--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:55:21 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/atpE/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -333.71 -336.26
2 -333.70 -336.44
--------------------------------------
TOTAL -333.71 -336.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898796 0.090310 0.362704 1.493182 0.871571 1322.83 1411.91 1.000
r(A<->C){all} 0.168155 0.019902 0.000007 0.441546 0.131600 168.02 247.53 1.000
r(A<->G){all} 0.162345 0.018712 0.000322 0.438521 0.126330 203.39 235.20 1.005
r(A<->T){all} 0.172096 0.021761 0.000050 0.467694 0.132409 131.31 246.90 1.000
r(C<->G){all} 0.164994 0.018867 0.000191 0.438531 0.129919 145.63 237.33 1.000
r(C<->T){all} 0.164587 0.019431 0.000029 0.448468 0.128983 260.00 285.97 1.000
r(G<->T){all} 0.167824 0.019140 0.000022 0.445604 0.134111 146.33 220.84 1.000
pi(A){all} 0.169690 0.000577 0.124637 0.218880 0.168772 1109.59 1305.30 1.000
pi(C){all} 0.270611 0.000786 0.216311 0.326100 0.270276 1367.34 1434.17 1.000
pi(G){all} 0.295371 0.000823 0.241044 0.352017 0.295428 981.32 1229.52 1.001
pi(T){all} 0.264328 0.000756 0.214262 0.319016 0.262608 1257.62 1334.26 1.000
alpha{1,2} 0.408025 0.235239 0.000169 1.324718 0.234785 1161.58 1331.29 1.002
alpha{3} 0.449584 0.225182 0.000155 1.397465 0.301613 1363.50 1387.18 1.000
pinvar{all} 0.993308 0.000058 0.978386 0.999993 0.995775 1083.81 1207.84 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -315.913444
Model 2: PositiveSelection -315.913444
Model 0: one-ratio -315.913444
Model 7: beta -315.913618
Model 8: beta&w>1 -315.913444
Model 0 vs 1 0.0
Model 2 vs 1 0.0
Model 8 vs 7 3.479999999171923E-4
>C1
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C2
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C3
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C4
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C5
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C6
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=81
C1 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C2 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C3 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C4 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C5 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C6 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
**************************************************
C1 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C2 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C3 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C4 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C5 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C6 TPFFITVGLVEAAYFINLAFMALFVFATPVK
*******************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 81 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 81 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2430]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2430]--->[2430]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.449 Mb, Max= 30.602 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C2 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C3 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C4 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C5 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
C6 MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
**************************************************
C1 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C2 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C3 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C4 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C5 TPFFITVGLVEAAYFINLAFMALFVFATPVK
C6 TPFFITVGLVEAAYFINLAFMALFVFATPVK
*******************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C2 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C3 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C4 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C5 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
C6 ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
**************************************************
C1 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C2 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C3 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C4 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C5 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
C6 GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
**************************************************
C1 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C2 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C3 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C4 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C5 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
C6 CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
**************************************************
C1 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C2 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C3 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C4 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C5 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
C6 ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
**************************************************
C1 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C2 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C3 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C4 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C5 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
C6 CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
*******************************************
>C1
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C2
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C3
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C4
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C5
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C6
ATGGATCCCATGATCGCTCAGGGTGCACTTATCGGTGGTGGCCTGATCAT
GGCTGGTGGTGCAATCGGCGCCGGTATCGGTGACGGTATGGCAGGCAATG
CGCTGGTTTCGGGTATTGCCCGGCAACCTGAGGCGCAAAGCCGCTTGTTC
ACACCGTTCTTCATCACCGTTGGCTTGGTTGAGGCAGCCTACTTCATCAA
CCTAGCGTTTATGGCGTTGTTCGTCTTCGCCACACCCGTCAAA
>C1
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C2
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C3
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C4
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C5
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
>C6
MDPMIAQGALIGGGLIMAGGAIGAGIGDGMAGNALVSGIARQPEAQSRLF
TPFFITVGLVEAAYFINLAFMALFVFATPVK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 243 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773226
Setting output file names to "/data/1res/atpE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1856078168
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8945311745
Seed = 755173270
Swapseed = 1579773226
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -543.845616 -- -24.965149
Chain 2 -- -543.845616 -- -24.965149
Chain 3 -- -543.845648 -- -24.965149
Chain 4 -- -543.845648 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -543.845648 -- -24.965149
Chain 2 -- -543.845565 -- -24.965149
Chain 3 -- -543.845648 -- -24.965149
Chain 4 -- -543.845565 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-543.846] (-543.846) (-543.846) (-543.846) * [-543.846] (-543.846) (-543.846) (-543.846)
500 -- (-340.366) (-340.317) (-343.302) [-339.329] * (-345.629) (-342.489) [-346.495] (-354.582) -- 0:00:00
1000 -- (-347.103) [-340.037] (-345.553) (-341.380) * [-344.399] (-339.185) (-338.889) (-347.176) -- 0:00:00
1500 -- (-340.127) (-339.802) [-345.310] (-347.613) * [-340.808] (-346.265) (-341.378) (-355.483) -- 0:00:00
2000 -- (-341.005) [-342.918] (-346.264) (-340.355) * [-343.091] (-343.335) (-353.787) (-340.162) -- 0:00:00
2500 -- (-343.604) [-340.940] (-344.986) (-346.036) * (-341.573) (-346.277) (-345.558) [-336.902] -- 0:00:00
3000 -- (-341.728) [-339.693] (-346.924) (-344.641) * [-348.496] (-340.375) (-349.206) (-345.372) -- 0:05:32
3500 -- [-343.214] (-352.754) (-343.984) (-342.137) * [-342.846] (-347.654) (-345.841) (-348.300) -- 0:04:44
4000 -- (-342.915) [-341.854] (-338.576) (-349.960) * (-338.307) [-337.203] (-362.778) (-344.981) -- 0:04:09
4500 -- (-342.720) (-343.935) (-346.232) [-338.104] * [-338.975] (-347.429) (-344.348) (-341.601) -- 0:03:41
5000 -- (-346.978) [-343.996] (-350.072) (-340.939) * (-343.841) (-346.912) (-349.506) [-341.383] -- 0:03:19
Average standard deviation of split frequencies: 0.082309
5500 -- (-338.943) (-342.727) (-343.374) [-343.554] * (-347.285) [-341.929] (-347.274) (-343.696) -- 0:03:00
6000 -- (-342.685) [-339.034] (-343.655) (-353.037) * (-339.914) [-341.515] (-355.648) (-344.076) -- 0:02:45
6500 -- (-345.319) (-341.460) (-340.913) [-344.687] * (-338.845) [-342.397] (-335.748) (-342.820) -- 0:02:32
7000 -- (-342.061) (-344.314) [-341.960] (-347.461) * (-345.595) (-342.324) [-334.572] (-341.300) -- 0:02:21
7500 -- (-349.641) [-341.282] (-343.990) (-344.949) * (-351.969) [-341.907] (-334.159) (-340.278) -- 0:02:12
8000 -- (-347.995) (-342.564) [-341.220] (-345.672) * [-346.324] (-341.505) (-333.732) (-348.450) -- 0:02:04
8500 -- (-342.763) [-337.576] (-348.503) (-346.621) * (-341.201) (-342.834) [-334.309] (-343.367) -- 0:01:56
9000 -- (-346.715) (-349.501) (-344.691) [-337.277] * (-338.992) (-349.945) [-332.766] (-339.422) -- 0:01:50
9500 -- (-356.259) (-344.338) (-339.389) [-343.575] * (-345.994) (-345.421) [-334.287] (-339.012) -- 0:01:44
10000 -- (-348.612) (-344.638) [-348.239] (-339.361) * (-350.074) (-340.278) (-335.286) [-338.423] -- 0:01:39
Average standard deviation of split frequencies: 0.083969
10500 -- (-336.365) (-346.706) (-342.409) [-341.585] * [-342.268] (-341.755) (-332.626) (-349.484) -- 0:01:34
11000 -- (-334.573) (-354.379) [-343.498] (-345.041) * [-349.368] (-339.699) (-332.269) (-350.832) -- 0:01:29
11500 -- [-337.487] (-340.867) (-340.359) (-348.464) * (-340.850) [-338.811] (-332.110) (-345.382) -- 0:01:25
12000 -- (-334.332) [-337.537] (-339.060) (-344.850) * [-343.242] (-348.270) (-333.500) (-341.622) -- 0:01:22
12500 -- [-336.226] (-336.401) (-339.528) (-348.760) * (-339.162) [-339.927] (-333.636) (-347.144) -- 0:01:19
13000 -- (-333.398) [-334.159] (-344.274) (-342.051) * (-343.319) [-341.472] (-335.679) (-340.789) -- 0:01:15
13500 -- (-334.981) [-333.200] (-352.624) (-348.244) * (-347.142) [-338.112] (-336.744) (-355.799) -- 0:01:13
14000 -- (-333.791) [-334.762] (-345.629) (-349.719) * [-343.390] (-343.994) (-340.480) (-344.534) -- 0:01:10
14500 -- (-334.582) [-335.177] (-349.955) (-343.208) * [-337.006] (-344.592) (-341.798) (-339.994) -- 0:01:07
15000 -- [-333.520] (-335.569) (-346.599) (-353.219) * (-350.580) [-345.268] (-334.956) (-345.795) -- 0:01:05
Average standard deviation of split frequencies: 0.084922
15500 -- (-332.905) [-334.621] (-345.690) (-343.933) * (-346.029) [-339.048] (-332.963) (-348.435) -- 0:01:03
16000 -- (-333.871) [-333.304] (-351.404) (-342.500) * [-349.959] (-350.511) (-333.357) (-346.314) -- 0:01:01
16500 -- (-333.099) (-333.365) (-346.198) [-339.370] * (-339.904) (-344.544) [-332.686] (-347.362) -- 0:00:59
17000 -- (-333.438) [-332.678] (-343.131) (-342.624) * (-349.861) (-343.684) (-333.477) [-345.826] -- 0:00:57
17500 -- (-333.886) (-332.596) (-338.960) [-352.662] * [-346.641] (-340.802) (-333.734) (-345.579) -- 0:00:56
18000 -- (-336.800) (-337.065) [-343.289] (-346.571) * (-344.832) (-351.050) [-333.374] (-346.633) -- 0:00:54
18500 -- (-334.148) (-334.854) [-339.477] (-341.323) * (-340.084) (-349.088) (-334.022) [-344.956] -- 0:00:53
19000 -- (-333.819) (-333.451) (-349.771) [-344.403] * [-333.438] (-344.657) (-332.804) (-339.733) -- 0:00:51
19500 -- (-340.923) (-335.890) (-339.899) [-343.695] * [-335.188] (-350.594) (-333.998) (-347.959) -- 0:01:40
20000 -- (-333.084) (-335.145) (-355.338) [-340.105] * (-334.325) [-349.132] (-334.508) (-342.626) -- 0:01:38
Average standard deviation of split frequencies: 0.058292
20500 -- (-333.136) (-334.027) [-345.902] (-346.063) * (-332.383) (-342.544) (-333.390) [-342.693] -- 0:01:35
21000 -- (-333.197) (-334.466) (-348.149) [-346.209] * [-332.486] (-348.172) (-333.087) (-345.817) -- 0:01:33
21500 -- (-335.869) (-335.301) [-336.542] (-356.604) * [-334.955] (-348.211) (-334.899) (-342.516) -- 0:01:31
22000 -- (-341.665) [-334.571] (-348.562) (-358.689) * [-333.449] (-345.130) (-334.419) (-346.442) -- 0:01:28
22500 -- [-334.863] (-335.159) (-348.533) (-357.544) * (-335.764) (-344.242) [-332.286] (-346.462) -- 0:01:26
23000 -- (-333.266) (-334.169) [-336.557] (-349.675) * (-335.461) [-344.648] (-334.556) (-348.161) -- 0:01:24
23500 -- [-332.840] (-334.178) (-335.170) (-338.034) * [-336.002] (-345.930) (-339.504) (-358.073) -- 0:01:23
24000 -- (-335.182) [-336.349] (-333.599) (-344.332) * (-334.702) (-348.914) (-336.807) [-350.479] -- 0:01:21
24500 -- [-333.560] (-333.720) (-332.193) (-335.692) * (-334.752) (-352.534) [-333.578] (-350.694) -- 0:01:19
25000 -- (-332.886) (-345.443) [-334.739] (-335.286) * (-333.932) (-342.961) (-334.557) [-342.839] -- 0:01:18
Average standard deviation of split frequencies: 0.054393
25500 -- [-333.320] (-341.536) (-339.335) (-336.427) * [-334.506] (-346.629) (-335.067) (-341.745) -- 0:01:16
26000 -- (-333.573) (-333.385) [-333.331] (-335.950) * [-334.019] (-341.522) (-339.509) (-350.816) -- 0:01:14
26500 -- (-333.097) [-335.418] (-333.220) (-336.391) * (-332.840) (-348.038) [-336.438] (-338.917) -- 0:01:13
27000 -- (-336.059) (-333.967) (-335.861) [-334.327] * [-333.273] (-345.320) (-333.805) (-345.319) -- 0:01:12
27500 -- [-334.652] (-332.767) (-334.080) (-337.722) * (-334.449) [-347.022] (-333.076) (-348.461) -- 0:01:10
28000 -- (-334.966) [-335.532] (-332.729) (-337.102) * (-332.820) (-340.718) (-333.468) [-344.736] -- 0:01:09
28500 -- (-337.060) (-333.651) [-334.424] (-338.092) * (-336.434) (-341.323) [-335.146] (-342.269) -- 0:01:08
29000 -- (-332.164) [-334.765] (-334.277) (-336.945) * [-334.644] (-340.492) (-332.381) (-341.222) -- 0:01:06
29500 -- [-332.071] (-335.384) (-340.978) (-335.172) * (-340.188) (-344.530) [-335.279] (-341.681) -- 0:01:05
30000 -- (-333.865) [-332.684] (-333.707) (-333.779) * (-334.679) [-341.910] (-334.866) (-346.878) -- 0:01:04
Average standard deviation of split frequencies: 0.050161
30500 -- (-334.079) (-336.826) [-333.321] (-332.231) * (-336.530) [-344.839] (-336.465) (-344.206) -- 0:01:03
31000 -- (-333.964) (-334.366) (-334.797) [-333.197] * (-335.951) (-341.795) [-333.357] (-342.218) -- 0:01:02
31500 -- [-333.661] (-334.592) (-332.964) (-336.638) * (-336.819) (-349.212) [-338.565] (-338.400) -- 0:01:01
32000 -- (-334.833) (-333.552) (-333.212) [-333.289] * (-332.405) (-348.709) [-334.812] (-341.039) -- 0:01:00
32500 -- (-334.521) [-333.647] (-335.712) (-335.828) * (-334.847) [-352.494] (-333.924) (-343.386) -- 0:00:59
33000 -- [-333.501] (-337.792) (-334.562) (-343.296) * [-335.087] (-348.883) (-335.223) (-347.954) -- 0:00:58
33500 -- (-333.830) (-342.601) [-333.838] (-335.585) * [-334.167] (-340.493) (-333.862) (-342.867) -- 0:00:57
34000 -- (-333.109) (-338.460) (-333.242) [-337.382] * [-336.492] (-350.964) (-335.652) (-342.542) -- 0:00:56
34500 -- (-335.636) (-335.708) (-334.713) [-335.790] * (-335.043) [-345.949] (-333.389) (-342.593) -- 0:00:55
35000 -- (-334.204) [-335.097] (-340.165) (-335.742) * [-334.533] (-352.451) (-335.814) (-345.657) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-333.361) [-332.620] (-335.269) (-334.774) * [-337.251] (-344.028) (-337.836) (-348.674) -- 0:00:54
36000 -- (-332.893) (-341.417) (-334.437) [-332.724] * [-333.901] (-335.468) (-337.448) (-344.586) -- 0:00:53
36500 -- (-335.713) (-336.471) (-335.804) [-334.807] * (-332.652) [-334.661] (-335.618) (-342.667) -- 0:01:19
37000 -- (-332.863) (-333.808) [-333.559] (-334.827) * (-334.629) [-333.583] (-333.513) (-338.916) -- 0:01:18
37500 -- [-335.276] (-335.927) (-334.887) (-334.052) * [-334.576] (-333.187) (-335.002) (-351.342) -- 0:01:17
38000 -- (-335.251) [-334.861] (-334.391) (-332.882) * [-333.582] (-335.054) (-332.893) (-342.490) -- 0:01:15
38500 -- (-337.895) [-334.760] (-334.318) (-333.805) * (-333.446) (-334.246) [-334.578] (-343.342) -- 0:01:14
39000 -- (-336.798) (-334.285) [-333.102] (-336.249) * [-333.626] (-333.622) (-333.493) (-343.810) -- 0:01:13
39500 -- (-332.628) (-336.055) [-338.327] (-332.916) * (-334.038) (-335.999) [-334.207] (-345.420) -- 0:01:12
40000 -- (-336.030) (-333.805) (-338.059) [-333.439] * (-334.086) (-333.607) [-335.409] (-349.417) -- 0:01:12
Average standard deviation of split frequencies: 0.041731
40500 -- (-335.098) [-334.306] (-337.686) (-335.346) * (-336.294) [-334.878] (-337.270) (-351.546) -- 0:01:11
41000 -- (-333.475) (-334.513) (-332.556) [-337.494] * (-336.462) (-335.630) [-334.842] (-342.831) -- 0:01:10
41500 -- [-335.338] (-332.710) (-333.547) (-334.183) * [-333.780] (-334.968) (-334.894) (-333.404) -- 0:01:09
42000 -- [-332.966] (-337.365) (-333.146) (-333.229) * (-336.365) [-333.220] (-334.781) (-333.196) -- 0:01:08
42500 -- (-332.819) (-334.944) [-334.203] (-332.793) * (-340.220) (-334.320) [-332.293] (-336.198) -- 0:01:07
43000 -- (-333.334) [-334.904] (-334.011) (-333.142) * (-334.566) (-334.493) (-333.856) [-336.156] -- 0:01:06
43500 -- (-335.333) (-336.832) (-335.075) [-336.748] * (-333.003) [-333.834] (-335.286) (-336.034) -- 0:01:05
44000 -- [-333.304] (-336.941) (-333.039) (-337.895) * [-336.977] (-333.647) (-335.755) (-336.345) -- 0:01:05
44500 -- (-333.724) (-335.549) (-334.998) [-332.561] * [-335.639] (-333.332) (-334.576) (-332.237) -- 0:01:04
45000 -- (-333.668) [-332.360] (-334.751) (-340.870) * (-332.853) (-332.821) (-334.287) [-332.099] -- 0:01:03
Average standard deviation of split frequencies: 0.039967
45500 -- (-333.959) [-334.756] (-333.516) (-334.941) * (-334.935) (-335.478) [-335.832] (-332.611) -- 0:01:02
46000 -- (-333.415) (-335.723) [-332.999] (-335.012) * (-334.014) (-333.506) (-336.687) [-336.289] -- 0:01:02
46500 -- [-334.081] (-335.385) (-333.735) (-333.736) * [-333.095] (-335.448) (-334.821) (-335.495) -- 0:01:01
47000 -- (-334.533) (-332.658) (-334.565) [-333.902] * [-334.060] (-337.381) (-333.901) (-335.363) -- 0:01:00
47500 -- (-335.239) [-334.027] (-335.847) (-335.035) * [-336.386] (-344.945) (-332.942) (-342.751) -- 0:01:00
48000 -- [-335.094] (-333.527) (-333.734) (-332.186) * [-333.881] (-334.025) (-332.245) (-338.310) -- 0:00:59
48500 -- [-334.800] (-335.406) (-334.991) (-333.629) * [-335.407] (-335.796) (-333.499) (-334.854) -- 0:00:58
49000 -- (-333.388) (-334.360) [-332.764] (-340.977) * [-334.952] (-332.819) (-333.707) (-332.397) -- 0:00:58
49500 -- [-335.535] (-333.565) (-333.448) (-338.660) * (-335.320) (-343.478) (-335.165) [-332.709] -- 0:00:57
50000 -- (-337.147) (-333.055) (-334.345) [-334.922] * (-333.610) (-336.578) (-336.093) [-332.786] -- 0:00:57
Average standard deviation of split frequencies: 0.041623
50500 -- (-336.817) (-336.247) (-335.157) [-335.650] * (-334.714) (-334.210) [-339.587] (-334.182) -- 0:00:56
51000 -- [-333.921] (-334.300) (-335.701) (-336.603) * (-334.844) [-332.333] (-333.842) (-337.057) -- 0:00:55
51500 -- (-335.517) (-334.464) [-334.990] (-333.430) * [-333.919] (-333.207) (-334.867) (-332.877) -- 0:00:55
52000 -- [-334.725] (-336.206) (-337.256) (-335.116) * [-334.143] (-334.018) (-333.373) (-333.452) -- 0:00:54
52500 -- (-335.804) (-335.675) [-335.310] (-333.955) * [-334.820] (-335.407) (-335.325) (-334.011) -- 0:00:54
53000 -- [-334.117] (-333.144) (-335.887) (-334.158) * (-333.291) [-333.223] (-340.477) (-332.921) -- 0:00:53
