 | 9/11
19 h-m-p 1.6000 8.0000 0.0000 N 315.913444 0 1.6000 297 | 9/11
20 h-m-p 0.0160 8.0000 0.0000 N 315.913444 0 0.0160 313
Out..
lnL = -315.913444
314 lfun, 1256 eigenQcodon, 5652 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -315.926359 S = -315.913703 -0.004845
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:03
did 20 / 35 patterns 0:03
did 30 / 35 patterns 0:03
did 35 / 35 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.092685 0.085087 0.072175 0.065601 0.015198 0.060533 0.000100 0.899077 1.566048
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 15.797711
np = 9
lnL0 = -344.087913
Iterating by ming2
Initial: fx= 344.087913
x= 0.09269 0.08509 0.07217 0.06560 0.01520 0.06053 0.00011 0.89908 1.56605
1 h-m-p 0.0000 0.0000 169.6294 ++ 344.007607 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0067 38.1862 +++++ 336.791943 m 0.0067 29 | 2/9
3 h-m-p 0.0013 0.0063 21.1299 ++ 328.439781 m 0.0063 41 | 3/9
4 h-m-p 0.0001 0.0005 220.9326 ++ 325.666530 m 0.0005 53 | 4/9
5 h-m-p 0.0001 0.0004 106.0567 ++ 323.653593 m 0.0004 65 | 5/9
6 h-m-p 0.0000 0.0000 15446.4499 ++ 319.600277 m 0.0000 77 | 6/9
7 h-m-p 0.0003 0.0013 43.1663 ++ 315.913629 m 0.0013 89 | 7/9
8 h-m-p 1.6000 8.0000 0.0001 -----C 315.913629 0 0.0004 106 | 7/9
9 h-m-p 0.0230 8.0000 0.0000 +++++ 315.913629 m 8.0000 123 | 7/9
10 h-m-p 0.0111 5.5560 0.4933 -----------Y 315.913629 0 0.0000 148 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 ------------N 315.913629 0 0.0000 174 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 +++++ 315.913629 m 8.0000 191 | 7/9
13 h-m-p 0.0160 8.0000 0.0810 +++++ 315.913625 m 8.0000 208 | 7/9
14 h-m-p 1.2179 8.0000 0.5318 ++ 315.913619 m 8.0000 222 | 7/9
15 h-m-p 1.6000 8.0000 0.3119 ++ 315.913619 m 8.0000 236 | 7/9
16 h-m-p 1.3464 8.0000 1.8532 ++ 315.913618 m 8.0000 250 | 7/9
17 h-m-p 1.6000 8.0000 1.2848 ---------C 315.913618 0 0.0000 271 | 7/9
18 h-m-p 0.4739 8.0000 0.0000 --C 315.913618 0 0.0074 285
Out..
lnL = -315.913618
286 lfun, 3146 eigenQcodon, 17160 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.043564 0.029031 0.077998 0.084104 0.081128 0.037592 0.000100 0.900000 0.705546 1.525482 2.528437
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 12.895990
np = 11
lnL0 = -340.005469
Iterating by ming2
Initial: fx= 340.005469
x= 0.04356 0.02903 0.07800 0.08410 0.08113 0.03759 0.00011 0.90000 0.70555 1.52548 2.52844
1 h-m-p 0.0000 0.0000 150.3925 ++ 339.930221 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0017 94.2798 ++++ 328.639803 m 0.0017 32 | 2/11
3 h-m-p 0.0000 0.0000 2353.6635 ++ 325.732995 m 0.0000 46 | 3/11
4 h-m-p 0.0011 0.0053 17.7877 ++ 324.050163 m 0.0053 60 | 4/11
5 h-m-p 0.0007 0.0035 55.8808 ++ 316.893351 m 0.0035 74 | 5/11
6 h-m-p 0.0002 0.0011 41.9539 ++ 316.230505 m 0.0011 88 | 6/11
7 h-m-p 0.0000 0.0001 155.3755 ++ 315.913835 m 0.0001 102 | 7/11
8 h-m-p 1.6000 8.0000 0.0001 ++ 315.913835 m 8.0000 116 | 7/11
9 h-m-p 0.0063 3.1675 0.2378 ------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0003 +++++ 315.913835 m 8.0000 165 | 7/11
11 h-m-p 0.0065 2.2042 0.3149 ----------Y 315.913835 0 0.0000 193 | 7/11
12 h-m-p 0.0002 0.1182 2.7167 +++++ 315.913665 m 0.1182 214 | 8/11
13 h-m-p 0.6020 8.0000 0.0923 ----------------.. | 8/11
14 h-m-p 0.0160 8.0000 0.0002 +++++ 315.913665 m 8.0000 262 | 8/11
15 h-m-p 0.0142 7.1093 0.6152 -------------.. | 8/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 315.913664 m 8.0000 310 | 8/11
17 h-m-p 0.0141 7.0750 0.6198 -----------N 315.913664 0 0.0000 338 | 8/11
18 h-m-p 0.0160 8.0000 0.0401 +++++ 315.913590 m 8.0000 358 | 8/11
19 h-m-p 0.4357 5.5294 0.7357 ---------------C 315.913590 0 0.0000 390 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 ----------Y 315.913590 0 0.0000 417 | 8/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913590 m 8.0000 437 | 8/11
22 h-m-p 0.0000 0.0186 86.2328 ---------.. | 8/11
23 h-m-p 0.0160 8.0000 0.0003 +++++ 315.913589 m 8.0000 478 | 8/11
24 h-m-p 0.0160 8.0000 0.4133 ------------Y 315.913589 0 0.0000 507 | 8/11
25 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913589 m 8.0000 527 | 8/11
26 h-m-p 0.0160 8.0000 0.4850 -----------Y 315.913589 0 0.0000 555 | 8/11
27 h-m-p 0.0160 8.0000 0.0077 +++++ 315.913580 m 8.0000 575 | 8/11
28 h-m-p 0.1218 8.0000 0.5086 ------------C 315.913580 0 0.0000 604 | 8/11
29 h-m-p 0.0160 8.0000 0.0002 +++++ 315.913580 m 8.0000 624 | 8/11
30 h-m-p 0.0160 8.0000 0.4719 -----------N 315.913580 0 0.0000 652 | 8/11
31 h-m-p 0.0160 8.0000 0.0001 ------N 315.913580 0 0.0000 675 | 8/11
32 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913580 m 8.0000 695 | 8/11
33 h-m-p 0.0160 8.0000 0.6175 ------------N 315.913580 0 0.0000 724 | 8/11
34 h-m-p 0.0160 8.0000 0.0003 +++++ 315.913580 m 8.0000 744 | 8/11
35 h-m-p 0.0160 8.0000 0.8287 -----------N 315.913580 0 0.0000 772 | 8/11
36 h-m-p 0.0160 8.0000 0.0001 +++++ 315.913580 m 8.0000 792 | 8/11
37 h-m-p 0.0160 8.0000 0.8410 -------------.. | 8/11
38 h-m-p 0.0160 8.0000 0.0004 +++++ 315.913579 m 8.0000 840 | 8/11
39 h-m-p 0.0160 8.0000 0.3724 ------------N 315.913579 0 0.0000 869 | 8/11
40 h-m-p 0.0160 8.0000 0.0148 +++++ 315.913528 m 8.0000 889 | 8/11
41 h-m-p 0.3142 8.0000 0.3758 ---------------.. | 8/11
42 h-m-p 0.0160 8.0000 0.0005 +++++ 315.913526 m 8.0000 939 | 8/11
43 h-m-p 0.0160 8.0000 0.2838 ------------N 315.913526 0 0.0000 968 | 8/11
44 h-m-p 0.0160 8.0000 0.0027 +++++ 315.913515 m 8.0000 988 | 8/11
45 h-m-p 0.0798 8.0000 0.2745 --------------.. | 8/11
46 h-m-p 0.0160 8.0000 0.0006 +++++ 315.913512 m 8.0000 1037 | 8/11
47 h-m-p 0.0175 8.0000 0.2625 -------------.. | 8/11
48 h-m-p 0.0160 8.0000 0.0006 +++++ 315.913509 m 8.0000 1085 | 8/11
49 h-m-p 0.0181 8.0000 0.2585 -------------.. | 8/11
50 h-m-p 0.0160 8.0000 0.0006 +++++ 315.913506 m 8.0000 1133 | 8/11
51 h-m-p 0.0187 8.0000 0.2545 ------------C 315.913506 0 0.0000 1162 | 8/11
52 h-m-p 0.0160 8.0000 0.0026 +++++ 315.913495 m 8.0000 1182 | 8/11
53 h-m-p 0.0616 8.0000 0.3398 --------------.. | 8/11
54 h-m-p 0.0160 8.0000 0.0007 +++++ 315.913491 m 8.0000 1231 | 8/11
55 h-m-p 0.0220 8.0000 0.2370 -------------.. | 8/11
56 h-m-p 0.0160 8.0000 0.0007 +++++ 315.913488 m 8.0000 1279 | 8/11
57 h-m-p 0.0228 8.0000 0.2334 ------------C 315.913488 0 0.0000 1308 | 8/11
58 h-m-p 0.0160 8.0000 0.0031 +++++ 315.913471 m 8.0000 1328 | 8/11
59 h-m-p 0.1068 8.0000 0.2345 --------------.. | 8/11
60 h-m-p 0.0160 8.0000 0.0008 +++++ 315.913467 m 8.0000 1377 | 8/11
61 h-m-p 0.0225 8.0000 0.2694 -------------.. | 8/11
62 h-m-p 0.0160 8.0000 0.0008 +++++ 315.913462 m 8.0000 1425 | 8/11
63 h-m-p 0.0160 8.0000 0.3941 ------------Y 315.913462 0 0.0000 1454 | 8/11
64 h-m-p 0.0160 8.0000 0.0012 +++++ 315.913456 m 8.0000 1474 | 8/11
65 h-m-p 0.0025 0.0125 2.4651 ++ 315.913444 m 0.0125 1491 | 9/11
66 h-m-p 1.6000 8.0000 0.0001 --Y 315.913444 0 0.0250 1507 | 9/11