53500 -- (-337.202) [-333.025] (-334.571) (-338.076) * [-333.396] (-336.090) (-332.473) (-337.071) -- 0:01:10
54000 -- [-336.047] (-336.003) (-339.033) (-337.871) * (-337.272) (-337.345) [-334.430] (-332.615) -- 0:01:10
54500 -- (-333.597) (-333.750) (-337.272) [-334.661] * (-336.390) (-334.507) (-334.466) [-332.851] -- 0:01:09
55000 -- (-333.344) (-336.246) [-335.271] (-332.750) * (-334.701) (-332.777) (-332.801) [-332.883] -- 0:01:08
Average standard deviation of split frequencies: 0.042976
55500 -- (-335.376) [-335.268] (-334.014) (-335.415) * (-333.491) (-333.497) (-334.299) [-336.558] -- 0:01:08
56000 -- [-334.117] (-335.073) (-335.387) (-335.080) * (-334.254) (-339.081) (-333.370) [-335.278] -- 0:01:07
56500 -- (-339.078) (-335.357) (-332.815) [-333.916] * (-333.950) [-335.772] (-333.483) (-335.121) -- 0:01:06
57000 -- [-335.618] (-334.282) (-332.755) (-333.544) * (-334.849) (-336.599) [-332.312] (-334.072) -- 0:01:06
57500 -- (-336.473) [-340.311] (-334.348) (-332.928) * (-334.080) (-335.760) [-334.912] (-336.085) -- 0:01:05
58000 -- (-338.314) [-335.426] (-337.752) (-334.214) * [-334.004] (-335.925) (-334.258) (-340.614) -- 0:01:04
58500 -- (-334.634) (-333.553) (-338.462) [-334.998] * (-334.792) [-332.949] (-333.929) (-333.542) -- 0:01:04
59000 -- (-336.692) (-333.088) [-333.282] (-333.572) * (-334.853) (-334.790) (-332.697) [-336.858] -- 0:01:03
59500 -- (-335.620) (-333.888) (-335.302) [-333.504] * (-333.149) [-334.005] (-336.101) (-334.820) -- 0:01:03
60000 -- (-335.366) (-332.689) [-335.986] (-332.999) * [-336.891] (-334.301) (-335.293) (-335.388) -- 0:01:02
Average standard deviation of split frequencies: 0.044169
60500 -- (-333.505) [-333.488] (-332.633) (-337.449) * (-335.346) (-335.554) [-333.178] (-336.319) -- 0:01:02
61000 -- [-332.874] (-338.649) (-337.329) (-333.748) * (-335.167) (-336.042) [-340.043] (-340.218) -- 0:01:01
61500 -- [-334.882] (-336.591) (-332.132) (-333.636) * (-334.125) [-335.130] (-336.448) (-335.155) -- 0:01:01
62000 -- (-335.764) (-337.436) [-335.355] (-333.376) * [-333.092] (-332.631) (-336.339) (-333.935) -- 0:01:00
62500 -- [-334.113] (-339.588) (-333.459) (-332.413) * (-336.960) [-334.490] (-334.396) (-333.243) -- 0:01:00
63000 -- [-332.990] (-334.471) (-332.603) (-334.360) * (-334.158) (-333.351) (-335.740) [-336.768] -- 0:00:59
63500 -- [-333.095] (-335.495) (-333.093) (-340.275) * (-334.600) [-335.086] (-334.275) (-332.924) -- 0:00:58
64000 -- (-337.962) (-337.183) [-333.232] (-333.815) * [-335.309] (-333.701) (-334.128) (-337.355) -- 0:00:58
64500 -- [-335.511] (-332.868) (-335.108) (-338.183) * (-338.028) (-340.556) [-334.424] (-333.505) -- 0:00:58
65000 -- [-333.037] (-332.984) (-335.392) (-335.311) * (-334.527) (-338.090) [-333.914] (-334.590) -- 0:00:57
Average standard deviation of split frequencies: 0.037576
65500 -- (-338.864) [-333.086] (-333.138) (-333.618) * (-336.040) (-335.805) (-334.023) [-334.737] -- 0:00:57
66000 -- (-333.939) (-340.909) (-333.162) [-332.534] * [-335.670] (-335.355) (-336.513) (-334.272) -- 0:00:56
66500 -- (-333.633) [-336.211] (-332.934) (-335.932) * [-333.749] (-332.427) (-340.653) (-333.484) -- 0:00:56
67000 -- [-336.745] (-336.337) (-333.167) (-333.360) * [-333.796] (-333.869) (-333.236) (-333.041) -- 0:00:55
67500 -- (-334.879) (-340.354) (-333.636) [-332.311] * (-333.476) (-336.578) [-333.428] (-335.355) -- 0:00:55
68000 -- (-336.728) [-339.906] (-333.793) (-335.251) * (-333.039) (-338.314) [-337.028] (-333.744) -- 0:00:54
68500 -- (-335.683) (-334.773) (-334.320) [-335.692] * (-336.352) (-333.911) [-333.641] (-335.713) -- 0:00:54
69000 -- (-333.485) (-336.478) [-333.401] (-335.777) * (-334.630) [-333.826] (-337.091) (-334.656) -- 0:00:53
69500 -- (-332.959) [-336.391] (-334.621) (-333.519) * [-335.167] (-334.377) (-335.545) (-334.619) -- 0:00:53
70000 -- (-334.268) (-336.843) (-333.445) [-333.401] * (-334.300) [-334.053] (-335.046) (-335.184) -- 0:00:53
Average standard deviation of split frequencies: 0.032774
70500 -- [-333.335] (-335.333) (-336.215) (-333.652) * (-333.548) (-335.668) (-335.591) [-332.354] -- 0:00:52
71000 -- [-333.840] (-335.927) (-336.536) (-334.904) * (-333.050) (-333.620) [-338.672] (-333.755) -- 0:01:05
71500 -- [-333.629] (-337.097) (-336.193) (-332.292) * [-333.477] (-337.125) (-340.977) (-336.015) -- 0:01:04
72000 -- (-336.671) (-335.389) [-337.285] (-334.832) * (-333.546) [-335.304] (-333.510) (-337.099) -- 0:01:04
72500 -- [-335.820] (-334.400) (-333.862) (-333.643) * (-334.123) [-332.463] (-336.136) (-335.402) -- 0:01:03
73000 -- (-334.470) [-333.799] (-333.604) (-335.252) * (-334.853) (-333.905) [-332.859] (-335.884) -- 0:01:03
73500 -- (-336.120) (-332.631) (-336.051) [-333.049] * (-335.055) (-333.796) [-334.804] (-335.563) -- 0:01:03
74000 -- [-335.662] (-332.962) (-335.916) (-334.165) * (-333.664) [-334.494] (-337.256) (-334.937) -- 0:01:02
74500 -- [-334.206] (-335.371) (-336.146) (-333.912) * (-333.318) [-335.113] (-338.102) (-333.176) -- 0:01:02
75000 -- [-335.064] (-335.667) (-338.024) (-337.698) * [-333.182] (-333.825) (-334.743) (-336.244) -- 0:01:01
Average standard deviation of split frequencies: 0.029886
75500 -- (-333.582) [-334.539] (-335.764) (-335.954) * (-334.722) (-334.310) [-332.506] (-332.540) -- 0:01:01
76000 -- (-334.715) (-333.778) (-332.652) [-336.988] * (-338.621) (-335.132) [-333.708] (-333.566) -- 0:01:00
76500 -- (-334.066) (-334.348) [-335.974] (-333.126) * (-336.229) (-334.903) [-332.031] (-336.274) -- 0:01:00
77000 -- (-337.256) (-337.709) (-333.281) [-334.682] * (-335.476) [-334.021] (-334.017) (-334.312) -- 0:00:59
77500 -- (-337.488) [-334.379] (-333.412) (-338.336) * [-334.011] (-334.626) (-332.859) (-337.865) -- 0:00:59
78000 -- (-336.376) (-333.389) (-333.290) [-334.460] * (-332.767) (-333.245) (-333.744) [-335.738] -- 0:00:59
78500 -- (-333.196) [-332.548] (-333.030) (-333.303) * [-332.948] (-336.502) (-332.761) (-336.244) -- 0:00:58
79000 -- (-333.027) [-334.946] (-334.153) (-336.248) * [-335.214] (-333.337) (-336.230) (-332.734) -- 0:00:58
79500 -- (-334.793) (-333.787) (-333.783) [-336.120] * (-343.490) [-336.423] (-334.191) (-333.519) -- 0:00:57
80000 -- (-333.084) (-334.015) [-334.549] (-336.423) * (-334.769) (-334.114) [-333.970] (-338.433) -- 0:00:57
Average standard deviation of split frequencies: 0.027066
80500 -- (-334.680) (-335.176) (-333.502) [-332.559] * [-332.234] (-334.834) (-333.693) (-336.441) -- 0:00:57
81000 -- [-336.681] (-334.476) (-333.192) (-340.705) * (-332.900) (-337.624) (-332.256) [-332.839] -- 0:00:56
81500 -- (-334.899) (-333.102) (-336.352) [-336.079] * (-333.384) (-340.361) (-335.315) [-332.486] -- 0:00:56
82000 -- (-333.031) (-334.632) (-335.126) [-332.832] * [-333.484] (-333.865) (-334.096) (-335.357) -- 0:00:55
82500 -- [-334.706] (-340.727) (-335.205) (-333.422) * (-334.411) (-333.851) (-332.713) [-333.498] -- 0:00:55
83000 -- (-334.928) (-334.837) (-333.710) [-333.359] * [-332.819] (-340.027) (-335.274) (-334.146) -- 0:00:55
83500 -- (-333.964) [-333.632] (-333.368) (-333.696) * [-332.204] (-335.361) (-337.774) (-338.367) -- 0:00:54
84000 -- [-333.819] (-335.062) (-335.879) (-334.065) * [-335.522] (-335.998) (-334.162) (-332.987) -- 0:00:54
84500 -- (-332.627) [-333.333] (-332.993) (-334.178) * (-334.569) (-334.269) (-335.504) [-342.200] -- 0:00:54
85000 -- (-333.734) (-337.068) (-333.644) [-335.635] * (-333.308) [-334.412] (-339.205) (-338.734) -- 0:00:53
Average standard deviation of split frequencies: 0.026542
85500 -- (-337.833) [-335.469] (-338.572) (-334.250) * (-337.054) (-333.360) [-334.210] (-334.590) -- 0:00:53
86000 -- [-339.647] (-334.985) (-333.828) (-332.361) * (-335.786) [-333.315] (-332.449) (-337.901) -- 0:00:53
86500 -- (-335.920) (-334.273) (-334.365) [-332.797] * (-342.825) (-332.740) [-333.956] (-333.062) -- 0:00:52
87000 -- (-335.074) (-334.404) [-334.449] (-336.217) * (-335.679) [-332.241] (-333.453) (-333.239) -- 0:00:52
87500 -- (-333.932) (-334.325) (-332.840) [-334.642] * [-335.385] (-335.723) (-333.398) (-335.514) -- 0:00:52
88000 -- [-338.445] (-334.546) (-332.888) (-337.171) * (-333.367) [-338.123] (-334.170) (-341.955) -- 0:01:02
88500 -- (-333.708) [-337.622] (-334.917) (-334.214) * (-333.752) (-336.072) (-336.878) [-334.672] -- 0:01:01
89000 -- [-333.224] (-336.211) (-334.958) (-334.755) * (-340.540) (-336.589) [-335.164] (-333.365) -- 0:01:01
89500 -- [-332.843] (-333.272) (-334.067) (-337.604) * (-337.836) (-334.989) (-334.534) [-332.904] -- 0:01:01
90000 -- (-336.499) (-333.990) [-333.659] (-337.806) * (-334.627) [-337.313] (-333.285) (-334.572) -- 0:01:00
Average standard deviation of split frequencies: 0.029463
90500 -- (-335.833) (-333.841) [-336.586] (-333.408) * (-335.239) (-334.115) (-332.979) [-333.111] -- 0:01:00
91000 -- (-333.374) (-334.404) (-333.558) [-334.486] * (-333.202) (-333.760) (-335.665) [-335.515] -- 0:00:59
91500 -- [-332.925] (-332.815) (-334.672) (-333.992) * [-334.468] (-335.331) (-334.468) (-333.935) -- 0:00:59
92000 -- (-337.019) (-340.025) (-332.170) [-333.509] * (-335.201) [-332.437] (-336.066) (-333.192) -- 0:00:59
92500 -- (-334.330) (-332.646) (-333.966) [-335.284] * (-333.856) (-333.311) [-333.024] (-332.688) -- 0:00:58
93000 -- [-333.875] (-333.164) (-334.775) (-337.312) * (-334.088) [-332.557] (-333.562) (-336.809) -- 0:00:58
93500 -- (-333.024) (-335.005) (-334.221) [-334.141] * [-334.968] (-334.854) (-333.025) (-335.550) -- 0:00:58
94000 -- (-335.146) (-334.888) [-336.508] (-335.333) * (-333.936) (-334.852) (-336.260) [-333.471] -- 0:00:57
94500 -- [-334.765] (-338.533) (-333.073) (-334.717) * (-333.413) (-335.281) (-333.389) [-333.513] -- 0:00:57
95000 -- (-334.422) (-333.867) [-332.530] (-335.593) * (-334.879) [-333.672] (-340.324) (-335.657) -- 0:00:57
Average standard deviation of split frequencies: 0.027826
95500 -- (-336.734) (-335.149) [-334.965] (-332.725) * [-333.979] (-333.700) (-338.829) (-335.565) -- 0:00:56
96000 -- (-336.535) (-336.583) (-335.328) [-336.460] * (-334.515) (-336.169) [-335.799] (-333.240) -- 0:00:56
96500 -- (-338.804) (-338.593) [-332.895] (-335.605) * (-334.308) [-332.640] (-335.418) (-338.253) -- 0:00:56
97000 -- (-334.804) (-332.700) (-337.603) [-335.802] * (-334.964) [-336.708] (-334.059) (-345.074) -- 0:00:55
97500 -- (-332.753) (-333.494) [-332.786] (-333.176) * (-333.651) (-336.389) [-334.326] (-334.134) -- 0:00:55
98000 -- (-335.854) [-333.859] (-333.707) (-336.254) * (-335.149) (-333.528) [-334.088] (-335.213) -- 0:00:55
98500 -- (-333.510) (-336.491) [-333.449] (-333.355) * (-333.000) (-335.451) [-333.428] (-336.838) -- 0:00:54
99000 -- [-334.231] (-333.153) (-333.105) (-335.903) * (-334.902) (-335.366) (-334.362) [-333.161] -- 0:00:54
99500 -- (-335.451) [-333.082] (-332.770) (-336.422) * (-335.013) (-338.071) (-336.721) [-334.088] -- 0:00:54
100000 -- (-336.412) (-332.985) (-335.796) [-333.592] * (-335.363) (-334.059) [-337.354] (-335.160) -- 0:00:54
Average standard deviation of split frequencies: 0.029474
100500 -- (-335.350) [-332.996] (-335.602) (-334.004) * (-334.671) (-334.068) (-334.644) [-334.038] -- 0:00:53
101000 -- (-337.459) (-336.012) [-333.132] (-337.305) * (-333.501) (-333.923) (-333.218) [-332.846] -- 0:00:53
101500 -- (-332.984) (-332.892) [-334.153] (-336.373) * [-333.719] (-334.879) (-333.455) (-332.448) -- 0:00:53
102000 -- (-332.898) (-333.234) [-333.867] (-333.542) * (-335.849) (-338.947) [-337.447] (-332.516) -- 0:00:52
102500 -- (-333.541) (-335.316) (-335.980) [-335.774] * (-335.671) (-334.218) (-336.777) [-332.883] -- 0:00:52
103000 -- (-337.269) (-333.166) (-335.389) [-332.593] * [-339.626] (-335.954) (-339.085) (-332.516) -- 0:00:52
103500 -- [-334.370] (-334.148) (-333.902) (-338.334) * (-333.460) (-334.112) (-335.192) [-333.214] -- 0:00:51
104000 -- (-335.430) (-335.049) (-336.053) [-335.387] * (-335.807) [-333.168] (-338.776) (-332.442) -- 0:00:51
104500 -- (-333.583) (-335.458) (-336.018) [-332.944] * [-332.769] (-334.070) (-335.600) (-333.290) -- 0:00:51
105000 -- (-332.791) [-333.638] (-335.418) (-336.137) * (-333.257) (-337.749) (-335.086) [-335.849] -- 0:00:59
Average standard deviation of split frequencies: 0.025279
105500 -- (-334.451) (-336.398) [-336.411] (-333.072) * (-332.621) (-335.429) (-332.697) [-333.934] -- 0:00:59
106000 -- (-333.278) (-335.633) (-334.668) [-333.158] * [-335.188] (-335.733) (-332.982) (-334.132) -- 0:00:59
106500 -- (-335.005) (-334.842) [-333.074] (-335.364) * (-333.865) (-340.143) (-338.576) [-337.186] -- 0:00:58
107000 -- [-335.092] (-336.422) (-333.333) (-333.466) * [-333.832] (-334.876) (-335.544) (-335.916) -- 0:00:58
107500 -- (-334.070) [-334.077] (-333.039) (-332.978) * (-335.939) (-333.071) (-335.097) [-332.425] -- 0:00:58
108000 -- (-335.040) (-333.264) [-336.155] (-338.287) * (-333.082) [-333.911] (-334.746) (-333.648) -- 0:00:57
108500 -- (-333.050) [-333.430] (-335.623) (-333.150) * (-333.346) (-333.220) (-337.684) [-334.179] -- 0:00:57
109000 -- (-335.216) (-333.779) [-333.641] (-335.126) * (-334.713) (-334.197) (-335.292) [-333.528] -- 0:00:57
109500 -- (-336.969) (-335.219) [-332.409] (-334.089) * [-334.521] (-332.959) (-333.655) (-333.890) -- 0:00:56
110000 -- (-332.994) [-336.542] (-339.498) (-336.492) * [-334.785] (-332.482) (-337.346) (-336.270) -- 0:00:56
Average standard deviation of split frequencies: 0.023989
110500 -- (-336.024) (-333.877) (-339.250) [-336.338] * (-333.583) [-333.435] (-334.715) (-334.889) -- 0:00:56
111000 -- (-334.117) (-332.915) (-334.997) [-334.506] * (-343.240) (-335.264) [-333.076] (-333.481) -- 0:00:56
111500 -- (-332.418) (-333.537) (-335.555) [-334.164] * (-335.799) (-336.817) (-335.748) [-333.601] -- 0:00:55
112000 -- (-334.202) (-332.935) [-332.580] (-334.226) * (-334.905) [-333.936] (-334.897) (-337.673) -- 0:00:55
112500 -- [-334.193] (-336.291) (-333.838) (-332.862) * [-333.299] (-336.193) (-341.855) (-336.094) -- 0:00:55
113000 -- (-333.582) (-336.282) [-334.741] (-334.817) * [-333.559] (-332.640) (-333.349) (-336.358) -- 0:00:54
113500 -- (-336.293) (-332.570) [-334.559] (-332.780) * [-337.317] (-332.765) (-332.604) (-332.464) -- 0:00:54
114000 -- (-332.702) (-333.028) (-335.743) [-338.456] * (-334.891) (-333.149) [-333.135] (-332.699) -- 0:00:54
114500 -- (-334.713) (-333.477) (-333.008) [-334.298] * (-333.117) (-333.981) (-334.060) [-333.417] -- 0:00:54
115000 -- (-334.082) [-335.409] (-333.026) (-335.514) * [-332.559] (-341.716) (-334.296) (-336.970) -- 0:00:53
Average standard deviation of split frequencies: 0.024383
115500 -- (-332.512) (-337.785) [-332.832] (-334.662) * (-334.702) [-334.346] (-333.733) (-337.912) -- 0:00:53
116000 -- [-337.788] (-333.645) (-332.885) (-335.497) * [-332.417] (-333.787) (-333.380) (-334.929) -- 0:00:53
116500 -- (-335.782) [-334.345] (-332.395) (-334.907) * (-333.406) [-335.669] (-332.914) (-334.670) -- 0:00:53
117000 -- (-332.429) (-333.253) (-332.279) [-335.697] * (-334.795) (-336.664) [-335.132] (-336.788) -- 0:00:52
117500 -- (-335.082) [-334.302] (-334.015) (-337.900) * (-335.520) (-336.558) [-334.762] (-337.571) -- 0:00:52
118000 -- (-333.086) (-334.923) [-333.945] (-335.428) * (-335.452) [-336.414] (-336.554) (-336.683) -- 0:00:52
118500 -- (-333.523) [-334.698] (-334.403) (-333.483) * (-335.760) (-337.970) [-335.533] (-336.918) -- 0:00:52
119000 -- (-335.046) (-333.538) (-333.237) [-334.539] * [-333.191] (-332.541) (-334.008) (-334.854) -- 0:00:51
119500 -- [-335.493] (-335.949) (-334.299) (-333.758) * (-334.538) (-334.798) [-335.377] (-334.919) -- 0:00:51
120000 -- (-333.426) (-333.021) (-334.362) [-332.589] * (-337.502) [-333.737] (-333.940) (-339.557) -- 0:00:51
Average standard deviation of split frequencies: 0.022061
120500 -- (-336.578) (-333.627) (-335.132) [-334.503] * [-335.056] (-336.036) (-337.813) (-335.841) -- 0:00:51
121000 -- (-333.551) (-335.135) [-332.716] (-335.208) * (-337.755) [-334.015] (-343.524) (-333.818) -- 0:00:50
121500 -- [-337.703] (-332.641) (-335.689) (-338.561) * (-337.273) (-335.047) [-333.062] (-334.271) -- 0:00:50
122000 -- [-333.536] (-334.502) (-336.774) (-336.515) * (-339.664) (-335.632) [-334.119] (-332.187) -- 0:00:57
122500 -- [-334.193] (-333.687) (-334.758) (-334.682) * (-348.790) (-333.182) [-334.164] (-333.661) -- 0:00:57
123000 -- [-334.765] (-334.280) (-335.628) (-334.014) * (-333.361) [-333.628] (-335.644) (-335.452) -- 0:00:57
123500 -- (-336.653) (-333.799) (-339.421) [-332.638] * (-333.094) (-332.785) (-334.060) [-333.818] -- 0:00:56
124000 -- (-335.656) (-336.077) [-333.441] (-335.547) * (-335.711) (-333.150) (-332.922) [-334.097] -- 0:00:56
124500 -- (-335.273) (-333.499) (-335.647) [-333.531] * (-334.770) (-333.620) (-335.184) [-333.577] -- 0:00:56
125000 -- (-334.556) (-334.951) (-338.782) [-336.946] * (-332.253) (-337.668) [-334.278] (-333.740) -- 0:00:56
Average standard deviation of split frequencies: 0.019297
125500 -- [-333.678] (-334.163) (-335.430) (-334.012) * (-334.516) [-337.981] (-335.032) (-332.607) -- 0:00:55
126000 -- [-335.864] (-335.145) (-332.902) (-335.444) * (-333.185) [-335.742] (-334.075) (-332.815) -- 0:00:55
126500 -- (-332.693) (-334.973) [-334.371] (-334.089) * (-335.317) (-332.714) (-334.534) [-332.819] -- 0:00:55
127000 -- [-332.882] (-333.483) (-333.441) (-334.277) * (-332.897) (-334.284) (-335.221) [-334.662] -- 0:00:54
127500 -- (-333.241) (-334.545) [-336.012] (-333.882) * (-334.716) (-333.400) (-336.038) [-334.372] -- 0:00:54
128000 -- [-333.263] (-334.166) (-335.789) (-335.112) * [-334.801] (-336.224) (-335.666) (-339.446) -- 0:00:54
128500 -- (-333.274) (-337.000) (-338.108) [-337.247] * (-336.384) (-334.146) (-336.625) [-334.917] -- 0:00:54
129000 -- (-335.972) (-334.969) (-336.595) [-334.660] * [-333.600] (-334.287) (-332.975) (-336.019) -- 0:00:54
129500 -- (-332.876) [-333.250] (-333.060) (-336.147) * [-334.594] (-335.402) (-333.644) (-333.963) -- 0:00:53
130000 -- (-334.688) [-332.056] (-337.012) (-337.677) * [-338.287] (-335.071) (-336.449) (-332.429) -- 0:00:53
Average standard deviation of split frequencies: 0.016836
130500 -- (-341.230) (-333.267) [-335.814] (-336.910) * (-335.237) (-333.571) (-333.966) [-334.217] -- 0:00:53
131000 -- [-334.179] (-333.413) (-334.411) (-337.397) * [-336.765] (-333.407) (-338.253) (-335.261) -- 0:00:53
131500 -- (-335.047) [-334.415] (-335.285) (-333.547) * (-335.994) (-334.388) [-333.985] (-334.835) -- 0:00:52
132000 -- (-337.675) [-332.495] (-334.402) (-335.199) * [-334.939] (-334.010) (-335.754) (-335.690) -- 0:00:52
132500 -- (-334.938) (-334.134) (-335.783) [-334.849] * (-335.467) [-335.101] (-333.407) (-337.724) -- 0:00:52
133000 -- (-337.093) (-338.248) [-333.060] (-337.574) * (-334.282) (-337.006) [-334.079] (-337.338) -- 0:00:52
133500 -- (-334.617) (-334.931) [-332.858] (-335.138) * (-336.098) (-333.859) (-333.387) [-334.164] -- 0:00:51
134000 -- (-333.474) (-333.290) (-332.840) [-333.550] * (-334.250) (-337.933) [-332.349] (-333.768) -- 0:00:51
134500 -- (-336.425) [-333.063] (-334.954) (-334.257) * (-334.400) (-339.452) [-334.033] (-333.138) -- 0:00:51
135000 -- (-336.465) (-338.270) [-334.353] (-335.400) * (-335.332) [-333.418] (-337.765) (-336.209) -- 0:00:51
Average standard deviation of split frequencies: 0.016108
135500 -- (-334.663) (-334.398) (-335.188) [-334.381] * (-334.637) [-334.969] (-334.154) (-333.103) -- 0:00:51
136000 -- (-332.534) (-335.364) [-338.617] (-338.007) * (-336.008) [-334.178] (-334.115) (-334.145) -- 0:00:50
136500 -- (-334.409) (-334.265) (-332.325) [-335.074] * (-335.774) (-332.997) (-335.406) [-333.246] -- 0:00:50
137000 -- [-333.525] (-334.051) (-334.494) (-338.314) * (-332.896) (-340.063) (-333.931) [-334.154] -- 0:00:50