67 h-m-p 0.9516 8.0000 0.0000 -Y 315.913444 0 0.0595 1524 | 9/11
68 h-m-p 0.0160 8.0000 0.0000 -N 315.913444 0 0.0010 1541
Out..
lnL = -315.913444
1542 lfun, 18504 eigenQcodon, 101772 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -315.930213 S = -315.913703 -0.007255
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:32
did 20 / 35 patterns 0:32
did 30 / 35 patterns 0:33
did 35 / 35 patterns 0:33
Time used: 0:33
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=81
NC_011896_1_WP_010908158_1_1191_MLBR_RS05585 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
NC_002677_1_NP_301834_1_706_atpE MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
NZ_CP029543_1_WP_010908158_1_1211_atpE MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
**************************************************
NC_011896_1_WP_010908158_1_1191_MLBR_RS05585 TPFFITVGLVEAAYFINLAFMALFVFATPVK
NC_002677_1_NP_301834_1_706_atpE TPFFITVGLVEAAYFINLAFMALFVFATPVK
NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405 TPFFITVGLVEAAYFINLAFMALFVFATPVK
NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280 TPFFITVGLVEAAYFINLAFMALFVFATPVK
NZ_CP029543_1_WP_010908158_1_1211_atpE TPFFITVGLVEAAYFINLAFMALFVFATPVK
NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260 TPFFITVGLVEAAYFINLAFMALFVFATPVK
*******************************
>NC_011896_1_WP_010908158_1_1191_MLBR_RS05585 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA >NC_002677_1_NP_301834_1_706_atpE ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA >NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA >NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA >NZ_CP029543_1_WP_010908158_1_1211_atpE ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA >NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>NC_011896_1_WP_010908158_1_1191_MLBR_RS05585 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK >NC_002677_1_NP_301834_1_706_atpE MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK >NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK >NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK >NZ_CP029543_1_WP_010908158_1_1211_atpE MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK >NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF TPFFITVGLVEAAYFINLAFMALFVFATPVK
#NEXUS
[ID: 8945311745]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908158_1_1191_MLBR_RS05585
NC_002677_1_NP_301834_1_706_atpE
NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405
NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280
NZ_CP029543_1_WP_010908158_1_1211_atpE
NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908158_1_1191_MLBR_RS05585,
2 NC_002677_1_NP_301834_1_706_atpE,
3 NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405,
4 NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280,
5 NZ_CP029543_1_WP_010908158_1_1211_atpE,
6 NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06647163,2:0.0740304,3:0.07162657,4:0.06806195,5:0.0676738,6:0.06964602);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06647163,2:0.0740304,3:0.07162657,4:0.06806195,5:0.0676738,6:0.06964602);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -333.71 -336.26
2 -333.70 -336.44
--------------------------------------
TOTAL -333.71 -336.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898796 0.090310 0.362704 1.493182 0.871571 1322.83 1411.91 1.000
r(A<->C){all} 0.168155 0.019902 0.000007 0.441546 0.131600 168.02 247.53 1.000
r(A<->G){all} 0.162345 0.018712 0.000322 0.438521 0.126330 203.39 235.20 1.005
r(A<->T){all} 0.172096 0.021761 0.000050 0.467694 0.132409 131.31 246.90 1.000
r(C<->G){all} 0.164994 0.018867 0.000191 0.438531 0.129919 145.63 237.33 1.000
r(C<->T){all} 0.164587 0.019431 0.000029 0.448468 0.128983 260.00 285.97 1.000
r(G<->T){all} 0.167824 0.019140 0.000022 0.445604 0.134111 146.33 220.84 1.000
pi(A){all} 0.169690 0.000577 0.124637 0.218880 0.168772 1109.59 1305.30 1.000
pi(C){all} 0.270611 0.000786 0.216311 0.326100 0.270276 1367.34 1434.17 1.000
pi(G){all} 0.295371 0.000823 0.241044 0.352017 0.295428 981.32 1229.52 1.001
pi(T){all} 0.264328 0.000756 0.214262 0.319016 0.262608 1257.62 1334.26 1.000
alpha{1,2} 0.408025 0.235239 0.000169 1.324718 0.234785 1161.58 1331.29 1.002
alpha{3} 0.449584 0.225182 0.000155 1.397465 0.301613 1363.50 1387.18 1.000
pinvar{all} 0.993308 0.000058 0.978386 0.999993 0.995775 1083.81 1207.84 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/atpE/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 81
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 6 6 6 6 6 6 | TCC 0 0 0 0 0 0 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 3 3 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 2 2 2 2 2 2 | CAC 0 0 0 0 0 0 | CGC 1 1 1 1 1 1
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 2 2 2 2 2 2 | CGA 0 0 0 0 0 0
CTG 2 2 2 2 2 2 | CCG 1 1 1 1 1 1 | CAG 1 1 1 1 1 1 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 7 7 7 7 7 7 | ACC 1 1 1 1 1 1 | AAC 1 1 1 1 1 1 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 5 5 5 5 5 5 | ACG 0 0 0 0 0 0 | AAG 0 0 0 0 0 0 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 3 3 3 | Ala GCT 2 2 2 2 2 2 | Asp GAT 1 1 1 1 1 1 | Gly GGT 9 9 9 9 9 9
GTC 2 2 2 2 2 2 | GCC 4 4 4 4 4 4 | GAC 1 1 1 1 1 1 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 4 4 4 4 4 4 | Glu GAA 0 0 0 0 0 0 | GGA 0 0 0 0 0 0
GTG 0 0 0 0 0 0 | GCG 4 4 4 4 4 4 | GAG 2 2 2 2 2 2 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908158_1_1191_MLBR_RS05585
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
#2: NC_002677_1_NP_301834_1_706_atpE
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
#3: NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
#4: NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
#5: NZ_CP029543_1_WP_010908158_1_1211_atpE
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
#6: NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 36 | TCC 0 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 18 | TCG 6 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 12 | CAC 0 | CGC 6
CTA 6 | CCA 0 | Gln Q CAA 12 | CGA 0
CTG 12 | CCG 6 | CAG 6 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 0
ATC 42 | ACC 6 | AAC 6 | AGC 6
ATA 0 | ACA 12 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 30 | ACG 0 | AAG 0 | AGG 0
------------------------------------------------------------------------------
Val V GTT 18 | Ala A GCT 12 | Asp D GAT 6 | Gly G GGT 54
GTC 12 | GCC 24 | GAC 6 | GGC 24
GTA 0 | GCA 24 | Glu E GAA 0 | GGA 0
GTG 0 | GCG 24 | GAG 12 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14815 C:0.16049 A:0.24691 G:0.44444
position 2: T:0.39506 C:0.27160 A:0.13580 G:0.19753
position 3: T:0.24691 C:0.38272 A:0.12346 G:0.24691
Average T:0.26337 C:0.27160 A:0.16872 G:0.29630