137500 -- (-333.034) [-333.481] (-333.370) (-335.704) * (-333.304) [-334.395] (-333.317) (-333.010) -- 0:00:50
138000 -- [-334.319] (-337.680) (-336.451) (-334.432) * (-333.876) (-335.634) (-334.390) [-335.822] -- 0:00:49
138500 -- (-333.675) (-333.489) (-335.777) [-334.965] * [-334.917] (-334.264) (-337.272) (-335.602) -- 0:00:49
139000 -- (-337.698) [-334.047] (-335.082) (-333.520) * (-334.825) (-333.404) (-333.696) [-334.933] -- 0:00:55
139500 -- (-335.983) (-335.564) [-333.903] (-334.498) * [-333.961] (-333.667) (-333.827) (-334.546) -- 0:00:55
140000 -- [-333.598] (-336.804) (-336.511) (-332.259) * (-332.869) [-333.345] (-334.849) (-334.866) -- 0:00:55
Average standard deviation of split frequencies: 0.015968
140500 -- (-337.123) (-335.197) [-334.374] (-332.693) * (-334.259) [-335.114] (-334.324) (-336.039) -- 0:00:55
141000 -- (-335.225) (-335.881) [-334.150] (-332.760) * (-338.623) (-337.037) [-335.661] (-337.457) -- 0:00:54
141500 -- (-335.420) (-334.554) (-335.621) [-335.302] * (-335.957) (-337.658) (-334.023) [-332.886] -- 0:00:54
142000 -- [-334.251] (-333.811) (-335.320) (-338.883) * [-333.558] (-332.709) (-332.947) (-334.463) -- 0:00:54
142500 -- [-333.413] (-333.261) (-341.992) (-333.801) * (-338.135) [-335.828] (-334.655) (-335.240) -- 0:00:54
143000 -- [-334.395] (-336.021) (-333.939) (-332.332) * (-334.891) [-333.144] (-333.007) (-337.915) -- 0:00:53
143500 -- [-334.409] (-335.843) (-337.111) (-333.519) * (-333.924) (-334.236) [-333.438] (-334.594) -- 0:00:53
144000 -- [-332.452] (-334.452) (-335.588) (-333.147) * (-334.308) [-333.986] (-334.077) (-333.836) -- 0:00:53
144500 -- (-333.203) (-332.305) (-334.732) [-333.253] * [-335.071] (-335.109) (-334.107) (-336.333) -- 0:00:53
145000 -- [-335.629] (-334.968) (-335.119) (-334.124) * (-336.592) (-334.011) (-332.900) [-332.894] -- 0:00:53
Average standard deviation of split frequencies: 0.016654
145500 -- [-334.153] (-333.125) (-333.055) (-336.933) * [-334.161] (-333.076) (-333.942) (-337.464) -- 0:00:52
146000 -- (-337.236) (-336.549) [-336.224] (-334.259) * (-337.741) [-335.126] (-333.093) (-335.823) -- 0:00:52
146500 -- (-334.091) (-334.830) (-333.407) [-332.313] * [-334.723] (-338.888) (-334.434) (-334.990) -- 0:00:52
147000 -- (-333.319) (-335.033) [-335.006] (-333.099) * (-333.905) (-336.668) [-333.441] (-333.200) -- 0:00:52
147500 -- (-335.285) (-333.981) [-333.468] (-335.848) * (-333.511) (-333.622) [-334.115] (-334.438) -- 0:00:52
148000 -- (-334.836) (-333.177) [-334.148] (-334.449) * (-336.501) (-338.766) (-332.962) [-334.901] -- 0:00:51
148500 -- (-336.151) (-334.900) (-334.134) [-336.269] * (-334.695) [-334.806] (-337.547) (-335.126) -- 0:00:51
149000 -- (-337.210) (-333.510) (-334.802) [-337.672] * (-334.570) (-332.950) [-335.115] (-338.157) -- 0:00:51
149500 -- (-335.079) (-333.380) (-333.913) [-334.541] * (-333.360) (-333.483) [-332.733] (-334.201) -- 0:00:51
150000 -- (-336.421) (-332.446) (-335.999) [-334.765] * (-333.663) [-333.515] (-335.084) (-335.685) -- 0:00:51
Average standard deviation of split frequencies: 0.018947
150500 -- (-335.155) (-340.633) (-337.751) [-332.892] * (-334.182) [-333.908] (-336.461) (-333.848) -- 0:00:50
151000 -- (-336.097) [-332.866] (-337.094) (-334.698) * (-334.018) (-334.285) (-337.062) [-332.421] -- 0:00:50
151500 -- (-336.511) [-332.589] (-340.179) (-333.338) * (-332.838) (-335.538) [-335.564] (-337.569) -- 0:00:50
152000 -- [-340.340] (-332.299) (-336.166) (-335.986) * (-336.259) (-333.104) [-332.625] (-333.683) -- 0:00:50
152500 -- (-333.892) (-332.711) (-333.280) [-334.019] * (-333.565) [-332.238] (-335.244) (-332.865) -- 0:00:50
153000 -- [-334.615] (-332.315) (-333.169) (-334.883) * (-333.652) [-334.486] (-335.851) (-334.265) -- 0:00:49
153500 -- (-333.477) (-333.152) (-335.664) [-334.979] * (-333.700) [-334.014] (-333.315) (-335.379) -- 0:00:49
154000 -- [-337.739] (-335.580) (-334.245) (-334.689) * [-334.396] (-341.916) (-335.889) (-332.764) -- 0:00:49
154500 -- (-335.903) [-333.925] (-334.271) (-335.109) * [-334.130] (-332.949) (-333.948) (-332.589) -- 0:00:49
155000 -- (-334.948) (-332.838) (-335.751) [-334.592] * (-333.400) (-337.453) (-333.429) [-332.844] -- 0:00:49
Average standard deviation of split frequencies: 0.018467
155500 -- (-334.838) (-333.626) [-336.996] (-337.732) * (-333.138) [-333.999] (-334.724) (-334.532) -- 0:00:54
156000 -- (-334.356) [-337.578] (-336.805) (-333.004) * [-333.816] (-335.119) (-333.590) (-337.673) -- 0:00:54
156500 -- (-333.035) (-332.904) (-339.195) [-334.476] * (-334.132) [-336.649] (-333.842) (-335.547) -- 0:00:53
157000 -- (-334.370) [-333.083] (-338.266) (-333.683) * (-333.722) (-333.677) [-333.225] (-339.629) -- 0:00:53
157500 -- (-337.102) [-333.547] (-334.073) (-335.966) * (-333.106) (-332.867) (-334.132) [-336.052] -- 0:00:53
158000 -- (-335.812) (-336.284) (-334.192) [-333.263] * (-336.133) (-333.532) [-336.641] (-335.613) -- 0:00:53
158500 -- (-335.211) (-334.182) [-336.275] (-334.457) * (-336.719) [-336.826] (-335.340) (-335.124) -- 0:00:53
159000 -- (-334.483) [-335.749] (-334.321) (-333.705) * [-334.056] (-335.909) (-335.489) (-335.550) -- 0:00:52
159500 -- (-333.874) [-335.585] (-336.179) (-335.436) * (-332.531) (-332.218) (-335.017) [-332.951] -- 0:00:52
160000 -- (-332.733) [-332.747] (-338.845) (-332.641) * (-333.775) (-332.229) [-336.003] (-332.790) -- 0:00:52
Average standard deviation of split frequencies: 0.017767
160500 -- (-333.433) [-333.777] (-338.691) (-335.204) * (-335.992) (-333.720) [-338.518] (-335.375) -- 0:00:52
161000 -- (-336.669) [-333.328] (-334.089) (-332.157) * (-335.002) (-333.396) (-334.121) [-335.072] -- 0:00:52
161500 -- [-333.361] (-333.663) (-336.888) (-334.039) * (-334.873) (-336.643) [-335.437] (-334.037) -- 0:00:51
162000 -- (-335.239) (-333.643) (-335.474) [-333.778] * (-332.653) (-334.264) (-333.799) [-333.051] -- 0:00:51
162500 -- (-335.425) (-333.008) [-337.220] (-336.646) * (-333.406) (-335.717) [-335.356] (-334.400) -- 0:00:51
163000 -- [-332.928] (-333.889) (-336.756) (-334.463) * (-333.798) (-335.866) [-334.690] (-334.753) -- 0:00:51
163500 -- (-335.280) (-333.967) (-333.836) [-333.150] * (-333.874) (-334.110) [-333.784] (-334.159) -- 0:00:51
164000 -- (-334.113) [-335.795] (-335.420) (-334.048) * (-333.953) (-333.718) (-333.833) [-333.754] -- 0:00:50
164500 -- [-333.285] (-334.518) (-335.501) (-338.841) * (-336.450) (-335.698) (-339.497) [-334.881] -- 0:00:50
165000 -- (-334.515) [-334.244] (-338.536) (-335.232) * (-338.470) (-333.250) (-339.065) [-334.812] -- 0:00:50
Average standard deviation of split frequencies: 0.016723
165500 -- (-335.435) (-332.523) [-333.665] (-336.432) * [-335.161] (-335.253) (-333.082) (-335.205) -- 0:00:50
166000 -- (-335.525) [-334.278] (-332.429) (-334.728) * (-337.118) (-332.452) [-333.296] (-335.012) -- 0:00:50
166500 -- (-333.311) [-333.164] (-333.329) (-335.755) * (-335.255) (-334.917) (-334.059) [-334.115] -- 0:00:50
167000 -- [-334.392] (-333.916) (-332.956) (-333.942) * [-334.626] (-333.749) (-336.051) (-333.999) -- 0:00:49
167500 -- (-337.310) [-335.782] (-335.183) (-334.165) * (-333.992) (-335.913) [-337.939] (-336.155) -- 0:00:49
168000 -- (-335.171) (-337.813) (-335.945) [-332.089] * (-332.457) (-336.856) [-342.207] (-335.710) -- 0:00:49
168500 -- (-335.256) (-335.674) (-336.629) [-335.299] * (-336.101) [-336.265] (-332.039) (-332.947) -- 0:00:49
169000 -- (-334.483) [-334.894] (-334.143) (-335.004) * (-334.800) [-333.000] (-333.429) (-335.965) -- 0:00:49
169500 -- (-336.018) (-335.600) [-333.477] (-333.221) * [-334.474] (-334.880) (-333.988) (-332.493) -- 0:00:48
170000 -- (-334.239) [-333.350] (-333.540) (-336.031) * [-334.800] (-332.657) (-333.708) (-332.694) -- 0:00:48
Average standard deviation of split frequencies: 0.019010
170500 -- (-334.327) (-333.081) [-334.449] (-337.459) * (-335.366) [-334.548] (-334.439) (-337.624) -- 0:00:48
171000 -- (-335.297) (-335.323) (-335.005) [-333.390] * (-333.012) (-334.955) (-336.991) [-332.801] -- 0:00:48
171500 -- (-336.204) (-335.145) [-332.348] (-335.875) * (-336.548) [-332.203] (-337.489) (-336.065) -- 0:00:48
172000 -- [-334.025] (-334.643) (-333.712) (-339.865) * (-332.956) (-332.803) [-334.666] (-336.339) -- 0:00:48
172500 -- [-333.223] (-336.442) (-335.538) (-333.799) * (-332.929) (-333.151) (-336.426) [-332.347] -- 0:00:52
173000 -- (-336.482) [-335.332] (-336.340) (-333.372) * [-334.503] (-333.441) (-332.862) (-333.963) -- 0:00:52
173500 -- (-337.922) (-333.406) [-335.902] (-333.952) * (-337.739) (-334.437) (-334.522) [-333.290] -- 0:00:52
174000 -- [-333.639] (-337.931) (-334.074) (-336.713) * [-334.274] (-334.572) (-332.942) (-333.084) -- 0:00:52
174500 -- (-335.195) (-333.458) (-333.269) [-333.880] * (-334.415) (-336.254) [-333.393] (-333.777) -- 0:00:52
175000 -- (-339.258) (-337.541) [-334.704] (-338.678) * (-335.557) [-334.928] (-333.614) (-333.425) -- 0:00:51
Average standard deviation of split frequencies: 0.018749
175500 -- (-335.021) [-335.540] (-335.538) (-335.784) * [-334.619] (-333.117) (-333.499) (-334.764) -- 0:00:51
176000 -- (-334.407) (-332.927) (-334.346) [-334.794] * (-338.015) (-336.027) [-336.724] (-336.801) -- 0:00:51
176500 -- (-332.415) (-333.220) [-334.230] (-335.319) * (-335.392) (-335.431) (-333.516) [-332.872] -- 0:00:51
177000 -- (-332.570) [-333.037] (-332.709) (-336.669) * (-334.992) (-333.482) (-332.510) [-335.045] -- 0:00:51
177500 -- (-333.222) [-333.406] (-333.879) (-340.249) * (-336.209) (-333.556) [-332.054] (-332.272) -- 0:00:50
178000 -- (-334.023) [-333.350] (-335.271) (-341.138) * (-338.101) (-335.578) (-332.752) [-333.028] -- 0:00:50
178500 -- (-337.030) (-334.965) (-336.179) [-338.578] * (-332.718) (-333.660) (-336.760) [-334.020] -- 0:00:50
179000 -- (-339.778) [-332.620] (-334.469) (-333.937) * (-334.209) (-333.597) [-333.664] (-334.590) -- 0:00:50
179500 -- (-332.984) (-334.679) (-336.576) [-336.843] * [-332.929] (-332.424) (-334.876) (-333.349) -- 0:00:50
180000 -- (-333.282) (-348.230) [-332.864] (-338.545) * (-334.605) [-334.375] (-335.514) (-333.143) -- 0:00:50
Average standard deviation of split frequencies: 0.019569
180500 -- [-332.735] (-335.501) (-332.754) (-338.121) * (-334.659) (-336.842) [-333.019] (-335.107) -- 0:00:49
181000 -- (-333.908) (-335.363) (-333.260) [-332.917] * (-333.973) [-334.131] (-333.039) (-335.784) -- 0:00:49
181500 -- (-341.206) [-337.100] (-336.013) (-332.866) * (-336.204) (-336.282) (-333.460) [-336.370] -- 0:00:49
182000 -- (-337.570) [-334.837] (-336.365) (-332.774) * (-333.725) (-334.610) (-333.471) [-333.338] -- 0:00:49
182500 -- (-333.990) (-336.832) [-333.122] (-334.809) * (-335.933) (-336.236) [-333.676] (-334.049) -- 0:00:49
183000 -- [-333.063] (-335.403) (-334.456) (-332.506) * (-334.086) [-333.194] (-334.357) (-338.368) -- 0:00:49
183500 -- (-335.268) (-333.392) [-337.511] (-332.160) * (-332.830) (-335.162) (-333.319) [-336.674] -- 0:00:48
184000 -- (-336.087) (-333.381) (-333.175) [-334.160] * [-332.963] (-334.646) (-333.269) (-337.525) -- 0:00:48
184500 -- (-332.494) (-334.216) [-333.503] (-337.208) * (-336.161) [-333.668] (-333.962) (-333.199) -- 0:00:48
185000 -- (-336.699) (-332.653) [-336.894] (-337.136) * (-336.583) (-334.335) [-333.676] (-334.287) -- 0:00:48
Average standard deviation of split frequencies: 0.020557
185500 -- [-334.251] (-333.993) (-333.832) (-335.617) * [-333.953] (-333.542) (-335.448) (-334.127) -- 0:00:48
186000 -- [-333.171] (-337.993) (-333.455) (-340.546) * (-333.290) (-332.831) (-335.121) [-338.795] -- 0:00:48
186500 -- (-334.337) [-336.390] (-333.095) (-333.574) * (-334.542) (-333.694) (-337.004) [-332.573] -- 0:00:47
187000 -- (-333.701) [-335.767] (-335.078) (-338.671) * (-334.099) (-334.887) (-334.707) [-334.894] -- 0:00:47
187500 -- (-333.482) [-337.607] (-337.513) (-336.745) * [-334.001] (-335.706) (-333.380) (-334.138) -- 0:00:47
188000 -- (-334.018) [-332.716] (-334.221) (-337.638) * (-333.662) [-334.931] (-334.524) (-336.668) -- 0:00:47
188500 -- (-335.803) [-336.209] (-333.607) (-338.124) * [-334.601] (-338.109) (-335.230) (-337.287) -- 0:00:47
189000 -- (-334.574) (-335.248) (-333.723) [-334.012] * (-332.925) (-340.028) [-334.045] (-334.520) -- 0:00:47
189500 -- (-333.072) (-335.268) [-334.789] (-335.958) * [-333.187] (-335.355) (-334.168) (-332.157) -- 0:00:51
190000 -- (-334.582) [-334.879] (-338.331) (-335.664) * (-332.869) (-333.451) [-337.718] (-333.307) -- 0:00:51
Average standard deviation of split frequencies: 0.020070
190500 -- [-333.452] (-334.026) (-337.399) (-336.615) * [-336.213] (-334.644) (-334.318) (-334.611) -- 0:00:50
191000 -- [-333.343] (-335.987) (-332.948) (-334.599) * (-334.507) (-334.240) (-333.447) [-336.191] -- 0:00:50
191500 -- (-338.576) (-333.508) (-334.033) [-334.089] * (-336.037) (-335.173) [-333.266] (-333.160) -- 0:00:50
192000 -- (-339.588) [-334.908] (-336.379) (-333.958) * (-337.265) (-333.639) [-332.390] (-333.061) -- 0:00:50
192500 -- [-338.575] (-334.393) (-334.411) (-333.063) * (-332.685) (-336.687) [-332.612] (-336.357) -- 0:00:50
193000 -- (-337.223) (-334.851) (-334.505) [-335.507] * (-333.984) (-335.256) (-333.332) [-334.010] -- 0:00:50
193500 -- (-335.189) (-334.056) (-334.213) [-333.661] * [-333.429] (-334.753) (-336.408) (-332.129) -- 0:00:50
194000 -- (-333.797) [-333.830] (-335.005) (-332.362) * (-335.977) (-335.861) [-335.544] (-334.543) -- 0:00:49
194500 -- (-333.632) [-334.765] (-336.368) (-334.578) * (-333.285) (-335.640) (-333.796) [-338.043] -- 0:00:49
195000 -- [-332.672] (-336.069) (-334.468) (-335.199) * [-333.887] (-334.538) (-337.430) (-335.497) -- 0:00:49
Average standard deviation of split frequencies: 0.019091
195500 -- [-333.395] (-334.736) (-334.006) (-335.901) * (-332.934) (-335.533) (-333.695) [-335.898] -- 0:00:49
196000 -- (-333.787) (-337.121) [-332.294] (-333.527) * [-335.277] (-334.865) (-333.492) (-334.281) -- 0:00:49
196500 -- (-334.827) (-335.359) (-332.353) [-334.472] * (-334.832) (-334.194) (-334.486) [-335.941] -- 0:00:49
197000 -- (-335.929) [-335.893] (-332.623) (-337.053) * (-334.124) (-333.875) (-334.832) [-339.663] -- 0:00:48
197500 -- (-344.334) [-332.508] (-337.138) (-335.269) * (-333.322) (-335.573) (-335.975) [-334.510] -- 0:00:48
198000 -- (-335.777) (-336.786) [-336.738] (-336.188) * (-333.276) (-335.293) (-334.195) [-338.347] -- 0:00:48
198500 -- [-333.065] (-336.324) (-334.541) (-333.756) * (-332.893) (-335.818) (-334.250) [-335.606] -- 0:00:48
199000 -- (-335.817) (-335.932) [-333.876] (-334.594) * (-337.469) [-333.025] (-334.695) (-336.412) -- 0:00:48
199500 -- (-334.326) (-335.854) [-333.866] (-335.054) * (-335.480) [-333.317] (-337.935) (-336.139) -- 0:00:48
200000 -- (-334.114) (-335.537) (-336.637) [-337.570] * (-336.993) [-334.962] (-338.004) (-336.687) -- 0:00:48
Average standard deviation of split frequencies: 0.018517
200500 -- (-333.154) (-341.282) (-334.552) [-335.738] * (-333.580) (-334.991) (-334.274) [-334.005] -- 0:00:47
201000 -- (-334.534) (-340.842) [-334.215] (-333.989) * [-334.294] (-333.778) (-335.377) (-334.532) -- 0:00:47
201500 -- (-332.421) (-337.073) [-334.110] (-339.680) * [-334.077] (-333.654) (-333.237) (-336.172) -- 0:00:47
202000 -- (-336.587) (-336.381) (-335.785) [-334.383] * (-334.405) [-332.981] (-332.263) (-334.837) -- 0:00:47
202500 -- [-336.965] (-340.066) (-335.238) (-334.450) * [-334.220] (-333.910) (-335.945) (-336.651) -- 0:00:47
203000 -- [-333.937] (-335.499) (-339.076) (-333.432) * (-334.382) [-334.731] (-334.973) (-334.932) -- 0:00:47
203500 -- (-339.133) (-333.746) [-335.999] (-333.991) * [-333.167] (-336.721) (-339.570) (-333.856) -- 0:00:46
204000 -- (-337.163) (-332.351) [-333.190] (-338.541) * (-334.103) [-334.495] (-334.537) (-334.826) -- 0:00:46
204500 -- (-332.406) (-334.008) (-335.789) [-335.203] * (-336.782) (-333.705) (-335.640) [-332.971] -- 0:00:46
205000 -- (-336.114) (-333.138) [-333.792] (-333.626) * (-332.517) (-332.968) (-336.016) [-333.403] -- 0:00:46
Average standard deviation of split frequencies: 0.018053
205500 -- (-335.634) [-335.684] (-333.790) (-335.568) * [-332.714] (-335.874) (-333.343) (-334.533) -- 0:00:46
206000 -- [-333.864] (-336.392) (-336.566) (-332.170) * (-339.459) [-334.001] (-333.749) (-335.288) -- 0:00:46
206500 -- (-336.669) (-336.379) [-334.895] (-335.442) * (-333.508) (-334.343) (-333.229) [-334.143] -- 0:00:49
207000 -- (-335.536) (-333.848) [-333.239] (-334.667) * (-334.106) (-332.999) [-332.725] (-334.307) -- 0:00:49
207500 -- [-333.366] (-332.421) (-333.073) (-334.104) * (-337.119) (-335.008) [-333.402] (-334.115) -- 0:00:49
208000 -- [-333.172] (-332.723) (-333.877) (-335.293) * (-334.470) (-332.700) (-333.750) [-333.557] -- 0:00:49
208500 -- (-333.760) [-334.498] (-332.744) (-333.785) * (-336.136) (-333.431) (-333.729) [-333.285] -- 0:00:49
209000 -- [-337.808] (-334.945) (-333.647) (-334.875) * (-334.951) (-333.884) [-332.908] (-336.310) -- 0:00:49
209500 -- [-335.555] (-334.047) (-332.772) (-333.528) * (-338.716) (-335.860) [-332.644] (-337.157) -- 0:00:49
210000 -- (-332.653) [-333.834] (-341.860) (-333.195) * (-338.055) (-334.370) (-332.860) [-333.559] -- 0:00:48
Average standard deviation of split frequencies: 0.017528
210500 -- (-334.195) [-337.173] (-334.420) (-333.365) * (-334.191) (-335.312) (-335.999) [-334.020] -- 0:00:48
211000 -- (-333.804) (-333.324) [-334.854] (-334.786) * (-336.676) [-333.121] (-333.601) (-334.686) -- 0:00:48
211500 -- (-334.645) (-335.283) (-333.292) [-333.904] * (-334.661) [-332.803] (-332.962) (-340.977) -- 0:00:48
212000 -- (-334.284) (-334.353) (-338.720) [-332.633] * (-333.633) [-333.819] (-332.580) (-335.559) -- 0:00:48
212500 -- (-333.958) (-345.038) (-335.558) [-333.106] * (-332.655) [-336.933] (-334.134) (-334.102) -- 0:00:48
213000 -- (-335.503) (-337.148) (-333.951) [-335.382] * [-335.956] (-332.991) (-334.740) (-336.849) -- 0:00:48
213500 -- (-333.422) (-335.785) [-333.772] (-337.497) * (-332.991) (-333.989) (-335.845) [-336.648] -- 0:00:47
214000 -- [-337.797] (-332.945) (-333.108) (-333.698) * (-333.232) (-333.231) (-340.264) [-337.281] -- 0:00:47
214500 -- (-333.824) [-333.694] (-332.794) (-333.636) * (-334.610) (-333.101) [-338.349] (-337.163) -- 0:00:47
215000 -- (-335.440) (-334.358) (-332.719) [-333.575] * (-336.048) [-332.499] (-335.742) (-333.029) -- 0:00:47
Average standard deviation of split frequencies: 0.018551
215500 -- [-335.258] (-333.489) (-337.238) (-336.765) * (-334.706) (-332.598) (-338.717) [-335.765] -- 0:00:47
216000 -- (-333.886) (-332.858) [-335.323] (-333.391) * (-333.613) (-334.278) [-334.047] (-334.930) -- 0:00:47
216500 -- (-333.611) (-334.545) [-334.850] (-334.488) * [-332.696] (-334.092) (-333.746) (-334.421) -- 0:00:47
217000 -- (-333.327) (-339.532) [-335.466] (-334.432) * (-333.135) (-332.951) [-338.145] (-333.601) -- 0:00:46
217500 -- (-333.205) (-337.299) (-335.162) [-334.919] * [-334.463] (-332.604) (-335.661) (-335.119) -- 0:00:46
218000 -- (-332.940) [-334.269] (-340.621) (-335.287) * (-333.071) (-333.917) [-334.054] (-335.206) -- 0:00:46
218500 -- (-333.482) (-335.214) (-332.989) [-335.692] * (-335.706) (-333.831) (-334.271) [-334.955] -- 0:00:46
219000 -- [-334.826] (-333.320) (-335.342) (-333.049) * (-336.663) (-334.558) (-336.173) [-334.203] -- 0:00:46
219500 -- (-336.881) [-332.092] (-334.505) (-334.689) * (-335.021) (-334.511) [-332.491] (-333.435) -- 0:00:46
220000 -- [-335.600] (-334.541) (-336.165) (-332.984) * (-335.412) (-335.870) (-334.053) [-334.019] -- 0:00:46
Average standard deviation of split frequencies: 0.017921
220500 -- (-335.168) [-334.253] (-334.784) (-339.487) * (-334.782) [-334.208] (-332.802) (-334.934) -- 0:00:45
221000 -- (-335.009) (-334.417) (-334.410) [-334.188] * (-334.990) (-333.768) [-336.752] (-332.723) -- 0:00:45