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -315.913444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908158_1_1191_MLBR_RS05585: 0.000004, NC_002677_1_NP_301834_1_706_atpE: 0.000004, NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405: 0.000004, NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280: 0.000004, NZ_CP029543_1_WP_010908158_1_1211_atpE: 0.000004, NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 173.1 69.9 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -315.913444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908158_1_1191_MLBR_RS05585: 0.000004, NC_002677_1_NP_301834_1_706_atpE: 0.000004, NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405: 0.000004, NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280: 0.000004, NZ_CP029543_1_WP_010908158_1_1211_atpE: 0.000004, NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -315.913444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908158_1_1191_MLBR_RS05585: 0.000004, NC_002677_1_NP_301834_1_706_atpE: 0.000004, NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405: 0.000004, NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280: 0.000004, NZ_CP029543_1_WP_010908158_1_1211_atpE: 0.000004, NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908158_1_1191_MLBR_RS05585)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.100 0.100 0.100 0.100 0.100 0.100 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -315.913618 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 5.352816 22.951249
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908158_1_1191_MLBR_RS05585: 0.000004, NC_002677_1_NP_301834_1_706_atpE: 0.000004, NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405: 0.000004, NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280: 0.000004, NZ_CP029543_1_WP_010908158_1_1211_atpE: 0.000004, NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 5.35282 q = 22.95125
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.08378 0.11476 0.13615 0.15480 0.17270 0.19102 0.21094 0.23424 0.26493 0.31975
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
7..2 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
7..3 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
7..4 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
7..5 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
7..6 0.000 173.1 69.9 0.1883 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -315.913444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.628249 2.544861
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908158_1_1191_MLBR_RS05585: 0.000004, NC_002677_1_NP_301834_1_706_atpE: 0.000004, NZ_LVXE01000005_1_WP_010908158_1_2061_A3216_RS03405: 0.000004, NZ_LYPH01000088_1_WP_010908158_1_2760_A8144_RS13280: 0.000004, NZ_CP029543_1_WP_010908158_1_1211_atpE: 0.000004, NZ_AP014567_1_WP_010908158_1_1236_JK2ML_RS06260: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.62825
(p1 = 0.00001) w = 2.54486
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 2.54486
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 173.1 69.9 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908158_1_1191_MLBR_RS05585)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:33
Model 1: NearlyNeutral -315.913444 Model 2: PositiveSelection -315.913444 Model 0: one-ratio -315.913444 Model 7: beta -315.913618 Model 8: beta&w>1 -315.913444 Model 0 vs 1 0.0 Model 2 vs 1 0.0 Model 8 vs 7 3.479999999171923E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