221500 -- [-332.819] (-334.909) (-335.875) (-333.063) * (-334.780) (-332.429) (-335.898) [-333.262] -- 0:00:45
222000 -- (-333.882) [-335.460] (-337.771) (-334.112) * (-338.916) [-333.883] (-334.604) (-333.041) -- 0:00:45
222500 -- (-333.616) (-336.017) (-338.626) [-332.878] * [-336.672] (-335.198) (-336.734) (-337.144) -- 0:00:45
223000 -- [-334.849] (-333.651) (-340.655) (-337.755) * [-334.321] (-333.608) (-333.799) (-332.277) -- 0:00:45
223500 -- (-335.123) (-332.423) [-336.572] (-333.934) * (-333.502) (-332.878) (-333.345) [-332.566] -- 0:00:48
224000 -- (-339.844) (-332.854) (-335.649) [-334.169] * (-333.582) (-336.879) (-333.848) [-333.155] -- 0:00:48
224500 -- (-337.262) [-333.096] (-334.298) (-338.091) * (-333.781) (-335.695) [-333.685] (-338.512) -- 0:00:48
225000 -- (-332.986) [-333.469] (-332.768) (-335.467) * (-338.840) (-335.995) [-332.498] (-335.518) -- 0:00:48
Average standard deviation of split frequencies: 0.018077
225500 -- (-336.289) (-334.393) [-334.524] (-338.697) * (-334.370) [-335.255] (-333.826) (-334.600) -- 0:00:48
226000 -- (-339.618) (-332.927) [-333.513] (-333.873) * (-334.082) (-332.679) (-334.757) [-332.689] -- 0:00:47
226500 -- (-337.421) (-333.298) (-340.701) [-332.653] * (-342.110) [-334.356] (-336.370) (-333.276) -- 0:00:47
227000 -- (-334.916) (-333.344) (-335.262) [-333.489] * (-334.498) [-334.560] (-334.023) (-338.690) -- 0:00:47
227500 -- (-333.682) (-333.913) [-332.934] (-334.105) * (-340.014) (-336.221) (-333.222) [-334.680] -- 0:00:47
228000 -- (-335.080) [-333.612] (-333.484) (-333.802) * [-334.310] (-334.840) (-333.749) (-332.715) -- 0:00:47
228500 -- (-334.483) [-333.293] (-336.437) (-337.794) * (-334.512) [-332.643] (-333.385) (-332.899) -- 0:00:47
229000 -- (-332.773) (-335.162) (-336.604) [-334.214] * (-334.419) [-333.251] (-335.714) (-333.004) -- 0:00:47
229500 -- (-342.650) (-338.903) [-333.377] (-334.198) * [-337.195] (-334.188) (-335.636) (-334.162) -- 0:00:47
230000 -- (-333.506) (-337.383) [-333.934] (-332.554) * (-336.770) [-333.944] (-333.130) (-332.114) -- 0:00:46
Average standard deviation of split frequencies: 0.017825
230500 -- (-332.380) (-335.280) (-334.142) [-334.697] * [-335.452] (-336.236) (-333.379) (-333.661) -- 0:00:46
231000 -- [-332.383] (-332.842) (-335.822) (-337.476) * [-332.330] (-334.644) (-337.254) (-338.630) -- 0:00:46
231500 -- (-333.453) (-332.782) [-332.066] (-334.643) * (-332.460) (-336.173) (-335.008) [-333.709] -- 0:00:46
232000 -- (-334.123) [-334.383] (-333.567) (-333.956) * (-339.972) (-333.865) [-336.454] (-334.579) -- 0:00:46
232500 -- (-336.888) (-335.907) [-335.684] (-332.624) * (-338.949) (-336.708) [-335.048] (-334.150) -- 0:00:46
233000 -- (-336.357) (-335.701) (-333.705) [-334.073] * (-336.309) (-333.044) [-337.002] (-336.615) -- 0:00:46
233500 -- (-337.342) (-336.150) [-332.295] (-333.160) * (-333.129) (-333.389) (-337.584) [-334.846] -- 0:00:45
234000 -- (-337.832) (-333.736) (-333.876) [-336.107] * (-332.364) (-332.943) [-332.952] (-337.835) -- 0:00:45
234500 -- (-339.097) (-333.968) [-336.572] (-335.994) * (-334.310) [-334.966] (-334.603) (-335.759) -- 0:00:45
235000 -- (-334.776) (-335.789) (-336.846) [-333.442] * [-334.479] (-334.834) (-333.411) (-334.914) -- 0:00:45
Average standard deviation of split frequencies: 0.019864
235500 -- (-333.849) (-336.832) (-333.747) [-334.578] * [-333.848] (-338.013) (-333.216) (-333.309) -- 0:00:45
236000 -- [-334.894] (-339.536) (-333.785) (-335.112) * (-333.352) (-336.158) [-334.179] (-334.521) -- 0:00:45
236500 -- (-336.578) (-336.091) (-336.126) [-335.297] * (-333.428) (-335.036) [-332.081] (-335.402) -- 0:00:45
237000 -- [-335.452] (-335.368) (-336.214) (-334.423) * (-334.233) [-335.941] (-335.445) (-335.741) -- 0:00:45
237500 -- (-335.843) [-334.528] (-337.427) (-333.088) * (-336.255) (-334.290) (-333.501) [-335.290] -- 0:00:44
238000 -- [-335.487] (-336.155) (-338.575) (-334.573) * (-336.315) (-334.093) (-336.470) [-332.914] -- 0:00:44
238500 -- (-337.083) [-336.289] (-332.472) (-335.178) * [-336.248] (-338.632) (-334.362) (-338.414) -- 0:00:44
239000 -- (-336.297) (-335.212) [-333.806] (-333.700) * [-334.951] (-335.043) (-334.991) (-334.421) -- 0:00:44
239500 -- (-333.731) (-334.988) (-332.544) [-333.575] * (-335.667) [-333.589] (-335.400) (-334.904) -- 0:00:44
240000 -- (-333.170) (-338.466) [-335.486] (-334.482) * [-334.257] (-334.497) (-335.069) (-333.395) -- 0:00:44
Average standard deviation of split frequencies: 0.018550
240500 -- (-337.913) (-334.598) [-334.453] (-333.822) * [-333.331] (-332.793) (-332.471) (-334.070) -- 0:00:44
241000 -- (-332.554) (-333.781) [-336.032] (-335.656) * (-332.136) [-332.956] (-335.334) (-339.069) -- 0:00:47
241500 -- [-336.724] (-332.399) (-337.237) (-336.340) * [-332.929] (-333.391) (-338.285) (-334.685) -- 0:00:47
242000 -- [-333.467] (-332.963) (-335.518) (-332.975) * (-336.287) (-334.878) (-333.837) [-332.075] -- 0:00:46
242500 -- (-334.642) (-336.759) [-333.892] (-335.946) * (-340.185) (-335.781) [-333.571] (-333.393) -- 0:00:46
243000 -- [-338.346] (-332.740) (-332.829) (-335.431) * (-334.535) (-336.098) (-332.150) [-333.464] -- 0:00:46
243500 -- [-336.617] (-334.355) (-335.595) (-336.193) * [-335.281] (-337.292) (-332.326) (-332.658) -- 0:00:46
244000 -- [-337.656] (-332.708) (-333.429) (-334.249) * [-335.410] (-333.949) (-333.424) (-335.642) -- 0:00:46
244500 -- (-335.663) (-334.117) (-335.256) [-334.262] * (-333.344) [-334.707] (-333.497) (-337.176) -- 0:00:46
245000 -- (-334.989) [-333.848] (-335.063) (-332.790) * [-332.833] (-340.325) (-333.831) (-338.220) -- 0:00:46
Average standard deviation of split frequencies: 0.018457
245500 -- [-334.972] (-335.284) (-333.747) (-334.159) * (-332.537) [-333.526] (-333.353) (-334.716) -- 0:00:46
246000 -- (-334.974) [-335.021] (-339.001) (-336.126) * [-333.924] (-333.865) (-335.702) (-333.942) -- 0:00:45
246500 -- [-334.654] (-337.706) (-335.373) (-338.279) * (-334.868) (-335.889) (-340.385) [-336.104] -- 0:00:45
247000 -- (-336.819) (-336.545) [-333.347] (-336.758) * (-333.943) (-333.548) [-335.426] (-334.342) -- 0:00:45
247500 -- (-333.938) (-332.855) (-337.790) [-333.103] * (-334.668) (-334.065) (-333.063) [-333.930] -- 0:00:45
248000 -- (-333.974) (-334.698) (-343.127) [-333.866] * [-336.294] (-333.998) (-334.208) (-335.270) -- 0:00:45
248500 -- (-332.545) [-333.886] (-337.343) (-333.911) * (-337.610) (-333.852) (-336.156) [-336.513] -- 0:00:45
249000 -- (-333.560) (-334.755) [-334.439] (-336.535) * [-334.713] (-337.161) (-333.113) (-333.355) -- 0:00:45
249500 -- (-333.401) (-333.624) [-332.834] (-333.696) * (-335.650) (-338.038) [-333.514] (-332.980) -- 0:00:45
250000 -- (-332.416) (-334.267) (-333.422) [-333.976] * (-332.500) (-333.426) [-332.939] (-333.760) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-332.453) (-339.617) [-335.486] (-340.747) * (-332.261) [-333.557] (-334.041) (-337.260) -- 0:00:44
251000 -- (-337.453) [-333.446] (-334.855) (-337.415) * (-334.361) (-332.706) (-336.996) [-333.082] -- 0:00:44
251500 -- (-336.876) (-337.182) (-335.839) [-334.601] * [-333.659] (-339.490) (-334.327) (-334.856) -- 0:00:44
252000 -- [-336.537] (-336.894) (-333.058) (-334.224) * [-332.602] (-338.299) (-333.553) (-335.514) -- 0:00:44
252500 -- (-336.824) (-332.204) (-333.489) [-334.551] * (-337.245) (-333.652) [-333.187] (-336.152) -- 0:00:44
253000 -- (-332.347) [-333.606] (-335.099) (-334.153) * (-334.159) (-336.270) [-333.542] (-335.674) -- 0:00:44
253500 -- (-333.997) (-333.360) [-336.035] (-339.962) * [-333.516] (-333.537) (-337.536) (-336.197) -- 0:00:44
254000 -- (-334.649) [-338.080] (-333.966) (-337.921) * [-333.586] (-334.594) (-336.669) (-336.650) -- 0:00:44
254500 -- [-334.123] (-338.257) (-333.763) (-335.376) * (-334.101) [-334.401] (-334.922) (-336.008) -- 0:00:43
255000 -- [-333.311] (-336.563) (-333.589) (-337.527) * (-336.329) (-333.133) [-333.216] (-335.431) -- 0:00:43
Average standard deviation of split frequencies: 0.018721
255500 -- (-333.561) (-335.081) (-335.023) [-332.945] * (-333.296) (-333.129) [-333.210] (-334.237) -- 0:00:43
256000 -- [-332.419] (-333.385) (-333.403) (-333.015) * [-334.305] (-335.113) (-340.614) (-333.757) -- 0:00:43
256500 -- (-334.094) [-336.061] (-333.072) (-333.778) * (-333.817) (-333.178) (-334.086) [-333.990] -- 0:00:43
257000 -- (-333.836) (-334.413) (-333.712) [-333.701] * (-333.618) [-333.324] (-334.657) (-337.673) -- 0:00:43
257500 -- (-334.097) (-336.356) (-332.334) [-332.461] * [-335.067] (-332.834) (-333.027) (-334.762) -- 0:00:43
258000 -- (-333.207) [-335.293] (-334.397) (-333.398) * (-335.908) [-335.316] (-332.104) (-333.084) -- 0:00:46
258500 -- (-334.551) [-333.030] (-333.504) (-333.466) * (-336.827) [-337.937] (-335.393) (-335.181) -- 0:00:45
259000 -- [-332.517] (-338.114) (-335.490) (-332.389) * (-333.939) [-333.330] (-335.127) (-334.490) -- 0:00:45
259500 -- (-332.306) [-338.666] (-335.550) (-334.313) * (-345.845) (-334.131) (-333.156) [-335.087] -- 0:00:45
260000 -- (-337.627) (-337.384) [-336.022] (-334.494) * (-340.000) [-334.704] (-334.530) (-333.643) -- 0:00:45
Average standard deviation of split frequencies: 0.019417
260500 -- (-336.140) (-336.387) (-335.600) [-333.775] * [-335.143] (-332.977) (-333.738) (-334.503) -- 0:00:45
261000 -- (-334.267) (-335.016) (-334.300) [-336.379] * (-333.277) (-332.434) [-334.083] (-334.153) -- 0:00:45
261500 -- [-333.375] (-332.930) (-334.590) (-336.829) * (-333.577) (-332.268) (-334.105) [-336.409] -- 0:00:45
262000 -- [-332.363] (-335.657) (-334.957) (-336.538) * [-332.437] (-334.156) (-336.076) (-335.798) -- 0:00:45
262500 -- (-334.263) (-332.680) (-335.815) [-333.249] * (-332.366) (-338.395) [-333.058] (-334.841) -- 0:00:44
263000 -- (-334.153) (-333.282) (-334.529) [-332.941] * (-334.240) (-333.594) [-333.266] (-335.089) -- 0:00:44
263500 -- (-332.178) (-332.840) (-335.012) [-332.619] * (-337.962) [-334.764] (-334.774) (-334.573) -- 0:00:44
264000 -- (-332.687) (-335.395) [-334.291] (-336.555) * [-333.421] (-335.250) (-332.557) (-336.868) -- 0:00:44
264500 -- [-332.976] (-335.529) (-333.686) (-336.336) * [-333.728] (-333.076) (-337.242) (-335.581) -- 0:00:44
265000 -- (-333.804) (-335.332) [-332.861] (-334.455) * [-332.901] (-333.330) (-334.768) (-333.402) -- 0:00:44
Average standard deviation of split frequencies: 0.019681
265500 -- (-333.998) (-335.021) (-340.930) [-335.941] * (-332.760) (-334.313) (-334.887) [-334.518] -- 0:00:44
266000 -- [-334.842] (-336.706) (-333.324) (-333.474) * (-333.752) (-334.519) (-333.337) [-334.578] -- 0:00:44
266500 -- (-335.234) (-335.377) (-337.331) [-332.631] * [-337.399] (-335.423) (-334.680) (-335.292) -- 0:00:44
267000 -- [-333.413] (-334.225) (-334.375) (-334.440) * [-333.031] (-333.658) (-335.268) (-334.020) -- 0:00:43
267500 -- (-333.996) (-333.323) [-332.452] (-333.298) * [-332.202] (-334.137) (-336.055) (-335.284) -- 0:00:43
268000 -- (-334.055) [-333.047] (-332.417) (-333.434) * (-334.250) (-333.716) (-336.265) [-339.634] -- 0:00:43
268500 -- (-333.561) (-334.080) [-334.373] (-336.480) * [-334.471] (-332.926) (-335.237) (-334.496) -- 0:00:43
269000 -- (-333.347) (-333.987) (-336.201) [-338.680] * [-333.424] (-333.075) (-335.138) (-339.219) -- 0:00:43
269500 -- (-335.044) (-333.528) (-333.367) [-334.163] * (-335.756) (-333.805) (-334.469) [-334.900] -- 0:00:43
270000 -- (-340.630) (-334.419) (-334.328) [-334.975] * (-334.405) (-334.117) (-333.964) [-334.400] -- 0:00:43
Average standard deviation of split frequencies: 0.018026
270500 -- [-335.711] (-332.666) (-333.633) (-335.912) * (-336.001) [-337.302] (-336.134) (-332.713) -- 0:00:43
271000 -- (-333.648) (-333.777) (-334.497) [-336.596] * (-334.757) [-334.296] (-337.754) (-334.783) -- 0:00:43
271500 -- (-332.755) [-333.713] (-332.269) (-335.307) * (-335.205) (-339.214) (-335.114) [-333.643] -- 0:00:42
272000 -- (-332.497) (-333.151) [-332.836] (-338.854) * (-334.283) (-334.633) (-335.585) [-333.637] -- 0:00:42
272500 -- [-333.259] (-334.223) (-332.781) (-338.169) * [-334.581] (-333.362) (-334.038) (-334.255) -- 0:00:42
273000 -- [-333.398] (-334.954) (-332.572) (-336.230) * (-334.179) (-336.110) (-333.542) [-333.523] -- 0:00:42
273500 -- (-334.148) [-334.508] (-336.415) (-333.738) * (-333.219) (-334.888) (-334.411) [-334.106] -- 0:00:42
274000 -- [-334.210] (-332.579) (-334.510) (-334.375) * (-334.110) (-335.798) (-334.377) [-333.172] -- 0:00:42
274500 -- (-334.562) (-333.256) (-335.379) [-335.055] * (-336.272) (-333.533) (-334.389) [-336.702] -- 0:00:42
275000 -- (-335.023) [-332.956] (-336.157) (-336.163) * (-338.712) (-334.411) [-333.675] (-339.944) -- 0:00:42
Average standard deviation of split frequencies: 0.018503
275500 -- [-333.347] (-333.827) (-332.523) (-334.116) * (-333.820) (-333.252) [-332.915] (-333.582) -- 0:00:44
276000 -- (-333.871) (-333.761) [-333.358] (-332.322) * (-334.760) (-334.669) [-332.379] (-334.425) -- 0:00:44
276500 -- (-333.996) [-334.425] (-342.163) (-333.448) * (-332.169) [-334.809] (-333.531) (-334.862) -- 0:00:44
277000 -- [-334.472] (-333.860) (-338.247) (-332.291) * (-333.557) [-334.636] (-333.840) (-332.587) -- 0:00:44
277500 -- (-335.286) [-335.451] (-333.561) (-332.921) * (-333.841) (-340.501) (-335.047) [-333.201] -- 0:00:44
278000 -- (-333.124) (-335.805) (-334.095) [-333.281] * (-337.299) [-334.739] (-334.730) (-332.916) -- 0:00:44
278500 -- (-336.336) (-334.340) (-340.443) [-332.975] * (-336.235) (-334.961) [-338.908] (-333.815) -- 0:00:44
279000 -- (-334.872) (-334.147) [-335.877] (-335.969) * (-333.790) (-338.768) (-332.772) [-333.233] -- 0:00:43
279500 -- [-334.541] (-333.156) (-334.820) (-335.109) * (-335.363) (-335.595) [-335.257] (-335.715) -- 0:00:43
280000 -- [-339.232] (-338.234) (-336.104) (-335.135) * (-338.796) (-337.152) [-336.120] (-337.068) -- 0:00:43
Average standard deviation of split frequencies: 0.016401
280500 -- [-334.795] (-335.390) (-333.818) (-335.514) * (-335.847) (-334.669) (-333.636) [-336.131] -- 0:00:43
281000 -- [-333.681] (-333.818) (-334.309) (-333.843) * (-336.350) (-334.031) (-334.530) [-333.227] -- 0:00:43
281500 -- (-333.576) [-335.339] (-335.364) (-333.155) * [-337.560] (-335.402) (-337.457) (-336.313) -- 0:00:43
282000 -- (-334.889) (-339.259) [-334.164] (-334.282) * (-336.439) (-336.730) (-337.667) [-335.680] -- 0:00:43
282500 -- (-334.035) [-337.617] (-336.746) (-334.915) * [-334.913] (-338.050) (-335.385) (-334.767) -- 0:00:43
283000 -- (-335.874) (-334.254) [-332.954] (-334.959) * [-334.824] (-333.897) (-337.077) (-335.892) -- 0:00:43
283500 -- (-337.859) [-333.801] (-332.955) (-333.233) * (-332.411) (-334.272) [-334.718] (-334.079) -- 0:00:42
284000 -- [-334.843] (-334.509) (-332.945) (-333.188) * (-334.536) (-335.033) (-335.560) [-332.929] -- 0:00:42
284500 -- (-332.930) (-334.295) [-332.462] (-335.719) * [-333.920] (-336.196) (-332.848) (-333.473) -- 0:00:42
285000 -- [-336.782] (-333.707) (-332.934) (-333.832) * (-334.131) (-333.132) (-334.961) [-334.946] -- 0:00:42
Average standard deviation of split frequencies: 0.017032
285500 -- (-337.864) (-332.574) [-334.082] (-336.215) * (-336.273) (-336.233) [-334.882] (-334.786) -- 0:00:42
286000 -- [-336.847] (-333.273) (-333.011) (-338.969) * (-334.209) (-334.884) (-333.661) [-336.291] -- 0:00:42
286500 -- [-333.545] (-333.019) (-337.314) (-338.554) * (-335.189) (-339.193) [-333.572] (-333.551) -- 0:00:42
287000 -- (-335.744) (-334.911) (-335.834) [-337.548] * (-335.059) (-334.800) (-333.311) [-333.285] -- 0:00:42
287500 -- (-332.589) (-338.247) (-334.788) [-333.730] * (-334.161) [-334.560] (-334.466) (-336.026) -- 0:00:42
288000 -- (-333.929) (-336.647) [-334.932] (-335.938) * [-334.222] (-333.977) (-337.179) (-333.966) -- 0:00:42
288500 -- (-336.387) (-337.194) (-336.572) [-334.836] * (-335.764) (-336.485) [-334.118] (-337.695) -- 0:00:41
289000 -- [-333.160] (-335.129) (-333.714) (-335.340) * (-336.972) (-334.286) [-333.984] (-335.128) -- 0:00:41
289500 -- (-332.496) (-338.445) [-334.618] (-335.721) * (-336.600) (-335.106) [-333.389] (-335.988) -- 0:00:41
290000 -- (-336.136) (-333.294) [-334.743] (-335.118) * [-334.008] (-334.976) (-333.923) (-334.675) -- 0:00:41
Average standard deviation of split frequencies: 0.017930
290500 -- (-333.956) (-336.287) (-334.154) [-335.452] * (-337.311) [-334.312] (-332.348) (-334.544) -- 0:00:41
291000 -- (-334.986) (-335.015) (-336.381) [-332.768] * (-336.208) (-339.933) [-335.168] (-335.813) -- 0:00:41
291500 -- [-335.161] (-335.613) (-335.141) (-334.624) * (-333.483) [-332.298] (-336.663) (-339.437) -- 0:00:41
292000 -- [-333.312] (-334.705) (-336.960) (-333.263) * [-333.412] (-333.338) (-333.758) (-338.333) -- 0:00:41
292500 -- [-333.327] (-333.085) (-337.331) (-333.691) * (-333.377) (-333.267) [-334.184] (-335.716) -- 0:00:43
293000 -- (-336.497) (-333.753) [-334.335] (-335.505) * (-332.728) (-333.323) (-335.841) [-333.219] -- 0:00:43
293500 -- (-334.489) (-332.935) (-337.231) [-335.121] * [-336.206] (-333.508) (-334.747) (-336.262) -- 0:00:43
294000 -- [-335.951] (-332.929) (-332.366) (-332.808) * (-332.158) (-334.481) (-336.010) [-333.887] -- 0:00:43
294500 -- [-335.886] (-336.895) (-334.688) (-334.803) * (-334.614) (-334.848) [-333.328] (-332.941) -- 0:00:43
295000 -- (-335.682) (-335.602) [-333.527] (-333.225) * (-334.916) (-334.100) (-332.491) [-332.814] -- 0:00:43
Average standard deviation of split frequencies: 0.016811
295500 -- (-333.199) (-333.153) (-333.753) [-334.171] * [-334.509] (-332.551) (-333.873) (-338.494) -- 0:00:42
296000 -- (-333.795) (-334.405) (-332.913) [-333.981] * (-332.987) (-334.355) [-333.347] (-335.616) -- 0:00:42
296500 -- (-337.440) (-335.111) [-333.027] (-334.164) * [-332.832] (-334.606) (-332.965) (-332.724) -- 0:00:42
297000 -- (-334.927) (-333.390) (-335.126) [-332.487] * (-335.534) (-337.617) [-334.710] (-334.762) -- 0:00:42
297500 -- (-334.093) [-334.120] (-335.935) (-333.935) * [-332.518] (-333.809) (-333.454) (-333.692) -- 0:00:42
298000 -- (-341.296) [-334.319] (-334.108) (-334.953) * (-334.344) [-334.520] (-332.611) (-332.771) -- 0:00:42
298500 -- (-337.643) [-333.662] (-335.161) (-333.053) * [-333.797] (-337.066) (-333.175) (-333.982) -- 0:00:42
299000 -- (-333.949) (-334.828) [-335.949] (-336.197) * [-337.344] (-337.689) (-334.623) (-337.680) -- 0:00:42
299500 -- (-337.537) (-332.670) (-334.890) [-332.436] * [-339.941] (-333.861) (-335.943) (-334.098) -- 0:00:42
300000 -- (-332.295) (-334.797) [-334.747] (-336.407) * (-334.789) [-333.666] (-335.348) (-334.584) -- 0:00:42
Average standard deviation of split frequencies: 0.016916
300500 -- (-334.129) (-335.952) [-335.365] (-332.488) * (-333.594) (-337.011) (-334.126) [-333.215] -- 0:00:41
301000 -- (-334.251) (-333.201) (-337.518) [-333.070] * [-335.709] (-337.269) (-334.820) (-339.075) -- 0:00:41
301500 -- [-332.871] (-333.350) (-334.070) (-334.833) * (-335.586) (-333.613) [-334.278] (-335.183) -- 0:00:41
302000 -- (-332.307) (-333.316) [-334.478] (-333.305) * (-333.944) [-332.345] (-333.678) (-336.280) -- 0:00:41
302500 -- (-334.528) (-334.385) (-332.751) [-336.165] * (-335.604) (-332.783) [-336.848] (-333.226) -- 0:00:41
303000 -- [-332.496] (-333.090) (-333.872) (-332.877) * (-333.090) (-334.064) [-335.734] (-334.057) -- 0:00:41
303500 -- (-337.672) [-333.674] (-335.703) (-335.952) * [-336.945] (-335.369) (-336.040) (-334.056) -- 0:00:41
304000 -- [-332.566] (-333.338) (-334.272) (-334.872) * (-338.805) (-334.296) [-333.617] (-334.985) -- 0:00:41
304500 -- (-332.427) [-333.692] (-333.622) (-334.982) * [-335.020] (-336.042) (-335.172) (-332.653) -- 0:00:41
305000 -- (-334.825) [-335.118] (-332.587) (-335.768) * (-334.399) (-337.991) [-333.049] (-333.877) -- 0:00:41
Average standard deviation of split frequencies: 0.016297
305500 -- (-333.084) [-332.823] (-333.129) (-338.356) * (-334.130) (-335.821) (-337.964) [-333.588] -- 0:00:40
306000 -- (-333.131) (-333.353) (-333.128) [-334.800] * (-333.366) (-338.605) (-333.824) [-333.172] -- 0:00:40
306500 -- (-335.426) (-333.629) (-333.050) [-336.052] * [-333.770] (-335.990) (-333.823) (-334.459) -- 0:00:40
307000 -- (-332.831) [-334.229] (-334.288) (-333.493) * [-334.000] (-334.658) (-334.834) (-334.979) -- 0:00:40
307500 -- (-333.264) [-334.475] (-335.187) (-333.657) * (-335.079) (-337.054) (-335.652) [-333.460] -- 0:00:40
308000 -- [-334.936] (-336.970) (-335.512) (-337.804) * [-335.735] (-334.943) (-333.295) (-333.956) -- 0:00:40
308500 -- (-337.486) [-333.598] (-337.136) (-338.585) * (-335.969) (-335.688) [-333.307] (-335.355) -- 0:00:40
309000 -- (-335.438) (-335.196) (-333.016) [-333.656] * (-333.006) (-339.690) [-332.682] (-333.602) -- 0:00:40
309500 -- [-337.377] (-334.001) (-335.933) (-333.901) * (-334.172) [-334.896] (-334.375) (-334.336) -- 0:00:42
310000 -- [-333.212] (-334.515) (-336.344) (-333.639) * (-332.924) (-333.422) [-332.600] (-339.037) -- 0:00:42
Average standard deviation of split frequencies: 0.017197
310500 -- (-332.674) (-333.057) (-338.217) [-335.235] * [-335.445] (-332.510) (-334.896) (-333.954) -- 0:00:42
311000 -- [-335.373] (-333.692) (-334.332) (-334.954) * [-332.701] (-333.084) (-333.752) (-332.800) -- 0:00:42
311500 -- [-338.065] (-335.925) (-332.855) (-333.821) * (-334.368) (-333.232) (-334.795) [-333.115] -- 0:00:41
312000 -- [-333.421] (-333.966) (-334.538) (-335.163) * (-333.883) [-332.669] (-333.332) (-333.500) -- 0:00:41
312500 -- (-336.009) (-333.431) [-335.132] (-335.740) * [-335.883] (-332.739) (-332.787) (-335.876) -- 0:00:41
313000 -- (-336.487) (-336.425) [-336.041] (-335.306) * (-332.670) [-334.284] (-337.741) (-337.181) -- 0:00:41
313500 -- (-332.951) (-334.605) (-332.299) [-335.609] * (-333.397) (-333.705) (-334.072) [-338.859] -- 0:00:41
314000 -- (-334.412) [-336.879] (-333.488) (-333.079) * (-335.684) (-333.680) (-333.330) [-339.354] -- 0:00:41
314500 -- (-335.758) (-337.441) (-332.574) [-333.005] * (-332.832) (-332.711) (-333.033) [-333.596] -- 0:00:41
315000 -- (-333.988) [-334.173] (-336.478) (-334.778) * (-337.080) (-333.997) (-335.778) [-332.433] -- 0:00:41
Average standard deviation of split frequencies: 0.016658
315500 -- (-334.633) (-338.594) [-332.819] (-337.017) * (-338.836) (-336.195) (-332.659) [-333.525] -- 0:00:41
316000 -- (-334.448) [-332.800] (-334.963) (-332.471) * [-337.418] (-337.130) (-334.035) (-333.314) -- 0:00:41
316500 -- (-334.603) [-332.899] (-336.109) (-332.566) * (-334.893) (-333.525) (-334.777) [-332.731] -- 0:00:41
317000 -- (-333.391) (-335.362) [-334.207] (-333.763) * (-339.480) (-334.894) [-333.976] (-334.045) -- 0:00:40
317500 -- (-334.067) [-335.506] (-334.099) (-334.264) * (-338.387) [-336.027] (-334.654) (-332.050) -- 0:00:40
318000 -- (-334.993) [-340.037] (-332.938) (-336.501) * [-335.380] (-335.303) (-335.411) (-332.965) -- 0:00:40
318500 -- (-336.543) (-335.666) [-337.125] (-333.832) * [-333.228] (-332.639) (-339.284) (-336.700) -- 0:00:40
319000 -- [-337.261] (-333.706) (-335.418) (-333.669) * [-334.053] (-333.315) (-333.767) (-333.217) -- 0:00:40
319500 -- (-337.342) [-335.852] (-336.706) (-333.718) * [-333.626] (-332.563) (-334.122) (-334.006) -- 0:00:40
320000 -- (-336.652) (-335.884) [-335.169] (-332.517) * [-337.304] (-335.408) (-336.710) (-333.849) -- 0:00:40
Average standard deviation of split frequencies: 0.017069
320500 -- (-336.519) (-334.657) [-339.026] (-333.034) * (-338.202) (-333.387) [-335.695] (-333.730) -- 0:00:40
321000 -- (-334.497) (-334.476) (-333.203) [-335.488] * (-337.312) [-333.913] (-334.974) (-332.956) -- 0:00:40
321500 -- (-333.513) (-334.076) (-332.742) [-333.225] * (-334.924) (-334.725) (-334.024) [-333.386] -- 0:00:40
322000 -- (-333.756) (-334.152) [-333.878] (-334.725) * (-336.778) (-337.031) [-338.668] (-334.182) -- 0:00:40
322500 -- (-336.118) (-337.267) [-336.798] (-340.017) * (-333.976) [-333.644] (-337.799) (-337.641) -- 0:00:39
323000 -- (-333.985) (-335.616) [-334.894] (-336.163) * (-333.284) (-332.601) (-334.964) [-334.517] -- 0:00:39
323500 -- (-334.665) (-334.233) [-335.589] (-338.935) * [-335.498] (-333.506) (-335.068) (-333.403) -- 0:00:39
324000 -- [-333.929] (-335.728) (-336.766) (-333.784) * (-338.015) [-332.515] (-333.399) (-334.556) -- 0:00:39
324500 -- [-334.264] (-337.025) (-338.821) (-332.951) * [-333.124] (-335.130) (-336.152) (-334.503) -- 0:00:39
325000 -- (-333.899) (-335.545) (-333.213) [-334.741] * (-335.849) (-338.350) (-334.517) [-336.512] -- 0:00:39
Average standard deviation of split frequencies: 0.017885
325500 -- [-335.013] (-334.107) (-333.064) (-335.872) * (-332.725) [-333.960] (-335.238) (-333.782) -- 0:00:39
326000 -- (-334.359) (-333.090) (-333.113) [-333.352] * (-334.158) [-335.529] (-334.960) (-338.203) -- 0:00:39
326500 -- (-336.484) (-333.648) (-336.183) [-333.076] * (-338.303) [-334.318] (-336.434) (-333.495) -- 0:00:41
327000 -- [-340.672] (-335.098) (-335.587) (-333.749) * (-334.764) (-336.648) [-334.830] (-333.934) -- 0:00:41
327500 -- [-332.886] (-335.779) (-335.286) (-335.571) * (-333.429) [-334.286] (-333.577) (-334.489) -- 0:00:41
328000 -- (-334.560) (-332.938) (-334.749) [-334.397] * (-335.182) (-333.159) (-332.713) [-334.243] -- 0:00:40
328500 -- (-333.035) (-334.998) (-338.484) [-334.362] * (-335.424) (-336.971) (-335.162) [-333.437] -- 0:00:40
329000 -- (-333.667) [-337.550] (-339.657) (-333.802) * (-344.595) (-334.338) (-335.341) [-333.572] -- 0:00:40
329500 -- (-332.570) [-336.206] (-333.507) (-332.837) * (-333.405) (-333.265) (-336.144) [-336.260] -- 0:00:40
330000 -- (-337.184) [-334.762] (-332.545) (-333.911) * [-333.075] (-336.873) (-334.418) (-333.853) -- 0:00:40
Average standard deviation of split frequencies: 0.018308
330500 -- (-333.042) (-332.378) (-335.947) [-334.153] * [-334.188] (-335.474) (-336.402) (-334.060) -- 0:00:40
331000 -- (-334.766) [-333.392] (-335.504) (-332.940) * (-333.342) [-333.750] (-332.703) (-335.986) -- 0:00:40
331500 -- (-335.174) (-333.594) (-335.072) [-333.739] * (-333.584) [-336.806] (-334.018) (-336.620) -- 0:00:40
332000 -- (-333.160) (-335.870) (-333.180) [-332.922] * [-335.871] (-335.194) (-333.881) (-336.196) -- 0:00:40
332500 -- (-334.360) (-337.355) [-332.897] (-336.938) * [-333.273] (-335.515) (-333.696) (-332.832) -- 0:00:40
333000 -- (-336.796) (-332.992) [-336.068] (-332.612) * (-337.818) (-332.840) [-334.902] (-337.736) -- 0:00:40
333500 -- (-333.999) (-334.426) [-332.820] (-343.050) * (-342.014) (-333.363) [-334.024] (-332.360) -- 0:00:39
334000 -- (-332.373) (-333.912) [-334.626] (-334.809) * (-337.246) [-333.696] (-332.572) (-340.150) -- 0:00:39
334500 -- (-335.056) (-333.796) [-333.552] (-334.875) * [-336.722] (-334.480) (-332.851) (-334.973) -- 0:00:39
335000 -- (-333.937) (-333.277) (-335.037) [-335.262] * (-338.965) (-335.759) [-333.594] (-334.415) -- 0:00:39
Average standard deviation of split frequencies: 0.018239
335500 -- (-334.058) [-334.704] (-332.982) (-344.224) * (-335.600) (-338.033) [-334.736] (-335.293) -- 0:00:39
336000 -- [-333.885] (-333.671) (-332.825) (-338.754) * [-338.393] (-336.480) (-337.159) (-338.162) -- 0:00:39
336500 -- (-334.765) (-332.947) [-333.282] (-334.457) * (-335.428) (-333.451) [-333.953] (-334.365) -- 0:00:39
337000 -- (-336.477) (-333.704) (-335.817) [-334.653] * (-335.717) [-337.416] (-335.876) (-336.976) -- 0:00:39
337500 -- [-335.122] (-334.155) (-337.137) (-333.154) * (-334.368) [-336.704] (-336.023) (-334.731) -- 0:00:39
338000 -- (-333.576) [-333.342] (-335.841) (-333.620) * (-337.267) (-334.974) [-333.870] (-333.820) -- 0:00:39
338500 -- [-332.323] (-336.125) (-336.044) (-334.608) * (-339.928) (-337.618) [-334.120] (-335.550) -- 0:00:39
339000 -- (-332.562) (-334.532) (-334.433) [-334.831] * (-333.627) (-338.436) [-338.229] (-336.317) -- 0:00:38
339500 -- [-336.022] (-335.791) (-336.273) (-332.615) * (-337.552) (-339.654) (-333.579) [-334.106] -- 0:00:38
340000 -- (-333.943) (-332.482) [-334.083] (-337.228) * [-333.381] (-338.034) (-337.846) (-332.605) -- 0:00:38
Average standard deviation of split frequencies: 0.017916
340500 -- (-339.623) (-332.819) [-335.716] (-336.537) * (-333.725) (-333.910) (-339.704) [-333.061] -- 0:00:38
341000 -- (-335.446) [-333.858] (-334.759) (-333.239) * (-333.936) (-333.425) [-337.564] (-334.660) -- 0:00:38
341500 -- (-336.178) [-335.661] (-332.643) (-335.524) * (-334.953) (-332.656) [-333.788] (-332.552) -- 0:00:38
342000 -- (-335.125) (-334.401) (-332.637) [-336.038] * (-333.558) (-333.676) [-334.286] (-334.667) -- 0:00:38
342500 -- [-334.995] (-333.606) (-334.647) (-335.625) * (-332.663) (-338.588) [-332.796] (-333.456) -- 0:00:38
343000 -- (-334.727) (-332.569) [-335.882] (-336.120) * (-335.158) (-335.573) (-332.662) [-333.869] -- 0:00:38
343500 -- (-333.515) [-333.683] (-341.027) (-332.586) * [-332.913] (-336.465) (-333.694) (-334.892) -- 0:00:40
344000 -- (-333.864) (-335.736) [-336.529] (-335.436) * (-336.130) (-334.417) (-335.270) [-334.086] -- 0:00:40
344500 -- (-334.992) [-333.856] (-333.345) (-335.155) * [-333.953] (-332.527) (-333.347) (-336.072) -- 0:00:39
345000 -- (-336.133) (-336.050) [-337.037] (-334.271) * (-333.841) (-334.565) [-335.249] (-332.649) -- 0:00:39
Average standard deviation of split frequencies: 0.018070
345500 -- (-335.522) (-336.847) (-337.664) [-335.132] * (-336.103) (-334.719) [-332.943] (-333.507) -- 0:00:39
346000 -- (-336.125) [-332.630] (-336.626) (-335.447) * [-334.830] (-333.574) (-333.456) (-334.441) -- 0:00:39
346500 -- [-333.028] (-335.234) (-336.036) (-339.126) * (-336.163) [-336.017] (-335.157) (-337.385) -- 0:00:39
347000 -- (-332.537) [-334.147] (-336.078) (-345.365) * (-332.847) (-333.822) (-333.100) [-333.959] -- 0:00:39
347500 -- (-334.362) [-334.629] (-335.241) (-335.994) * [-334.429] (-332.746) (-332.588) (-334.531) -- 0:00:39
348000 -- (-335.769) [-333.651] (-333.647) (-337.125) * (-335.719) (-333.375) [-334.205] (-333.298) -- 0:00:39
348500 -- (-335.667) (-333.857) (-333.929) [-334.854] * [-333.493] (-334.163) (-334.398) (-332.344) -- 0:00:39
349000 -- (-339.312) (-335.231) (-334.632) [-333.982] * (-332.791) (-332.956) (-334.022) [-333.251] -- 0:00:39
349500 -- (-339.864) (-338.408) (-333.121) [-333.753] * (-334.805) (-332.512) [-332.209] (-335.188) -- 0:00:39
350000 -- [-339.286] (-336.916) (-334.937) (-333.154) * (-334.957) [-334.774] (-336.230) (-337.576) -- 0:00:39
Average standard deviation of split frequencies: 0.018113
350500 -- (-337.324) (-337.822) (-333.856) [-333.736] * [-332.202] (-333.059) (-333.971) (-333.134) -- 0:00:38
351000 -- [-335.948] (-341.926) (-334.966) (-336.695) * (-333.846) (-334.357) (-334.404) [-333.356] -- 0:00:38
351500 -- (-336.007) [-336.283] (-336.229) (-334.983) * (-334.245) (-335.757) (-334.866) [-332.262] -- 0:00:38
352000 -- (-333.102) (-333.962) [-333.035] (-332.899) * (-334.014) (-333.958) [-333.597] (-338.766) -- 0:00:38
352500 -- (-337.525) (-334.211) (-342.604) [-334.973] * (-334.735) (-334.506) [-333.518] (-333.751) -- 0:00:38
353000 -- (-335.765) (-333.202) (-335.106) [-335.098] * [-337.597] (-334.581) (-335.060) (-335.627) -- 0:00:38
353500 -- [-336.552] (-337.284) (-342.101) (-337.600) * (-338.341) (-334.624) (-333.842) [-335.568] -- 0:00:38
354000 -- [-332.988] (-336.913) (-337.382) (-334.793) * (-339.533) (-337.818) [-333.468] (-332.822) -- 0:00:38
354500 -- (-332.769) (-335.814) (-335.834) [-335.428] * (-335.584) [-336.438] (-333.525) (-332.807) -- 0:00:38
355000 -- (-333.461) (-334.020) (-334.878) [-334.683] * [-333.576] (-333.443) (-334.468) (-333.616) -- 0:00:38
Average standard deviation of split frequencies: 0.018097
355500 -- (-334.490) [-333.519] (-334.902) (-335.422) * (-334.624) [-332.617] (-333.077) (-337.684) -- 0:00:38
356000 -- (-338.827) [-333.732] (-335.443) (-335.760) * (-332.836) (-335.861) [-333.386] (-333.439) -- 0:00:37
356500 -- (-335.554) (-332.663) (-332.846) [-332.916] * (-332.707) (-333.001) (-337.381) [-332.454] -- 0:00:37
357000 -- (-333.427) [-333.032] (-335.425) (-334.729) * (-334.613) (-334.491) (-333.658) [-335.099] -- 0:00:37
357500 -- (-335.130) [-334.537] (-337.096) (-336.012) * (-334.461) [-335.143] (-334.117) (-335.436) -- 0:00:37
358000 -- (-333.778) (-336.688) (-333.204) [-332.887] * [-335.771] (-336.833) (-335.596) (-334.742) -- 0:00:37
358500 -- [-332.985] (-334.620) (-332.927) (-334.810) * [-337.642] (-334.714) (-337.060) (-335.226) -- 0:00:37
359000 -- (-335.483) (-332.503) (-336.511) [-334.428] * (-332.898) (-333.768) [-332.190] (-332.817) -- 0:00:37
359500 -- (-336.556) [-335.792] (-333.384) (-333.579) * (-338.008) [-334.444] (-334.179) (-338.808) -- 0:00:37
360000 -- (-334.727) (-334.527) (-332.742) [-334.402] * (-335.613) (-335.384) (-333.037) [-333.117] -- 0:00:37
Average standard deviation of split frequencies: 0.018371
360500 -- (-334.449) (-336.350) (-332.425) [-332.833] * (-333.230) (-334.363) [-334.919] (-333.361) -- 0:00:39
361000 -- (-333.301) (-336.691) [-336.061] (-335.342) * (-336.099) (-337.047) (-334.624) [-332.459] -- 0:00:38
361500 -- (-334.071) (-336.385) (-336.689) [-332.930] * (-334.333) (-336.347) [-336.929] (-333.074) -- 0:00:38
362000 -- (-335.210) (-334.828) [-334.764] (-332.335) * (-332.933) (-333.404) (-337.160) [-334.733] -- 0:00:38
362500 -- [-335.328] (-334.639) (-333.744) (-335.384) * (-334.447) (-333.988) [-333.183] (-336.241) -- 0:00:38
363000 -- (-334.126) [-337.608] (-333.981) (-333.142) * (-333.553) (-332.334) [-334.913] (-333.137) -- 0:00:38
363500 -- [-333.924] (-335.100) (-333.115) (-335.950) * (-334.737) (-332.457) [-339.113] (-332.315) -- 0:00:38
364000 -- [-338.665] (-333.199) (-333.781) (-335.163) * (-335.126) (-334.366) (-333.274) [-332.862] -- 0:00:38
364500 -- [-333.704] (-335.582) (-332.790) (-332.793) * (-335.822) (-334.572) (-333.315) [-335.466] -- 0:00:38
365000 -- (-338.175) [-337.253] (-335.253) (-333.725) * [-333.878] (-336.407) (-333.183) (-335.081) -- 0:00:38
Average standard deviation of split frequencies: 0.017625
365500 -- [-334.549] (-335.442) (-334.456) (-332.378) * [-333.950] (-332.319) (-334.855) (-333.070) -- 0:00:38
366000 -- (-337.262) [-336.130] (-335.258) (-333.591) * (-332.441) (-332.785) [-336.733] (-335.537) -- 0:00:38
366500 -- (-335.809) [-333.849] (-333.860) (-334.817) * (-336.921) (-333.886) [-334.011] (-334.688) -- 0:00:38
367000 -- (-336.895) [-332.476] (-337.507) (-334.774) * (-334.439) (-334.138) (-332.645) [-339.025] -- 0:00:37
367500 -- (-333.934) (-332.690) [-333.271] (-333.790) * [-335.773] (-337.596) (-335.500) (-332.860) -- 0:00:37
368000 -- (-337.339) (-334.524) (-334.347) [-336.501] * (-334.901) (-337.656) [-334.044] (-333.887) -- 0:00:37
368500 -- (-335.096) (-335.136) (-334.242) [-333.339] * [-334.532] (-335.940) (-334.563) (-337.858) -- 0:00:37
369000 -- (-334.775) (-333.486) (-335.429) [-334.838] * (-336.797) (-333.675) (-334.141) [-333.153] -- 0:00:37
369500 -- (-333.341) (-333.917) (-332.852) [-333.381] * (-333.726) (-333.349) [-334.458] (-332.340) -- 0:00:37
370000 -- (-335.962) (-333.257) (-332.576) [-333.661] * (-332.695) [-334.118] (-333.044) (-333.341) -- 0:00:37
Average standard deviation of split frequencies: 0.017470
370500 -- (-332.560) (-333.881) (-332.659) [-332.909] * [-335.170] (-333.394) (-332.899) (-333.106) -- 0:00:37
371000 -- (-333.519) (-333.835) (-333.421) [-333.855] * (-335.233) (-336.331) (-336.327) [-334.805] -- 0:00:37
371500 -- [-333.662] (-334.905) (-337.898) (-335.485) * (-334.713) [-333.951] (-334.897) (-335.042) -- 0:00:37
372000 -- (-332.447) (-332.005) (-336.240) [-334.546] * (-332.211) [-332.521] (-333.855) (-333.392) -- 0:00:37
372500 -- (-332.750) [-334.225] (-336.954) (-334.518) * (-333.025) (-334.306) (-333.518) [-333.935] -- 0:00:37
373000 -- (-332.664) (-333.410) (-336.600) [-334.859] * [-335.460] (-338.229) (-333.583) (-335.119) -- 0:00:36
373500 -- [-334.491] (-334.583) (-335.274) (-334.507) * [-336.743] (-333.659) (-334.013) (-334.463) -- 0:00:36
374000 -- (-333.380) [-334.372] (-332.201) (-333.450) * (-333.593) (-333.514) (-333.870) [-336.091] -- 0:00:36
374500 -- (-333.352) (-332.724) (-333.177) [-332.421] * (-334.861) [-332.924] (-334.851) (-333.744) -- 0:00:36
375000 -- (-333.548) (-334.864) [-334.390] (-332.580) * (-333.611) [-335.382] (-333.650) (-333.296) -- 0:00:36
Average standard deviation of split frequencies: 0.017816
375500 -- (-334.867) (-335.489) (-333.038) [-332.292] * (-336.116) (-332.710) [-334.041] (-332.534) -- 0:00:36
376000 -- (-338.269) (-336.074) [-333.193] (-333.000) * [-337.378] (-336.274) (-335.844) (-332.631) -- 0:00:36
376500 -- (-335.702) (-335.310) (-337.367) [-333.929] * [-338.191] (-337.842) (-334.776) (-332.905) -- 0:00:36
377000 -- (-332.143) (-334.107) (-333.530) [-333.426] * (-333.789) [-335.210] (-336.410) (-337.505) -- 0:00:38
377500 -- [-333.003] (-334.086) (-332.673) (-333.321) * (-334.346) (-334.418) [-336.516] (-334.056) -- 0:00:37
378000 -- (-339.375) (-334.899) [-335.119] (-336.454) * [-332.175] (-333.951) (-337.487) (-335.726) -- 0:00:37
378500 -- (-333.714) (-334.980) [-334.116] (-332.854) * [-333.829] (-334.885) (-333.137) (-332.608) -- 0:00:37
379000 -- (-334.741) (-334.139) [-335.099] (-333.987) * [-333.082] (-336.454) (-335.815) (-333.914) -- 0:00:37
379500 -- (-334.037) [-333.506] (-335.632) (-334.954) * (-338.161) (-334.145) [-336.761] (-338.241) -- 0:00:37
380000 -- (-336.054) [-333.006] (-332.516) (-334.659) * (-333.127) (-332.835) (-337.270) [-335.170] -- 0:00:37
Average standard deviation of split frequencies: 0.017859
380500 -- [-333.760] (-332.644) (-339.013) (-333.468) * (-335.919) [-334.107] (-341.919) (-336.999) -- 0:00:37
381000 -- (-335.869) [-334.285] (-338.162) (-334.421) * (-335.651) [-337.069] (-333.088) (-335.376) -- 0:00:37
381500 -- (-334.929) (-334.738) [-334.706] (-334.330) * (-334.598) (-339.863) [-335.565] (-336.834) -- 0:00:37
382000 -- (-335.411) (-336.903) [-334.565] (-333.896) * (-335.727) (-340.982) [-335.682] (-334.729) -- 0:00:37
382500 -- [-333.691] (-332.953) (-333.611) (-337.261) * [-332.982] (-336.822) (-334.685) (-334.625) -- 0:00:37
383000 -- (-335.455) [-334.724] (-334.947) (-337.586) * [-332.902] (-334.846) (-333.526) (-335.589) -- 0:00:37
383500 -- (-335.259) [-333.762] (-337.387) (-335.095) * (-334.799) (-335.505) [-332.397] (-338.407) -- 0:00:36
384000 -- (-334.587) (-335.706) [-333.393] (-333.372) * (-335.051) (-338.364) [-333.556] (-333.146) -- 0:00:36
384500 -- (-337.328) [-335.846] (-333.853) (-334.181) * [-334.372] (-336.566) (-335.096) (-334.378) -- 0:00:36
385000 -- (-335.482) (-335.134) (-335.628) [-333.842] * (-337.112) (-335.550) [-332.868] (-333.796) -- 0:00:36
Average standard deviation of split frequencies: 0.017740
385500 -- (-335.191) (-337.206) [-333.869] (-335.091) * (-336.438) (-332.536) (-333.068) [-334.765] -- 0:00:36
386000 -- [-336.807] (-334.950) (-334.096) (-333.304) * [-336.044] (-334.216) (-334.048) (-334.989) -- 0:00:36
386500 -- (-333.537) [-335.966] (-336.797) (-335.902) * (-336.293) [-332.696] (-338.916) (-332.810) -- 0:00:36
387000 -- [-333.052] (-334.124) (-335.647) (-334.152) * [-333.796] (-333.756) (-336.398) (-333.725) -- 0:00:36
387500 -- [-333.697] (-336.183) (-336.056) (-336.437) * (-333.751) [-333.274] (-337.533) (-334.687) -- 0:00:36
388000 -- (-334.065) (-336.090) (-336.051) [-335.264] * [-335.594] (-334.038) (-334.049) (-336.306) -- 0:00:36
388500 -- (-333.942) [-334.676] (-334.645) (-333.962) * (-334.499) (-337.947) (-332.811) [-335.804] -- 0:00:36
389000 -- [-333.768] (-336.342) (-335.301) (-333.564) * [-332.750] (-336.874) (-333.448) (-337.039) -- 0:00:36
389500 -- (-336.359) [-333.562] (-333.477) (-334.718) * (-339.386) (-335.152) (-332.751) [-334.224] -- 0:00:36
390000 -- (-335.310) [-333.103] (-334.690) (-333.730) * [-334.166] (-335.327) (-334.221) (-333.394) -- 0:00:35
Average standard deviation of split frequencies: 0.018100
390500 -- (-337.793) [-335.352] (-336.158) (-334.097) * (-332.815) (-333.759) (-335.522) [-334.219] -- 0:00:35
391000 -- [-333.177] (-336.741) (-336.770) (-335.651) * (-338.483) (-333.205) [-333.680] (-341.998) -- 0:00:35
391500 -- [-333.971] (-338.078) (-333.918) (-334.283) * (-334.568) (-333.811) [-333.798] (-335.339) -- 0:00:35
392000 -- (-337.324) (-334.161) [-333.057] (-333.178) * (-334.060) (-332.931) (-334.173) [-339.549] -- 0:00:35
392500 -- (-334.915) [-333.571] (-333.512) (-333.452) * (-334.943) (-335.597) (-337.579) [-337.380] -- 0:00:35
393000 -- (-334.925) (-333.873) (-338.862) [-333.688] * (-336.427) [-334.515] (-336.062) (-333.467) -- 0:00:35
393500 -- (-334.882) (-333.695) [-334.278] (-335.176) * (-335.511) (-339.649) [-332.775] (-332.448) -- 0:00:35
394000 -- (-334.737) [-333.579] (-334.663) (-336.534) * (-333.284) (-333.560) [-333.592] (-333.228) -- 0:00:36
394500 -- (-333.308) (-333.805) (-332.737) [-332.793] * [-334.112] (-334.706) (-334.184) (-339.245) -- 0:00:36
395000 -- [-333.319] (-333.496) (-333.623) (-334.164) * (-336.980) [-334.621] (-336.451) (-334.364) -- 0:00:36
Average standard deviation of split frequencies: 0.017480
395500 -- (-332.409) (-334.616) [-333.225] (-342.789) * (-334.282) (-333.247) (-333.398) [-334.950] -- 0:00:36
396000 -- [-337.182] (-333.804) (-335.924) (-335.569) * [-336.689] (-338.194) (-334.350) (-335.542) -- 0:00:36
396500 -- (-341.473) [-333.398] (-335.044) (-334.737) * (-333.267) [-333.131] (-338.505) (-334.019) -- 0:00:36
397000 -- [-339.210] (-336.284) (-333.923) (-336.436) * (-339.247) [-333.621] (-332.328) (-337.316) -- 0:00:36
397500 -- (-343.633) (-337.033) [-333.550] (-336.051) * (-332.896) (-333.858) [-332.805] (-335.112) -- 0:00:36
398000 -- (-344.458) [-333.655] (-333.926) (-338.090) * (-335.105) (-333.126) [-333.730] (-334.201) -- 0:00:36
398500 -- (-334.347) (-334.252) [-335.087] (-333.032) * [-333.284] (-334.122) (-332.941) (-333.772) -- 0:00:36
399000 -- (-338.277) (-332.807) [-333.583] (-333.310) * (-332.368) (-333.853) (-333.116) [-335.635] -- 0:00:36
399500 -- (-332.769) (-335.548) (-337.997) [-334.741] * (-332.766) [-333.877] (-333.660) (-333.632) -- 0:00:36
400000 -- (-335.116) (-335.186) (-333.539) [-333.993] * (-333.693) [-332.969] (-335.355) (-334.343) -- 0:00:36
Average standard deviation of split frequencies: 0.018206
400500 -- (-334.206) [-337.126] (-336.859) (-333.494) * (-335.277) (-337.596) (-334.014) [-333.659] -- 0:00:35
401000 -- (-335.502) (-334.283) (-333.249) [-332.516] * (-332.737) (-334.321) [-333.330] (-334.613) -- 0:00:35
401500 -- [-333.804] (-333.938) (-333.111) (-332.918) * (-334.679) [-334.671] (-332.511) (-334.703) -- 0:00:35
402000 -- (-335.709) (-334.534) [-333.035] (-335.844) * (-335.124) (-333.906) (-333.198) [-332.965] -- 0:00:35
402500 -- (-335.200) [-334.084] (-333.333) (-335.438) * (-334.911) (-332.390) [-332.229] (-336.580) -- 0:00:35
403000 -- (-334.839) (-337.349) [-334.233] (-334.523) * [-334.295] (-337.535) (-333.857) (-333.580) -- 0:00:35
403500 -- (-335.238) (-335.284) (-333.863) [-336.489] * [-333.289] (-332.378) (-332.769) (-336.198) -- 0:00:35
404000 -- (-332.786) (-336.048) [-333.396] (-337.075) * (-333.023) (-334.195) [-333.013] (-333.435) -- 0:00:35
404500 -- (-333.821) (-335.411) (-337.590) [-332.741] * (-333.420) [-333.608] (-334.566) (-336.921) -- 0:00:35
405000 -- (-335.083) [-334.751] (-335.154) (-332.759) * (-336.490) (-333.403) (-333.300) [-337.338] -- 0:00:35
Average standard deviation of split frequencies: 0.017539
405500 -- [-334.093] (-336.949) (-338.802) (-336.362) * [-332.115] (-333.495) (-335.680) (-335.242) -- 0:00:35
406000 -- (-335.185) (-333.672) (-337.558) [-333.621] * (-333.748) (-333.968) (-336.533) [-338.001] -- 0:00:35
406500 -- (-337.454) (-334.477) [-334.270] (-336.143) * [-333.190] (-336.824) (-338.969) (-333.822) -- 0:00:35
407000 -- (-337.008) [-334.921] (-333.174) (-338.982) * [-333.765] (-334.344) (-342.632) (-335.727) -- 0:00:34
407500 -- (-334.981) (-333.454) (-334.145) [-335.312] * [-333.295] (-333.294) (-333.990) (-332.837) -- 0:00:34
408000 -- (-335.406) [-334.595] (-336.900) (-334.482) * (-334.188) (-332.979) (-335.320) [-333.670] -- 0:00:34
408500 -- (-336.711) (-335.411) (-336.045) [-334.400] * (-333.684) [-334.773] (-333.423) (-337.372) -- 0:00:34
409000 -- [-335.290] (-337.557) (-339.488) (-333.740) * (-333.682) (-332.549) [-333.192] (-333.142) -- 0:00:34
409500 -- (-334.483) (-335.151) (-335.315) [-335.893] * (-335.674) (-334.064) [-333.826] (-333.454) -- 0:00:34
410000 -- (-333.742) (-336.048) (-333.493) [-333.852] * (-334.028) (-334.236) [-334.631] (-334.686) -- 0:00:34
Average standard deviation of split frequencies: 0.017410
410500 -- (-336.884) [-332.235] (-334.203) (-334.210) * (-333.080) [-335.536] (-332.991) (-334.464) -- 0:00:34
411000 -- (-333.515) (-334.116) (-333.477) [-334.379] * (-336.166) (-334.533) [-336.555] (-336.401) -- 0:00:35
411500 -- (-332.571) (-336.219) [-335.218] (-332.996) * (-333.314) (-333.594) [-334.816] (-338.321) -- 0:00:35
412000 -- (-333.068) [-335.330] (-336.376) (-336.509) * [-336.029] (-338.598) (-336.010) (-333.903) -- 0:00:35
412500 -- (-333.090) (-334.306) (-334.410) [-333.529] * (-334.639) (-334.142) [-332.666] (-333.098) -- 0:00:35
413000 -- (-333.556) (-333.235) [-332.990] (-334.668) * (-334.750) (-332.973) [-333.891] (-333.233) -- 0:00:35
413500 -- (-337.079) (-335.456) (-332.263) [-334.681] * (-337.041) (-333.405) (-332.125) [-335.471] -- 0:00:35
414000 -- (-336.289) [-332.781] (-339.531) (-333.113) * (-332.401) (-335.026) [-333.409] (-335.752) -- 0:00:35
414500 -- (-334.608) (-332.491) [-334.385] (-334.349) * (-334.815) [-333.427] (-334.946) (-338.488) -- 0:00:35
415000 -- (-333.598) [-332.832] (-335.068) (-334.780) * [-335.748] (-337.093) (-334.270) (-337.780) -- 0:00:35
Average standard deviation of split frequencies: 0.016103
415500 -- (-335.395) [-333.713] (-335.518) (-337.454) * (-332.434) (-333.970) [-332.431] (-334.615) -- 0:00:35
416000 -- (-334.303) (-332.493) [-334.973] (-334.929) * [-333.173] (-337.060) (-335.650) (-334.634) -- 0:00:35
416500 -- (-334.422) (-335.353) [-332.915] (-334.871) * [-335.857] (-334.656) (-333.416) (-333.685) -- 0:00:35
417000 -- (-340.396) (-333.438) [-339.367] (-334.439) * [-339.496] (-334.246) (-334.652) (-336.627) -- 0:00:34
417500 -- (-342.940) [-334.138] (-334.815) (-334.734) * (-332.769) (-335.589) [-332.307] (-337.371) -- 0:00:34
418000 -- (-337.977) (-336.275) [-333.798] (-333.731) * [-333.809] (-338.951) (-335.374) (-333.109) -- 0:00:34
418500 -- (-334.935) [-333.982] (-334.395) (-333.143) * [-335.024] (-335.476) (-336.446) (-334.700) -- 0:00:34
419000 -- (-334.508) (-335.560) (-332.351) [-332.919] * (-337.951) [-333.257] (-335.502) (-337.962) -- 0:00:34
419500 -- (-334.256) [-332.511] (-332.328) (-333.233) * [-335.100] (-338.079) (-333.552) (-334.481) -- 0:00:34
420000 -- (-334.085) (-336.165) [-333.318] (-332.924) * [-335.078] (-337.171) (-337.142) (-335.141) -- 0:00:34
Average standard deviation of split frequencies: 0.016249
420500 -- [-334.539] (-334.870) (-335.127) (-333.360) * (-333.253) (-336.996) (-332.792) [-333.632] -- 0:00:34
421000 -- [-336.482] (-337.181) (-335.914) (-334.055) * [-334.024] (-335.685) (-336.060) (-334.740) -- 0:00:34
421500 -- (-340.140) (-332.441) (-333.452) [-334.730] * (-333.972) (-333.413) (-332.975) [-336.800] -- 0:00:34
422000 -- (-333.946) (-333.287) [-336.103] (-336.208) * (-334.444) [-334.698] (-335.720) (-334.777) -- 0:00:34
422500 -- (-335.530) [-332.289] (-336.634) (-334.969) * [-334.135] (-334.947) (-334.972) (-333.694) -- 0:00:34
423000 -- [-333.499] (-333.583) (-335.920) (-332.405) * (-335.801) (-336.380) [-333.102] (-332.843) -- 0:00:34
423500 -- (-336.163) (-335.784) [-332.717] (-336.445) * [-335.128] (-340.798) (-333.520) (-334.919) -- 0:00:34
424000 -- (-333.396) (-333.032) [-334.368] (-334.292) * (-337.632) [-336.586] (-334.574) (-333.372) -- 0:00:33
424500 -- (-332.991) [-334.694] (-336.209) (-339.019) * (-334.883) (-339.151) [-332.337] (-340.441) -- 0:00:33
425000 -- (-333.688) (-333.209) (-333.307) [-335.678] * (-335.012) (-337.009) (-332.629) [-336.564] -- 0:00:33
Average standard deviation of split frequencies: 0.015492
425500 -- [-337.109] (-335.229) (-338.068) (-335.689) * (-334.988) [-333.597] (-332.766) (-332.661) -- 0:00:33
426000 -- [-335.706] (-334.491) (-339.290) (-334.360) * (-333.224) [-334.223] (-333.844) (-337.238) -- 0:00:33
426500 -- (-337.388) [-334.767] (-336.050) (-337.068) * (-334.986) [-333.455] (-334.806) (-333.758) -- 0:00:33
427000 -- (-338.087) (-334.012) (-334.733) [-334.832] * (-336.558) (-333.222) (-338.346) [-333.163] -- 0:00:33
427500 -- (-334.532) [-333.506] (-334.058) (-334.698) * (-333.823) [-334.024] (-332.735) (-333.208) -- 0:00:33
428000 -- (-332.964) (-333.968) (-338.767) [-332.623] * [-333.283] (-341.509) (-333.815) (-333.197) -- 0:00:34
428500 -- (-337.043) [-333.412] (-338.206) (-333.734) * (-334.111) (-335.672) (-333.624) [-332.508] -- 0:00:34
429000 -- (-335.036) (-336.436) [-333.923] (-334.010) * (-334.036) (-338.357) [-333.786] (-332.660) -- 0:00:34
429500 -- [-336.329] (-332.619) (-333.131) (-334.081) * [-334.884] (-337.734) (-335.360) (-335.226) -- 0:00:34
430000 -- (-335.807) (-335.405) (-333.671) [-333.871] * (-334.074) (-334.196) [-336.835] (-337.296) -- 0:00:34
Average standard deviation of split frequencies: 0.015555
430500 -- (-335.662) (-335.571) (-333.050) [-332.433] * (-333.816) (-335.014) (-334.374) [-334.408] -- 0:00:34
431000 -- (-332.975) (-332.649) [-332.526] (-333.500) * [-333.835] (-332.421) (-340.143) (-332.968) -- 0:00:34
431500 -- (-332.751) (-332.731) [-333.841] (-333.382) * (-334.338) (-333.476) [-333.905] (-334.374) -- 0:00:34
432000 -- (-332.815) (-332.843) [-334.226] (-334.536) * (-333.420) (-335.302) (-334.297) [-337.020] -- 0:00:34
432500 -- [-333.115] (-333.632) (-338.388) (-339.670) * (-333.307) (-335.186) [-333.101] (-334.843) -- 0:00:34
433000 -- (-333.226) [-334.027] (-336.349) (-335.224) * [-332.762] (-332.213) (-333.914) (-337.348) -- 0:00:34
433500 -- [-333.740] (-332.911) (-332.926) (-333.478) * [-333.493] (-332.539) (-333.030) (-335.233) -- 0:00:33
434000 -- (-335.349) [-333.664] (-334.613) (-334.519) * [-335.868] (-333.740) (-335.531) (-333.602) -- 0:00:33
434500 -- (-336.383) (-335.475) [-335.080] (-335.048) * (-334.251) [-332.866] (-339.290) (-333.570) -- 0:00:33
435000 -- [-339.186] (-336.146) (-334.298) (-336.004) * [-334.086] (-333.015) (-335.830) (-332.078) -- 0:00:33
Average standard deviation of split frequencies: 0.014837
435500 -- (-337.641) [-334.261] (-332.997) (-334.683) * (-336.667) (-340.445) (-335.641) [-334.504] -- 0:00:33
436000 -- (-335.466) (-335.131) [-334.167] (-335.764) * [-336.130] (-336.897) (-336.743) (-335.135) -- 0:00:33
436500 -- (-333.453) (-333.692) [-334.908] (-336.042) * [-334.417] (-336.191) (-337.427) (-333.978) -- 0:00:33
437000 -- (-334.011) (-333.838) [-333.664] (-335.369) * (-336.390) (-335.814) (-336.905) [-333.657] -- 0:00:33
437500 -- [-332.815] (-335.627) (-337.270) (-334.866) * (-333.484) (-342.919) [-334.203] (-335.888) -- 0:00:33
438000 -- (-333.094) [-333.837] (-335.986) (-334.573) * [-333.463] (-338.872) (-335.547) (-335.119) -- 0:00:33
438500 -- (-333.679) (-335.419) (-333.993) [-335.679] * [-333.963] (-336.127) (-334.580) (-333.738) -- 0:00:33
439000 -- (-334.579) (-334.532) (-333.451) [-334.038] * (-334.912) [-333.609] (-338.787) (-335.393) -- 0:00:33
439500 -- (-332.228) (-332.944) (-333.008) [-333.201] * [-335.529] (-333.242) (-335.356) (-338.761) -- 0:00:33
440000 -- (-333.632) (-336.572) (-333.488) [-334.700] * (-335.599) [-333.819] (-335.125) (-333.282) -- 0:00:33
Average standard deviation of split frequencies: 0.014917
440500 -- [-334.961] (-338.876) (-335.377) (-337.177) * (-337.856) [-334.182] (-333.746) (-334.170) -- 0:00:33
441000 -- [-335.043] (-335.092) (-335.821) (-339.597) * (-333.417) (-333.552) [-334.576] (-333.837) -- 0:00:32
441500 -- [-335.604] (-334.925) (-338.134) (-332.760) * (-337.061) (-332.334) (-333.815) [-335.989] -- 0:00:32
442000 -- (-333.543) (-332.869) (-334.712) [-332.910] * (-333.133) (-332.294) [-333.129] (-333.244) -- 0:00:32
442500 -- [-338.819] (-334.581) (-332.130) (-334.157) * [-333.963] (-333.513) (-332.907) (-332.431) -- 0:00:32
443000 -- (-333.486) [-334.889] (-334.567) (-335.859) * (-334.293) (-332.803) [-335.768] (-334.579) -- 0:00:32
443500 -- (-332.474) [-334.436] (-333.863) (-334.908) * [-333.827] (-334.008) (-332.871) (-333.943) -- 0:00:32
444000 -- (-335.381) [-334.518] (-333.523) (-334.911) * (-333.781) [-335.027] (-332.358) (-333.567) -- 0:00:32
444500 -- (-333.306) (-332.680) [-335.389] (-337.434) * [-336.449] (-333.324) (-334.319) (-334.006) -- 0:00:33
445000 -- (-336.843) (-333.949) [-335.662] (-334.570) * (-334.411) (-332.940) (-333.830) [-333.323] -- 0:00:33
Average standard deviation of split frequencies: 0.014915
445500 -- (-344.227) (-333.065) [-337.394] (-335.590) * (-336.411) (-332.646) [-333.549] (-334.081) -- 0:00:33
446000 -- (-334.212) [-332.781] (-332.354) (-333.737) * (-339.029) (-336.388) (-333.852) [-333.018] -- 0:00:33
446500 -- (-335.627) (-333.654) [-334.941] (-332.361) * (-334.936) [-334.068] (-334.195) (-335.531) -- 0:00:33
447000 -- (-337.707) (-333.785) [-332.770] (-332.443) * (-334.507) [-332.136] (-333.416) (-336.388) -- 0:00:33
447500 -- (-332.620) (-335.156) [-333.852] (-336.540) * (-335.601) (-333.229) (-333.745) [-333.878] -- 0:00:33
448000 -- (-336.504) [-333.216] (-332.839) (-336.594) * (-332.903) (-333.051) [-333.790] (-336.291) -- 0:00:33
448500 -- (-332.813) [-334.141] (-332.195) (-336.893) * (-333.674) (-332.995) (-334.081) [-335.455] -- 0:00:33
449000 -- (-332.801) [-333.296] (-334.079) (-334.103) * [-333.466] (-337.891) (-333.687) (-335.757) -- 0:00:33
449500 -- (-335.416) [-334.062] (-336.057) (-336.388) * (-332.584) (-333.815) (-333.407) [-332.623] -- 0:00:33
450000 -- (-334.441) (-338.153) (-336.477) [-333.858] * (-333.013) (-334.722) [-339.583] (-332.566) -- 0:00:33
Average standard deviation of split frequencies: 0.014528
450500 -- (-334.202) [-335.915] (-334.293) (-335.199) * (-335.088) (-336.102) [-333.478] (-335.172) -- 0:00:32
451000 -- (-333.614) (-335.944) [-334.939] (-335.085) * (-336.402) [-334.274] (-334.556) (-335.591) -- 0:00:32
451500 -- (-334.489) (-335.082) (-336.378) [-333.987] * [-336.959] (-339.304) (-332.642) (-334.636) -- 0:00:32
452000 -- (-334.876) (-333.026) [-337.510] (-334.341) * (-340.711) (-333.806) (-338.560) [-335.177] -- 0:00:32
452500 -- (-336.455) [-332.771] (-336.214) (-339.149) * (-337.436) [-332.902] (-333.088) (-333.408) -- 0:00:32
453000 -- (-335.588) (-336.294) [-333.518] (-335.879) * (-332.775) [-334.054] (-337.030) (-332.870) -- 0:00:32
453500 -- (-333.027) (-335.593) [-333.438] (-336.459) * [-333.890] (-334.157) (-336.535) (-332.736) -- 0:00:32
454000 -- (-333.365) (-332.750) [-334.628] (-335.578) * (-333.729) (-333.668) (-333.797) [-332.926] -- 0:00:32
454500 -- (-335.699) [-335.339] (-333.283) (-333.576) * (-335.273) (-335.886) (-332.699) [-332.163] -- 0:00:32
455000 -- (-337.593) (-333.608) (-334.693) [-334.582] * (-333.191) (-333.704) (-333.911) [-333.553] -- 0:00:32
Average standard deviation of split frequencies: 0.015020
455500 -- [-333.659] (-332.693) (-334.667) (-334.058) * [-336.219] (-337.374) (-332.745) (-334.802) -- 0:00:32
456000 -- (-333.557) (-332.149) (-334.014) [-339.621] * (-332.736) (-336.030) [-336.572] (-336.036) -- 0:00:32
456500 -- (-335.359) [-332.454] (-333.929) (-336.332) * (-341.366) [-333.306] (-336.643) (-333.184) -- 0:00:32
457000 -- (-332.347) [-333.541] (-336.042) (-337.745) * (-338.524) (-334.282) [-333.994] (-334.871) -- 0:00:32
457500 -- (-335.577) [-334.156] (-334.782) (-333.418) * (-337.249) (-338.070) (-334.934) [-334.068] -- 0:00:32
458000 -- [-334.601] (-334.768) (-333.291) (-336.890) * [-333.805] (-334.367) (-337.333) (-335.083) -- 0:00:31
458500 -- (-332.653) (-333.877) [-337.921] (-334.132) * (-336.116) (-335.387) [-336.789] (-337.401) -- 0:00:31
459000 -- [-333.175] (-338.324) (-335.230) (-332.778) * [-334.951] (-334.040) (-333.713) (-334.080) -- 0:00:31
459500 -- (-333.498) [-335.008] (-332.632) (-334.360) * (-336.195) (-334.257) [-332.381] (-335.345) -- 0:00:31
460000 -- (-334.830) (-337.977) (-334.921) [-332.385] * (-334.731) [-334.386] (-333.657) (-334.117) -- 0:00:31
Average standard deviation of split frequencies: 0.015065
460500 -- (-334.822) (-332.888) (-333.048) [-334.142] * [-333.638] (-337.396) (-335.541) (-332.804) -- 0:00:31
461000 -- (-333.337) (-333.175) [-334.537] (-337.097) * (-334.627) (-337.420) (-334.640) [-333.506] -- 0:00:31
461500 -- (-334.263) (-335.669) (-333.892) [-333.639] * [-335.167] (-334.680) (-334.870) (-334.278) -- 0:00:32
462000 -- [-332.897] (-334.482) (-332.476) (-334.480) * (-332.601) [-336.414] (-333.671) (-339.535) -- 0:00:32
462500 -- (-333.269) (-337.354) (-334.373) [-332.844] * (-336.400) (-335.963) (-334.365) [-338.297] -- 0:00:32
463000 -- (-332.460) [-337.336] (-336.175) (-333.015) * (-335.065) [-338.209] (-332.369) (-337.882) -- 0:00:32
463500 -- (-332.504) (-338.401) [-334.938] (-334.412) * (-338.591) (-335.309) [-334.730] (-342.441) -- 0:00:32
464000 -- (-332.970) (-334.509) (-333.489) [-334.475] * [-333.014] (-337.772) (-341.392) (-335.730) -- 0:00:32
464500 -- (-333.301) (-339.509) [-334.709] (-333.683) * (-334.833) (-333.121) (-332.833) [-336.788] -- 0:00:32
465000 -- (-334.131) (-338.480) (-335.072) [-335.338] * (-333.044) (-332.859) (-337.430) [-333.116] -- 0:00:32
Average standard deviation of split frequencies: 0.014837
465500 -- (-334.191) [-334.012] (-336.293) (-333.940) * (-336.242) (-332.743) (-335.026) [-333.206] -- 0:00:32
466000 -- (-333.962) [-336.751] (-335.397) (-335.764) * (-335.493) (-336.022) (-333.219) [-333.867] -- 0:00:32
466500 -- (-333.649) (-333.270) (-335.503) [-334.914] * (-333.773) (-335.157) [-333.660] (-339.150) -- 0:00:32
467000 -- [-332.711] (-333.574) (-333.791) (-333.281) * (-336.133) [-333.481] (-333.859) (-332.816) -- 0:00:31
467500 -- (-335.695) [-332.402] (-336.698) (-332.494) * (-337.343) [-334.478] (-334.303) (-333.188) -- 0:00:31
468000 -- [-333.763] (-332.350) (-333.764) (-333.909) * (-334.890) [-332.756] (-333.067) (-337.976) -- 0:00:31
468500 -- [-334.215] (-332.981) (-332.899) (-332.903) * (-332.544) [-333.576] (-333.589) (-333.977) -- 0:00:31
469000 -- (-335.146) (-337.411) (-333.508) [-334.744] * (-335.091) [-334.781] (-334.382) (-335.525) -- 0:00:31
469500 -- (-334.123) (-338.685) (-333.418) [-333.190] * (-336.033) (-334.326) [-334.301] (-335.670) -- 0:00:31
470000 -- (-338.913) [-336.758] (-334.018) (-334.106) * (-336.823) [-338.612] (-334.130) (-335.513) -- 0:00:31
Average standard deviation of split frequencies: 0.014245
470500 -- [-335.660] (-332.725) (-333.317) (-333.523) * (-336.308) (-336.475) (-336.554) [-334.973] -- 0:00:31
471000 -- (-334.976) [-332.969] (-335.089) (-335.471) * (-334.101) (-333.559) [-336.384] (-333.606) -- 0:00:31
471500 -- (-335.511) (-335.471) (-333.428) [-335.622] * (-334.903) (-334.736) (-332.849) [-335.010] -- 0:00:31
472000 -- (-333.829) (-333.792) [-335.625] (-333.247) * [-334.861] (-335.325) (-335.136) (-336.625) -- 0:00:31
472500 -- (-334.874) [-334.045] (-336.628) (-332.352) * [-333.878] (-335.826) (-336.267) (-337.858) -- 0:00:31
473000 -- (-333.774) (-335.203) (-335.790) [-334.127] * (-334.376) (-336.697) (-333.936) [-335.152] -- 0:00:31
473500 -- [-333.750] (-336.031) (-337.945) (-335.276) * [-334.412] (-334.393) (-334.098) (-334.109) -- 0:00:31
474000 -- (-335.477) (-335.582) [-333.388] (-334.958) * (-335.916) (-333.477) (-333.739) [-335.119] -- 0:00:31
474500 -- [-334.372] (-335.069) (-335.633) (-332.905) * (-335.739) (-334.580) [-334.762] (-336.204) -- 0:00:31
475000 -- [-334.485] (-335.156) (-335.550) (-333.677) * (-337.471) [-333.195] (-334.503) (-334.872) -- 0:00:30
Average standard deviation of split frequencies: 0.013617
475500 -- (-333.706) [-334.517] (-335.457) (-332.712) * (-332.371) (-333.207) [-336.563] (-336.132) -- 0:00:30
476000 -- (-333.540) [-333.972] (-336.179) (-333.410) * (-333.217) (-335.642) [-334.361] (-334.113) -- 0:00:30
476500 -- (-332.514) (-334.367) (-334.670) [-335.022] * (-333.653) (-338.336) [-335.433] (-334.921) -- 0:00:30
477000 -- (-332.123) (-333.520) [-333.176] (-338.725) * (-332.600) (-333.802) [-333.342] (-334.318) -- 0:00:31
477500 -- (-333.270) (-337.019) (-336.428) [-333.692] * (-334.325) (-332.529) (-334.617) [-334.407] -- 0:00:31
478000 -- (-335.221) (-336.137) (-337.265) [-333.941] * (-335.885) (-335.617) (-333.307) [-332.790] -- 0:00:31
478500 -- (-332.375) (-334.832) [-337.023] (-334.275) * (-335.263) (-334.437) (-337.611) [-332.110] -- 0:00:31
479000 -- (-334.512) [-336.565] (-335.899) (-334.587) * (-332.797) [-333.275] (-335.991) (-334.477) -- 0:00:31
479500 -- (-336.622) [-334.757] (-334.606) (-332.945) * (-334.540) (-334.513) [-333.401] (-332.679) -- 0:00:31
480000 -- (-333.354) [-335.024] (-335.453) (-332.760) * (-334.078) (-334.501) (-332.342) [-334.664] -- 0:00:31
Average standard deviation of split frequencies: 0.014480
480500 -- (-335.016) [-335.145] (-332.706) (-332.755) * (-335.706) (-335.030) [-333.494] (-334.997) -- 0:00:31
481000 -- (-333.761) [-334.248] (-336.373) (-334.076) * (-336.198) (-334.469) [-332.350] (-335.868) -- 0:00:31
481500 -- [-332.933] (-334.775) (-335.530) (-333.478) * (-338.562) (-334.320) (-332.361) [-333.814] -- 0:00:31
482000 -- (-335.149) (-338.104) [-334.106] (-336.301) * (-337.263) (-335.844) [-332.663] (-333.388) -- 0:00:31
482500 -- (-334.096) [-334.787] (-334.150) (-332.887) * (-335.231) [-335.098] (-337.893) (-335.922) -- 0:00:31
483000 -- (-334.786) (-333.837) [-333.658] (-332.152) * [-338.899] (-333.732) (-334.438) (-333.283) -- 0:00:31
483500 -- [-335.419] (-333.765) (-334.805) (-333.283) * (-334.029) (-335.774) (-333.978) [-334.030] -- 0:00:30
484000 -- (-333.535) (-333.589) [-337.727] (-333.348) * [-332.811] (-333.174) (-332.810) (-333.879) -- 0:00:30
484500 -- (-333.243) [-336.457] (-335.285) (-335.779) * (-335.915) (-337.193) [-334.332] (-333.123) -- 0:00:30
485000 -- (-332.615) [-335.449] (-335.668) (-333.968) * (-333.839) [-333.434] (-332.700) (-335.877) -- 0:00:30
Average standard deviation of split frequencies: 0.015120
485500 -- [-333.582] (-336.874) (-333.786) (-335.168) * (-333.625) (-332.234) (-337.608) [-335.659] -- 0:00:30
486000 -- [-333.807] (-334.906) (-333.973) (-336.415) * [-332.828] (-334.772) (-335.331) (-336.690) -- 0:00:30
486500 -- (-333.561) (-333.787) [-336.239] (-332.995) * (-334.794) [-333.186] (-332.339) (-336.529) -- 0:00:30
487000 -- (-334.303) (-334.737) (-334.224) [-332.636] * (-334.349) (-332.813) (-332.827) [-333.976] -- 0:00:30
487500 -- (-334.667) [-333.866] (-333.571) (-333.827) * (-332.393) [-333.950] (-339.323) (-334.011) -- 0:00:30
488000 -- (-334.128) (-333.570) (-333.331) [-335.567] * (-334.318) (-333.376) (-339.168) [-333.846] -- 0:00:30
488500 -- (-337.044) (-336.834) [-336.306] (-334.065) * (-334.439) [-333.655] (-334.355) (-339.558) -- 0:00:30
489000 -- (-339.365) [-334.867] (-333.164) (-335.322) * (-334.500) [-333.290] (-333.196) (-334.087) -- 0:00:30
489500 -- [-334.690] (-334.776) (-333.896) (-338.338) * (-334.225) [-333.343] (-336.896) (-332.723) -- 0:00:30
490000 -- (-334.261) (-336.753) (-333.911) [-335.096] * (-338.151) (-340.800) (-333.626) [-336.066] -- 0:00:30
Average standard deviation of split frequencies: 0.014531
490500 -- (-334.963) [-337.138] (-333.615) (-333.250) * (-335.215) [-334.729] (-334.056) (-340.338) -- 0:00:30
491000 -- (-338.920) (-332.746) [-335.729] (-334.388) * [-332.565] (-334.053) (-338.098) (-338.374) -- 0:00:30
491500 -- (-333.371) (-333.929) (-335.056) [-334.012] * [-332.872] (-335.902) (-333.968) (-338.839) -- 0:00:30
492000 -- (-336.799) (-339.625) (-334.004) [-332.615] * (-334.825) (-333.647) [-337.039] (-334.352) -- 0:00:29
492500 -- (-335.166) [-333.071] (-334.220) (-335.533) * [-334.888] (-332.681) (-335.935) (-334.875) -- 0:00:29
493000 -- [-332.624] (-333.276) (-332.685) (-335.003) * (-334.830) [-332.251] (-334.218) (-333.263) -- 0:00:29
493500 -- (-337.013) (-336.460) [-333.858] (-332.560) * (-333.658) [-335.648] (-337.316) (-335.158) -- 0:00:29
494000 -- (-333.262) (-334.328) [-335.988] (-333.058) * [-334.865] (-334.350) (-336.879) (-335.882) -- 0:00:30
494500 -- [-335.522] (-336.632) (-334.835) (-336.351) * (-334.883) (-334.182) (-333.026) [-334.645] -- 0:00:30
495000 -- (-336.573) (-334.000) [-333.934] (-336.005) * (-333.431) (-334.555) [-332.874] (-332.928) -- 0:00:30
Average standard deviation of split frequencies: 0.014791
495500 -- (-335.206) (-332.948) [-336.227] (-333.572) * (-334.515) (-337.650) (-333.028) [-337.148] -- 0:00:30
496000 -- [-332.663] (-332.315) (-336.041) (-332.801) * (-332.825) (-336.840) [-334.120] (-333.449) -- 0:00:30
496500 -- [-333.640] (-335.128) (-333.686) (-333.528) * (-335.442) (-332.878) [-332.785] (-334.659) -- 0:00:30
497000 -- [-335.507] (-339.381) (-334.056) (-334.942) * (-333.499) [-335.233] (-336.516) (-335.515) -- 0:00:30
497500 -- [-333.555] (-347.023) (-337.878) (-332.744) * [-334.118] (-333.227) (-336.768) (-332.930) -- 0:00:30
498000 -- (-333.836) (-333.041) [-333.588] (-334.216) * (-333.524) (-333.336) (-334.365) [-334.374] -- 0:00:30
498500 -- (-333.504) [-334.813] (-335.669) (-338.909) * (-332.692) [-334.106] (-335.340) (-333.720) -- 0:00:30
499000 -- [-334.401] (-335.130) (-334.937) (-334.141) * (-333.321) [-333.537] (-337.681) (-332.361) -- 0:00:30
499500 -- [-334.338] (-332.878) (-333.481) (-334.370) * (-340.038) [-332.975] (-337.449) (-337.690) -- 0:00:30
500000 -- (-338.374) [-332.121] (-334.476) (-334.543) * (-335.544) [-334.370] (-338.035) (-333.468) -- 0:00:30
Average standard deviation of split frequencies: 0.014418
500500 -- (-337.361) [-332.773] (-332.827) (-336.188) * (-334.395) [-333.599] (-339.205) (-333.795) -- 0:00:29
501000 -- (-337.360) [-336.786] (-333.775) (-337.227) * (-333.345) (-335.453) (-336.678) [-334.160] -- 0:00:29
501500 -- [-334.442] (-333.795) (-335.373) (-334.392) * (-335.299) (-337.269) [-332.250] (-332.637) -- 0:00:29
502000 -- [-335.322] (-333.106) (-336.263) (-334.335) * (-334.670) (-334.667) [-332.234] (-335.237) -- 0:00:29
502500 -- (-335.170) [-333.961] (-339.814) (-333.742) * (-334.391) (-332.532) [-333.222] (-337.513) -- 0:00:29
503000 -- (-333.759) (-334.295) [-336.557] (-333.933) * (-335.583) (-332.791) [-337.439] (-335.704) -- 0:00:29
503500 -- [-334.620] (-336.696) (-334.214) (-335.359) * (-335.377) [-335.202] (-332.567) (-333.687) -- 0:00:29
504000 -- [-335.622] (-335.384) (-332.537) (-334.200) * (-336.968) (-334.259) (-335.055) [-332.727] -- 0:00:29
504500 -- (-333.630) (-335.122) (-333.746) [-333.676] * [-333.726] (-332.811) (-336.082) (-335.134) -- 0:00:29
505000 -- (-333.750) (-332.995) [-334.817] (-334.599) * (-335.736) (-336.617) [-335.057] (-340.730) -- 0:00:29
Average standard deviation of split frequencies: 0.014577
505500 -- (-337.196) (-333.880) [-336.423] (-336.228) * (-332.747) (-334.907) (-336.740) [-333.957] -- 0:00:29
506000 -- [-335.420] (-334.227) (-337.966) (-335.186) * (-332.608) (-333.275) (-333.707) [-334.265] -- 0:00:29
506500 -- (-336.437) (-337.331) [-333.286] (-333.115) * [-335.809] (-337.279) (-335.110) (-334.255) -- 0:00:29
507000 -- [-332.966] (-332.612) (-334.022) (-334.283) * [-335.032] (-333.057) (-332.566) (-340.768) -- 0:00:29
507500 -- (-334.376) (-337.659) [-333.966] (-332.357) * (-333.358) (-334.154) [-333.044] (-334.204) -- 0:00:29
508000 -- (-332.675) (-333.933) [-337.290] (-332.151) * (-333.153) (-335.645) [-336.310] (-332.691) -- 0:00:29
508500 -- (-333.552) [-332.689] (-341.127) (-332.898) * (-338.092) [-333.571] (-334.713) (-334.675) -- 0:00:28
509000 -- [-336.169] (-334.792) (-337.230) (-333.947) * (-334.426) (-334.231) (-333.542) [-334.324] -- 0:00:28
509500 -- (-333.722) (-334.512) [-333.721] (-333.740) * (-335.089) [-335.665] (-332.592) (-336.372) -- 0:00:28
510000 -- (-334.911) (-332.523) [-333.157] (-333.176) * (-334.881) [-333.955] (-333.613) (-335.790) -- 0:00:28
Average standard deviation of split frequencies: 0.014173
510500 -- (-332.936) (-335.658) [-334.103] (-333.367) * (-332.699) (-335.185) [-333.216] (-336.371) -- 0:00:28
511000 -- (-332.913) [-334.748] (-335.087) (-332.793) * (-338.312) (-335.206) (-335.942) [-336.292] -- 0:00:29
511500 -- [-337.926] (-334.877) (-335.678) (-333.075) * (-333.598) (-334.123) [-333.092] (-333.260) -- 0:00:29
512000 -- (-337.876) [-333.822] (-335.870) (-333.299) * (-334.648) [-336.201] (-334.499) (-333.401) -- 0:00:29
512500 -- [-333.018] (-334.000) (-334.664) (-332.956) * (-332.889) (-333.167) (-336.144) [-332.992] -- 0:00:29
513000 -- (-335.935) (-335.570) [-333.614] (-337.203) * (-333.547) [-335.963] (-336.890) (-336.243) -- 0:00:29
513500 -- (-336.960) [-335.361] (-337.514) (-340.735) * (-334.392) (-333.237) [-336.456] (-334.703) -- 0:00:29
514000 -- (-334.841) (-334.513) (-335.334) [-335.116] * (-333.976) (-334.898) (-332.669) [-334.185] -- 0:00:29
514500 -- (-335.142) [-337.209] (-333.875) (-333.204) * [-332.839] (-339.847) (-333.358) (-334.265) -- 0:00:29
515000 -- (-334.728) [-335.000] (-336.217) (-334.302) * (-332.732) (-336.799) [-334.607] (-333.360) -- 0:00:29
Average standard deviation of split frequencies: 0.013761
515500 -- [-335.047] (-333.627) (-335.543) (-332.532) * (-333.233) (-335.256) (-333.801) [-334.208] -- 0:00:29
516000 -- (-335.736) (-334.837) [-335.868] (-334.919) * (-333.667) (-337.258) (-333.904) [-333.215] -- 0:00:29
516500 -- (-334.488) (-334.017) (-333.918) [-332.661] * [-335.952] (-332.907) (-333.434) (-334.292) -- 0:00:29
517000 -- [-333.990] (-333.228) (-333.129) (-334.062) * (-333.422) [-336.923] (-335.281) (-334.832) -- 0:00:28
517500 -- [-333.445] (-332.658) (-332.787) (-334.033) * [-335.088] (-338.386) (-333.319) (-336.428) -- 0:00:28
518000 -- [-332.257] (-333.623) (-334.719) (-334.685) * [-337.243] (-335.209) (-332.517) (-333.099) -- 0:00:28
518500 -- [-335.405] (-337.126) (-336.027) (-333.263) * (-337.606) (-333.355) [-333.712] (-335.475) -- 0:00:28
519000 -- [-334.509] (-336.891) (-337.581) (-332.562) * (-332.998) (-335.444) [-332.794] (-332.871) -- 0:00:28
519500 -- (-332.850) (-336.488) [-333.231] (-333.913) * (-336.578) (-334.451) [-332.665] (-333.002) -- 0:00:28
520000 -- (-332.787) (-337.272) (-334.058) [-332.754] * [-336.720] (-334.682) (-334.431) (-333.866) -- 0:00:28
Average standard deviation of split frequencies: 0.014090
520500 -- (-336.075) [-334.295] (-333.392) (-333.568) * [-337.259] (-332.870) (-335.469) (-335.288) -- 0:00:28
521000 -- (-333.538) (-333.506) (-334.508) [-335.412] * (-334.053) [-337.376] (-335.485) (-334.428) -- 0:00:28
521500 -- (-335.125) (-333.862) (-336.350) [-333.557] * (-333.537) (-332.783) (-335.712) [-335.495] -- 0:00:28
522000 -- [-334.293] (-338.909) (-335.639) (-333.780) * (-335.616) (-333.720) (-334.357) [-335.073] -- 0:00:28
522500 -- (-334.337) (-335.229) [-332.814] (-333.317) * [-335.314] (-333.652) (-334.983) (-336.091) -- 0:00:28
523000 -- [-334.857] (-332.946) (-335.097) (-336.744) * [-333.359] (-333.814) (-336.757) (-335.041) -- 0:00:28
523500 -- (-332.628) (-334.196) (-339.326) [-333.315] * (-332.708) (-336.056) (-335.938) [-332.475] -- 0:00:28
524000 -- (-333.699) (-333.858) [-334.359] (-334.952) * (-335.130) (-334.432) (-334.038) [-333.772] -- 0:00:28
524500 -- (-335.768) (-334.826) (-334.984) [-333.137] * (-336.202) (-338.742) [-335.392] (-333.088) -- 0:00:28
525000 -- (-337.423) (-334.081) [-332.680] (-333.673) * (-336.953) (-333.419) [-333.947] (-334.240) -- 0:00:28
Average standard deviation of split frequencies: 0.014234
525500 -- (-335.280) (-334.981) (-332.612) [-333.425] * (-335.734) (-337.403) (-334.838) [-333.774] -- 0:00:27
526000 -- (-333.452) (-335.280) (-333.441) [-335.235] * (-335.730) [-333.301] (-332.720) (-338.088) -- 0:00:27
526500 -- (-334.341) [-333.075] (-333.078) (-335.291) * (-338.238) [-340.514] (-333.769) (-332.959) -- 0:00:27
527000 -- (-333.629) (-334.211) [-335.680] (-334.002) * (-334.440) (-332.776) [-332.928] (-334.633) -- 0:00:27
527500 -- [-332.850] (-333.924) (-333.521) (-335.488) * [-332.798] (-333.097) (-334.822) (-336.055) -- 0:00:27
528000 -- (-334.785) [-336.709] (-337.788) (-332.976) * (-332.999) (-333.635) [-333.939] (-337.914) -- 0:00:28
528500 -- (-336.218) [-332.400] (-342.095) (-334.274) * (-333.714) (-332.234) [-332.868] (-333.905) -- 0:00:28
529000 -- [-334.437] (-334.932) (-339.359) (-336.496) * (-334.365) (-336.721) [-333.625] (-335.996) -- 0:00:28
529500 -- [-335.223] (-335.652) (-335.139) (-336.567) * (-332.823) (-335.664) (-333.388) [-337.635] -- 0:00:28
530000 -- (-332.709) (-335.664) (-339.420) [-335.763] * (-338.509) (-335.158) (-333.103) [-333.696] -- 0:00:28
Average standard deviation of split frequencies: 0.014265
530500 -- (-334.297) (-335.592) (-337.703) [-334.764] * (-337.664) [-336.077] (-333.468) (-333.613) -- 0:00:28
531000 -- (-333.303) (-335.472) (-335.859) [-334.681] * (-337.147) [-333.123] (-332.393) (-333.989) -- 0:00:28
531500 -- [-333.776] (-336.205) (-336.728) (-344.229) * (-336.039) [-332.790] (-332.758) (-335.602) -- 0:00:28
532000 -- (-335.898) [-333.452] (-334.463) (-340.480) * (-333.844) (-334.114) [-334.353] (-333.699) -- 0:00:28
532500 -- (-333.831) [-333.379] (-335.077) (-334.454) * [-334.116] (-334.824) (-338.131) (-338.637) -- 0:00:28
533000 -- (-336.737) (-333.926) (-335.187) [-336.985] * (-336.304) (-333.736) (-334.151) [-337.057] -- 0:00:28
533500 -- (-334.827) (-333.753) [-333.075] (-336.576) * (-333.109) (-332.475) (-334.672) [-333.805] -- 0:00:27
534000 -- [-335.875] (-338.962) (-334.789) (-334.823) * (-336.299) (-335.490) [-332.360] (-335.395) -- 0:00:27
534500 -- (-335.435) (-334.214) [-334.658] (-345.826) * (-333.907) (-333.745) [-333.032] (-332.857) -- 0:00:27
535000 -- (-335.657) (-335.074) (-333.543) [-333.968] * (-335.234) (-333.177) (-332.498) [-333.828] -- 0:00:27
Average standard deviation of split frequencies: 0.014848
535500 -- (-336.634) (-334.639) [-332.609] (-332.910) * (-336.615) [-333.221] (-333.941) (-335.065) -- 0:00:27
536000 -- (-334.742) [-334.632] (-333.891) (-334.101) * (-334.521) (-334.073) (-332.674) [-335.558] -- 0:00:27
536500 -- (-333.122) (-333.639) (-333.078) [-334.534] * (-334.224) [-333.269] (-332.793) (-337.145) -- 0:00:27
537000 -- (-334.004) [-332.223] (-334.614) (-336.645) * (-333.393) (-334.413) [-334.473] (-332.297) -- 0:00:27
537500 -- (-342.830) (-334.821) [-334.704] (-335.195) * (-333.201) [-333.742] (-334.936) (-336.675) -- 0:00:27
538000 -- (-334.659) (-332.723) [-332.049] (-335.599) * [-337.446] (-335.434) (-335.635) (-334.913) -- 0:00:27
538500 -- (-335.092) (-334.178) (-335.301) [-337.603] * [-334.326] (-337.698) (-335.292) (-334.170) -- 0:00:27
539000 -- [-335.865] (-336.817) (-333.545) (-335.214) * (-333.714) [-337.936] (-332.685) (-334.503) -- 0:00:27
539500 -- (-334.252) (-332.415) [-334.268] (-337.962) * [-334.754] (-339.136) (-333.838) (-337.726) -- 0:00:27
540000 -- (-333.500) (-334.583) [-332.073] (-338.690) * (-332.780) [-338.210] (-333.264) (-333.732) -- 0:00:27
Average standard deviation of split frequencies: 0.013232
540500 -- [-333.469] (-334.563) (-335.725) (-335.460) * (-336.361) [-336.592] (-335.671) (-333.128) -- 0:00:27
541000 -- (-334.241) [-333.715] (-335.420) (-336.495) * (-334.028) (-336.576) (-336.313) [-333.772] -- 0:00:27
541500 -- (-337.175) (-334.500) (-335.365) [-334.473] * (-334.536) (-334.199) (-333.533) [-333.457] -- 0:00:27
542000 -- (-336.649) (-333.834) [-334.860] (-333.793) * [-333.860] (-333.515) (-335.897) (-336.173) -- 0:00:27
542500 -- (-339.085) [-333.058] (-339.911) (-332.613) * (-333.628) [-332.817] (-335.699) (-336.726) -- 0:00:26
543000 -- (-333.131) [-334.032] (-335.723) (-335.309) * (-334.890) [-334.020] (-336.849) (-336.377) -- 0:00:26
543500 -- (-334.163) [-332.632] (-332.212) (-332.643) * [-332.681] (-333.123) (-335.632) (-334.294) -- 0:00:26
544000 -- (-334.809) (-332.239) (-335.809) [-334.296] * [-333.902] (-332.477) (-334.976) (-335.769) -- 0:00:26
544500 -- (-335.888) (-333.167) [-333.858] (-335.885) * (-334.010) (-336.771) (-333.568) [-337.390] -- 0:00:26
545000 -- (-333.952) (-334.012) [-334.150] (-335.502) * (-333.396) [-337.687] (-336.519) (-338.483) -- 0:00:26
Average standard deviation of split frequencies: 0.012544
545500 -- (-336.947) (-332.953) (-335.285) [-332.866] * (-333.059) [-336.889] (-335.714) (-334.658) -- 0:00:27
546000 -- (-334.554) (-338.875) (-333.709) [-333.385] * (-334.946) (-334.798) (-333.203) [-332.642] -- 0:00:27
546500 -- [-336.241] (-336.930) (-332.989) (-335.433) * (-335.249) [-333.650] (-333.819) (-332.414) -- 0:00:27
547000 -- (-338.695) (-334.537) (-332.912) [-333.169] * (-333.432) [-332.853] (-332.636) (-333.412) -- 0:00:27
547500 -- [-336.335] (-334.013) (-333.116) (-336.645) * (-333.991) (-336.452) (-333.264) [-333.100] -- 0:00:27
548000 -- (-335.632) [-332.861] (-333.159) (-335.088) * (-333.486) [-335.238] (-334.811) (-333.566) -- 0:00:27
548500 -- (-333.161) (-332.492) (-334.843) [-333.447] * (-334.927) (-334.590) (-334.717) [-332.911] -- 0:00:27
549000 -- (-336.795) [-332.187] (-333.177) (-334.153) * (-334.475) (-334.439) (-334.896) [-332.123] -- 0:00:27
549500 -- (-335.054) [-335.864] (-335.154) (-333.018) * [-334.938] (-334.048) (-339.078) (-337.859) -- 0:00:27
550000 -- [-337.479] (-336.031) (-333.932) (-337.148) * [-333.841] (-337.102) (-334.266) (-336.685) -- 0:00:27
Average standard deviation of split frequencies: 0.012186
550500 -- (-334.406) [-332.534] (-334.138) (-335.062) * (-333.643) (-339.833) (-334.303) [-335.992] -- 0:00:26
551000 -- (-333.922) [-333.475] (-333.563) (-332.912) * (-334.671) [-334.770] (-334.023) (-337.880) -- 0:00:26
551500 -- (-333.526) [-334.311] (-334.727) (-335.553) * (-335.610) [-336.222] (-335.222) (-334.070) -- 0:00:26
552000 -- (-335.262) (-336.098) [-332.898] (-335.320) * (-333.674) (-334.583) (-336.287) [-332.876] -- 0:00:26
552500 -- (-337.060) (-334.731) (-333.500) [-335.803] * (-332.711) (-332.589) [-334.897] (-337.199) -- 0:00:26
553000 -- (-336.038) (-335.626) [-332.559] (-337.860) * (-337.253) (-332.784) (-338.107) [-335.671] -- 0:00:26
553500 -- (-336.315) (-335.035) (-332.674) [-334.128] * (-339.367) (-348.159) (-339.429) [-333.752] -- 0:00:26
554000 -- (-336.464) [-334.839] (-335.354) (-333.953) * (-335.521) (-335.290) (-333.719) [-336.238] -- 0:00:26
554500 -- (-333.571) [-337.771] (-335.777) (-333.680) * [-335.626] (-335.533) (-334.571) (-335.619) -- 0:00:26
555000 -- (-336.888) (-335.018) (-336.523) [-334.215] * [-337.238] (-334.293) (-338.867) (-335.312) -- 0:00:26
Average standard deviation of split frequencies: 0.012518
555500 -- (-335.059) [-336.772] (-336.159) (-335.836) * [-333.194] (-341.134) (-336.809) (-333.910) -- 0:00:26
556000 -- (-334.193) (-336.252) [-336.942] (-335.348) * [-334.499] (-333.840) (-333.289) (-334.969) -- 0:00:26
556500 -- (-333.891) (-333.654) (-334.245) [-334.766] * (-338.429) (-335.311) (-338.911) [-334.750] -- 0:00:26
557000 -- [-333.917] (-334.327) (-334.292) (-332.903) * (-335.466) (-337.179) (-341.161) [-336.169] -- 0:00:26
557500 -- [-336.076] (-334.057) (-336.369) (-332.199) * (-335.122) [-332.471] (-343.799) (-333.421) -- 0:00:26
558000 -- (-333.987) (-334.532) [-335.828] (-333.805) * [-334.332] (-333.253) (-335.512) (-333.003) -- 0:00:26
558500 -- [-335.120] (-336.752) (-334.276) (-335.751) * (-334.180) (-336.997) (-333.874) [-335.183] -- 0:00:26
559000 -- (-336.075) (-336.775) (-340.390) [-333.480] * (-334.045) (-333.404) (-332.794) [-334.931] -- 0:00:26
559500 -- (-334.117) (-335.343) (-332.770) [-335.159] * (-332.961) (-333.947) (-334.794) [-333.612] -- 0:00:25
560000 -- (-334.061) (-334.867) [-333.710] (-334.089) * [-333.565] (-332.752) (-333.342) (-333.392) -- 0:00:25
Average standard deviation of split frequencies: 0.012167
560500 -- [-333.685] (-333.934) (-333.550) (-333.092) * (-336.274) (-334.846) [-333.279] (-332.811) -- 0:00:25
561000 -- (-333.820) (-333.384) [-332.433] (-333.900) * (-336.515) (-333.961) (-332.181) [-332.707] -- 0:00:25
561500 -- (-336.625) (-334.705) [-334.524] (-334.320) * (-335.945) [-333.139] (-336.393) (-332.384) -- 0:00:25
562000 -- (-336.787) (-336.425) (-334.031) [-334.884] * [-337.987] (-333.230) (-334.261) (-332.731) -- 0:00:25
562500 -- (-334.675) (-335.225) (-334.990) [-333.171] * (-335.502) [-332.959] (-334.999) (-335.963) -- 0:00:26
563000 -- (-335.804) (-334.875) (-335.114) [-336.100] * (-337.050) (-333.137) (-338.354) [-336.503] -- 0:00:26
563500 -- [-335.806] (-332.898) (-333.466) (-334.906) * (-334.670) (-332.563) (-334.926) [-332.863] -- 0:00:26
564000 -- (-332.228) (-334.194) [-332.421] (-337.782) * (-335.045) [-332.836] (-334.564) (-336.855) -- 0:00:26
564500 -- (-333.264) [-335.115] (-333.840) (-336.556) * (-333.682) [-334.294] (-333.905) (-334.754) -- 0:00:26
565000 -- (-333.885) [-334.586] (-334.313) (-336.593) * [-333.598] (-333.280) (-333.892) (-334.984) -- 0:00:26
Average standard deviation of split frequencies: 0.012123
565500 -- (-333.987) (-334.134) (-333.577) [-335.890] * [-333.457] (-334.873) (-334.144) (-333.790) -- 0:00:26
566000 -- (-335.691) [-334.539] (-333.444) (-333.584) * (-333.425) [-332.916] (-333.583) (-335.879) -- 0:00:26
566500 -- (-333.636) (-336.156) (-334.536) [-333.895] * (-333.800) [-337.960] (-333.416) (-332.559) -- 0:00:26
567000 -- (-334.763) (-337.183) [-332.352] (-333.684) * (-334.106) (-336.241) (-334.586) [-334.842] -- 0:00:25
567500 -- (-333.678) [-333.086] (-334.806) (-332.953) * [-338.017] (-336.568) (-335.277) (-337.604) -- 0:00:25
568000 -- (-333.793) (-332.643) [-335.110] (-333.157) * [-333.741] (-334.224) (-334.931) (-335.502) -- 0:00:25
568500 -- (-334.782) (-335.369) (-335.897) [-334.054] * [-334.746] (-333.598) (-333.777) (-334.937) -- 0:00:25
569000 -- (-338.030) (-335.170) [-333.818] (-332.906) * (-337.483) (-335.034) [-334.806] (-337.762) -- 0:00:25
569500 -- (-337.136) (-334.196) (-337.439) [-335.076] * (-335.253) (-332.597) (-333.574) [-334.138] -- 0:00:25
570000 -- (-337.418) [-334.324] (-335.920) (-333.509) * (-339.994) [-335.686] (-334.024) (-334.515) -- 0:00:25
Average standard deviation of split frequencies: 0.011703
570500 -- (-333.628) (-337.518) (-334.934) [-337.038] * (-337.707) [-332.952] (-333.005) (-335.031) -- 0:00:25
571000 -- (-333.781) [-336.034] (-334.542) (-335.097) * (-334.975) (-333.098) (-333.925) [-332.979] -- 0:00:25
571500 -- (-333.690) (-334.776) [-333.505] (-334.816) * (-334.497) (-333.340) (-336.485) [-333.436] -- 0:00:25
572000 -- [-333.165] (-336.771) (-332.417) (-336.961) * [-334.147] (-333.449) (-335.906) (-332.612) -- 0:00:25
572500 -- (-333.539) (-334.625) (-332.555) [-333.287] * [-336.109] (-332.919) (-334.134) (-332.626) -- 0:00:25
573000 -- [-332.901] (-335.524) (-335.668) (-334.157) * (-335.408) (-333.813) (-334.832) [-332.342] -- 0:00:25
573500 -- (-334.867) [-332.999] (-337.125) (-333.884) * (-335.106) (-333.936) (-335.727) [-332.275] -- 0:00:25
574000 -- (-333.708) (-333.023) (-336.863) [-335.872] * (-333.256) (-333.367) (-333.784) [-332.512] -- 0:00:25
574500 -- (-333.189) (-333.708) [-335.492] (-334.657) * (-333.472) (-333.647) (-333.569) [-337.953] -- 0:00:25
575000 -- (-333.111) [-333.863] (-333.428) (-335.944) * (-337.563) [-332.920] (-334.597) (-334.090) -- 0:00:25
Average standard deviation of split frequencies: 0.011503
575500 -- (-336.761) (-333.071) (-334.231) [-333.914] * (-334.172) (-334.332) [-333.364] (-332.722) -- 0:00:25
576000 -- (-334.610) [-332.522] (-333.396) (-332.866) * (-332.586) (-336.191) (-337.302) [-333.518] -- 0:00:25
576500 -- (-333.421) [-333.251] (-335.655) (-333.116) * [-334.391] (-332.968) (-334.560) (-333.503) -- 0:00:24
577000 -- (-334.049) (-335.015) [-332.776] (-332.847) * (-335.530) (-335.625) [-336.593] (-334.265) -- 0:00:24
577500 -- (-335.904) (-335.824) (-333.751) [-333.193] * (-333.945) (-334.622) [-334.722] (-334.253) -- 0:00:24
578000 -- (-332.770) [-334.594] (-333.454) (-336.247) * (-335.426) [-333.693] (-334.569) (-334.046) -- 0:00:24
578500 -- (-336.459) (-334.722) [-339.343] (-335.504) * [-338.204] (-334.396) (-336.601) (-335.128) -- 0:00:24
579000 -- (-334.329) (-334.799) (-335.768) [-336.077] * (-336.541) (-334.270) (-334.682) [-333.087] -- 0:00:25
579500 -- (-333.858) [-332.625] (-334.375) (-336.700) * (-338.952) (-333.501) [-334.565] (-338.936) -- 0:00:25
580000 -- (-332.467) [-333.888] (-336.128) (-334.259) * [-333.580] (-332.534) (-334.846) (-334.649) -- 0:00:25
Average standard deviation of split frequencies: 0.011986
580500 -- (-335.124) (-332.629) (-333.960) [-333.983] * (-333.828) (-334.450) [-334.967] (-335.282) -- 0:00:25
581000 -- [-336.867] (-335.993) (-333.749) (-335.342) * (-332.745) (-337.552) (-333.930) [-332.997] -- 0:00:25
581500 -- (-337.917) (-336.161) [-332.999] (-336.271) * (-332.715) (-332.786) (-332.403) [-338.323] -- 0:00:25
582000 -- (-336.237) (-337.889) [-334.293] (-338.583) * (-333.672) (-334.576) [-334.446] (-338.783) -- 0:00:25
582500 -- (-336.271) (-334.123) [-333.602] (-334.251) * (-334.805) (-333.744) (-335.598) [-337.481] -- 0:00:25
583000 -- (-344.288) [-333.627] (-333.432) (-334.900) * (-338.832) (-334.231) (-337.449) [-333.593] -- 0:00:25
583500 -- [-333.418] (-333.085) (-332.695) (-334.087) * (-334.558) (-334.552) (-336.108) [-334.724] -- 0:00:24
584000 -- [-337.210] (-333.332) (-334.173) (-334.577) * [-334.033] (-336.308) (-333.850) (-332.978) -- 0:00:24
584500 -- [-334.558] (-332.767) (-335.529) (-332.686) * (-334.703) [-334.205] (-335.870) (-334.043) -- 0:00:24
585000 -- (-332.757) (-334.780) (-337.206) [-332.280] * (-334.923) (-335.732) (-336.917) [-334.935] -- 0:00:24
Average standard deviation of split frequencies: 0.011262
585500 -- [-332.897] (-333.355) (-334.457) (-334.505) * (-335.341) (-335.090) (-333.016) [-335.573] -- 0:00:24
586000 -- (-335.140) (-332.760) [-333.951] (-334.560) * [-337.926] (-338.698) (-346.009) (-336.037) -- 0:00:24
586500 -- [-334.219] (-332.541) (-332.535) (-335.108) * [-333.351] (-335.288) (-333.867) (-336.626) -- 0:00:24
587000 -- [-334.151] (-338.314) (-333.424) (-338.404) * [-335.056] (-336.373) (-333.430) (-332.206) -- 0:00:24
587500 -- (-333.488) (-333.876) (-334.367) [-332.820] * (-333.319) (-335.437) (-333.576) [-334.297] -- 0:00:24
588000 -- (-333.621) (-332.334) (-337.527) [-336.058] * [-334.706] (-332.973) (-332.504) (-337.931) -- 0:00:24
588500 -- (-335.349) (-336.271) (-339.050) [-334.359] * (-335.973) [-333.661] (-332.612) (-334.840) -- 0:00:24
589000 -- [-335.209] (-336.068) (-336.165) (-335.020) * [-334.546] (-333.824) (-334.719) (-339.194) -- 0:00:24
589500 -- [-332.996] (-335.676) (-333.301) (-335.221) * [-336.666] (-343.656) (-333.467) (-335.030) -- 0:00:24
590000 -- [-335.198] (-333.229) (-334.743) (-335.539) * (-337.463) (-334.677) [-336.553] (-333.583) -- 0:00:24
Average standard deviation of split frequencies: 0.010819
590500 -- [-333.569] (-334.267) (-334.606) (-334.517) * (-335.394) [-335.800] (-332.908) (-334.464) -- 0:00:24
591000 -- (-333.132) [-336.241] (-335.622) (-332.693) * [-334.040] (-336.141) (-333.577) (-333.466) -- 0:00:24
591500 -- [-336.485] (-340.049) (-335.358) (-332.652) * (-335.774) (-342.899) (-333.653) [-335.137] -- 0:00:24
592000 -- (-332.986) [-333.585] (-334.504) (-333.689) * [-336.513] (-334.200) (-334.594) (-338.033) -- 0:00:24
592500 -- (-334.096) [-334.780] (-333.101) (-332.833) * [-335.971] (-339.612) (-337.250) (-333.693) -- 0:00:24
593000 -- (-333.725) (-340.180) [-334.503] (-333.428) * (-332.443) [-333.621] (-334.862) (-335.499) -- 0:00:24
593500 -- (-334.310) (-335.649) (-334.506) [-333.822] * [-336.508] (-342.500) (-333.642) (-336.232) -- 0:00:23
594000 -- [-336.504] (-334.762) (-336.000) (-333.280) * (-335.170) [-335.084] (-334.582) (-337.341) -- 0:00:23
594500 -- (-332.953) (-334.513) (-334.537) [-333.519] * (-336.051) [-338.476] (-333.734) (-334.427) -- 0:00:23
595000 -- (-333.467) [-333.942] (-332.654) (-332.568) * [-333.904] (-338.437) (-333.445) (-334.722) -- 0:00:23
Average standard deviation of split frequencies: 0.011073
595500 -- (-334.819) (-335.592) [-332.858] (-333.754) * [-335.251] (-333.646) (-332.330) (-332.709) -- 0:00:23
596000 -- (-335.277) (-335.836) (-338.987) [-333.319] * (-334.497) (-333.627) (-337.151) [-334.889] -- 0:00:24
596500 -- [-335.521] (-335.906) (-333.241) (-335.252) * (-335.192) (-334.477) (-337.593) [-335.063] -- 0:00:24
597000 -- (-334.666) (-336.288) (-335.287) [-335.694] * (-334.493) (-338.736) (-337.886) [-332.791] -- 0:00:24
597500 -- (-333.280) (-333.082) [-333.940] (-338.511) * (-336.249) [-332.816] (-335.563) (-332.814) -- 0:00:24
598000 -- (-333.104) (-333.580) [-333.664] (-332.399) * (-335.195) (-332.816) [-334.727] (-332.551) -- 0:00:24
598500 -- [-332.947] (-335.167) (-333.166) (-334.534) * (-333.772) (-333.270) [-336.127] (-336.213) -- 0:00:24
599000 -- [-335.158] (-332.632) (-333.403) (-334.880) * [-333.610] (-334.673) (-337.351) (-335.688) -- 0:00:24
599500 -- [-336.470] (-335.108) (-334.434) (-335.186) * [-333.981] (-337.042) (-334.283) (-336.141) -- 0:00:24
600000 -- [-333.271] (-338.898) (-333.377) (-333.993) * [-337.565] (-334.210) (-332.580) (-337.067) -- 0:00:24
Average standard deviation of split frequencies: 0.010756
600500 -- [-336.556] (-335.665) (-334.060) (-334.561) * (-336.808) [-335.604] (-333.658) (-336.663) -- 0:00:23
601000 -- [-338.780] (-333.767) (-336.936) (-334.628) * (-339.929) (-332.460) [-332.652] (-333.208) -- 0:00:23
601500 -- (-337.225) (-340.935) (-332.882) [-334.057] * (-335.153) (-334.851) (-332.998) [-332.424] -- 0:00:23
602000 -- [-334.417] (-334.225) (-334.051) (-334.953) * (-333.029) (-336.882) (-332.424) [-334.462] -- 0:00:23
602500 -- (-334.938) (-336.354) [-333.522] (-333.725) * (-334.177) (-333.227) (-332.775) [-334.116] -- 0:00:23
603000 -- (-334.784) [-338.359] (-333.469) (-336.454) * (-333.594) (-333.502) (-333.251) [-333.077] -- 0:00:23
603500 -- [-332.944] (-334.305) (-336.377) (-335.364) * (-333.836) (-333.541) (-337.917) [-334.765] -- 0:00:23
604000 -- [-334.870] (-333.849) (-335.116) (-334.538) * (-335.129) (-341.736) (-334.772) [-332.411] -- 0:00:23
604500 -- (-333.741) (-336.869) [-338.261] (-335.639) * (-333.603) [-334.902] (-336.415) (-333.036) -- 0:00:23
605000 -- (-333.176) (-335.104) (-334.214) [-333.927] * (-335.025) (-335.935) (-335.127) [-340.423] -- 0:00:23
Average standard deviation of split frequencies: 0.011063
605500 -- [-335.655] (-336.228) (-339.915) (-333.590) * (-334.576) [-337.882] (-335.679) (-339.286) -- 0:00:23
606000 -- (-333.842) (-339.015) [-332.804] (-332.891) * (-335.538) (-335.139) [-333.505] (-337.687) -- 0:00:23
606500 -- (-337.497) (-335.362) (-335.383) [-333.396] * [-335.775] (-335.460) (-335.058) (-333.050) -- 0:00:23
607000 -- (-336.755) (-333.107) (-333.876) [-336.011] * (-335.554) [-333.023] (-332.848) (-332.514) -- 0:00:23
607500 -- (-336.825) (-340.737) [-333.301] (-334.362) * (-334.116) (-333.357) [-333.945] (-337.542) -- 0:00:23
608000 -- (-337.350) (-335.137) [-334.420] (-333.118) * (-334.390) (-332.871) [-334.165] (-336.106) -- 0:00:23
608500 -- (-337.232) (-333.218) [-334.094] (-333.568) * (-333.840) (-333.232) [-332.995] (-339.027) -- 0:00:23
609000 -- (-332.449) [-334.254] (-332.882) (-332.918) * (-336.023) (-332.648) (-334.976) [-341.754] -- 0:00:23
609500 -- (-332.963) (-337.393) [-332.982] (-334.726) * (-333.811) (-335.311) (-335.780) [-338.631] -- 0:00:23
610000 -- (-335.791) [-336.502] (-332.550) (-333.387) * (-335.820) (-334.386) [-334.233] (-334.656) -- 0:00:23
Average standard deviation of split frequencies: 0.011279
610500 -- (-334.544) [-334.480] (-334.593) (-335.018) * [-334.680] (-333.670) (-336.530) (-334.597) -- 0:00:22
611000 -- (-332.689) (-332.296) [-332.900] (-334.040) * (-332.600) [-333.177] (-334.485) (-333.678) -- 0:00:22
611500 -- (-334.721) [-334.904] (-334.951) (-333.192) * (-333.058) (-333.783) [-333.554] (-336.729) -- 0:00:22
612000 -- [-337.296] (-332.834) (-337.930) (-332.764) * (-334.984) (-335.789) (-334.461) [-336.251] -- 0:00:22
612500 -- [-332.484] (-332.570) (-335.922) (-335.523) * (-334.650) (-336.244) [-333.619] (-333.399) -- 0:00:22
613000 -- [-336.113] (-333.653) (-338.117) (-335.646) * (-337.875) (-335.588) (-335.188) [-333.177] -- 0:00:23
613500 -- (-333.906) (-338.759) (-334.744) [-337.163] * [-333.283] (-335.676) (-335.752) (-335.667) -- 0:00:23
614000 -- (-336.190) [-332.968] (-334.722) (-341.745) * (-333.896) (-336.087) [-335.931] (-333.304) -- 0:00:23
614500 -- (-334.541) (-338.700) [-333.444] (-342.744) * (-336.126) [-333.850] (-339.449) (-333.545) -- 0:00:23
615000 -- (-332.874) (-334.391) (-334.312) [-338.023] * (-334.085) [-332.735] (-334.995) (-332.826) -- 0:00:23
Average standard deviation of split frequencies: 0.010714
615500 -- (-340.210) [-333.727] (-332.766) (-334.203) * (-336.537) [-333.422] (-339.408) (-336.250) -- 0:00:23
616000 -- (-334.926) [-335.446] (-333.996) (-333.725) * (-344.261) [-336.430] (-339.515) (-334.491) -- 0:00:23
616500 -- (-335.937) [-334.357] (-336.135) (-333.756) * [-336.820] (-333.318) (-333.414) (-332.933) -- 0:00:23
617000 -- (-338.472) (-335.061) [-333.808] (-338.873) * (-338.404) (-333.858) [-333.174] (-333.063) -- 0:00:22
617500 -- (-339.473) (-334.785) [-333.707] (-338.716) * (-335.302) (-334.799) [-333.257] (-333.358) -- 0:00:22
618000 -- (-332.584) [-336.677] (-335.971) (-336.325) * (-334.019) [-334.625] (-339.687) (-335.187) -- 0:00:22
618500 -- (-337.076) (-337.866) (-334.678) [-333.324] * [-333.187] (-336.543) (-340.831) (-335.152) -- 0:00:22
619000 -- (-336.126) [-334.194] (-334.883) (-332.487) * (-333.644) (-332.813) [-338.118] (-334.096) -- 0:00:22
619500 -- (-333.843) (-340.476) [-332.201] (-336.461) * [-332.825] (-333.753) (-333.967) (-334.067) -- 0:00:22
620000 -- (-332.833) (-336.232) [-332.975] (-335.258) * [-335.111] (-333.575) (-332.953) (-336.366) -- 0:00:22
Average standard deviation of split frequencies: 0.010886
620500 -- (-333.163) [-339.555] (-333.200) (-333.486) * (-333.674) [-334.101] (-334.451) (-338.405) -- 0:00:22
621000 -- (-334.573) [-334.080] (-336.890) (-334.173) * (-336.220) (-333.449) [-335.896] (-334.348) -- 0:00:22
621500 -- [-333.956] (-334.338) (-334.143) (-334.514) * (-336.184) [-333.558] (-334.830) (-335.525) -- 0:00:22
622000 -- (-334.608) (-334.546) [-333.814] (-337.576) * (-335.218) (-338.235) [-334.074] (-333.831) -- 0:00:22
622500 -- (-335.953) (-334.305) (-336.193) [-334.794] * (-332.977) (-334.653) (-334.858) [-334.218] -- 0:00:22
623000 -- (-334.778) [-336.664] (-335.586) (-335.070) * [-336.185] (-339.040) (-335.725) (-333.950) -- 0:00:22
623500 -- (-333.316) (-333.953) (-333.206) [-334.696] * [-337.024] (-339.224) (-333.815) (-336.676) -- 0:00:22
624000 -- (-332.327) (-333.617) (-333.152) [-334.485] * (-335.888) (-338.971) [-336.139] (-334.254) -- 0:00:22
624500 -- [-334.609] (-334.106) (-336.084) (-335.815) * (-333.799) (-338.889) (-343.334) [-332.794] -- 0:00:22
625000 -- (-334.511) (-332.154) (-337.188) [-332.237] * [-334.788] (-336.201) (-332.778) (-333.650) -- 0:00:22
Average standard deviation of split frequencies: 0.010543
625500 -- (-334.103) (-332.797) (-334.700) [-333.160] * (-333.400) (-334.823) (-334.927) [-332.973] -- 0:00:22
626000 -- (-334.846) [-334.846] (-335.300) (-333.844) * (-332.892) [-333.857] (-333.476) (-334.325) -- 0:00:22
626500 -- (-333.988) (-334.068) [-335.392] (-334.096) * (-332.946) (-336.567) [-333.762] (-334.416) -- 0:00:22
627000 -- (-333.656) (-334.696) (-337.256) [-335.443] * [-335.666] (-334.256) (-336.436) (-333.192) -- 0:00:22
627500 -- (-335.798) (-332.166) [-333.874] (-334.147) * (-334.402) (-334.132) [-332.415] (-332.491) -- 0:00:21
628000 -- (-332.333) [-334.021] (-334.579) (-333.572) * (-334.201) (-333.690) [-334.334] (-333.699) -- 0:00:21
628500 -- (-333.176) (-337.565) (-334.813) [-333.199] * (-335.831) (-335.616) (-335.670) [-335.051] -- 0:00:21
629000 -- (-333.144) (-337.328) [-334.155] (-332.845) * [-337.673] (-333.050) (-336.407) (-335.186) -- 0:00:21
629500 -- (-334.501) [-334.042] (-332.528) (-333.861) * (-334.398) [-335.284] (-334.770) (-332.362) -- 0:00:21
630000 -- (-333.914) (-334.022) [-333.237] (-336.932) * [-332.842] (-335.580) (-333.274) (-334.587) -- 0:00:21
Average standard deviation of split frequencies: 0.010797
630500 -- [-333.546] (-333.273) (-334.868) (-333.572) * (-332.368) [-332.488] (-333.188) (-332.498) -- 0:00:22
631000 -- (-332.882) (-335.078) [-334.974] (-332.486) * [-334.224] (-337.947) (-336.306) (-334.112) -- 0:00:22
631500 -- [-333.393] (-337.840) (-334.491) (-334.181) * [-334.703] (-338.315) (-336.517) (-337.978) -- 0:00:22
632000 -- [-332.445] (-337.178) (-335.320) (-335.292) * [-335.785] (-333.335) (-335.828) (-333.988) -- 0:00:22
632500 -- (-334.319) (-333.198) [-334.184] (-336.219) * (-341.088) (-333.859) [-333.905] (-335.196) -- 0:00:22
633000 -- (-338.074) (-335.034) [-333.977] (-334.268) * [-335.268] (-335.195) (-332.640) (-334.224) -- 0:00:22
633500 -- (-334.254) [-334.723] (-332.570) (-333.833) * [-336.005] (-337.021) (-332.643) (-333.528) -- 0:00:21
634000 -- (-334.524) (-334.808) [-333.234] (-333.532) * (-333.130) (-337.254) (-334.194) [-333.338] -- 0:00:21
634500 -- (-334.143) (-332.916) [-334.139] (-338.945) * (-338.679) (-336.814) (-334.051) [-334.159] -- 0:00:21
635000 -- [-333.644] (-334.154) (-334.027) (-333.624) * (-335.372) (-335.272) [-337.412] (-336.968) -- 0:00:21
Average standard deviation of split frequencies: 0.010726
635500 -- [-333.401] (-334.032) (-338.536) (-334.470) * [-333.578] (-334.900) (-333.526) (-336.679) -- 0:00:21
636000 -- (-336.334) (-333.866) [-337.593] (-335.550) * [-334.358] (-334.429) (-337.100) (-335.588) -- 0:00:21
636500 -- [-334.030] (-333.469) (-335.294) (-335.391) * [-332.494] (-332.167) (-337.343) (-333.887) -- 0:00:21
637000 -- (-339.748) (-336.321) [-333.183] (-335.965) * [-332.365] (-333.593) (-334.742) (-334.501) -- 0:00:21
637500 -- (-334.726) (-344.113) (-333.777) [-333.072] * (-332.741) [-334.298] (-332.490) (-337.110) -- 0:00:21
638000 -- (-335.511) [-334.312] (-335.399) (-332.730) * [-334.102] (-332.550) (-334.892) (-336.872) -- 0:00:21
638500 -- [-333.256] (-337.360) (-333.835) (-333.276) * (-334.184) (-335.476) (-334.733) [-335.192] -- 0:00:21
639000 -- (-334.997) (-334.214) (-334.506) [-333.805] * (-335.050) (-334.424) (-332.769) [-337.431] -- 0:00:21
639500 -- (-336.301) (-335.533) [-335.640] (-333.095) * [-335.204] (-333.660) (-334.941) (-335.449) -- 0:00:21
640000 -- (-335.011) [-337.628] (-336.320) (-333.822) * [-337.285] (-334.253) (-334.254) (-333.104) -- 0:00:21
Average standard deviation of split frequencies: 0.010691
640500 -- [-332.559] (-333.288) (-336.705) (-337.646) * [-335.995] (-333.391) (-334.100) (-335.962) -- 0:00:21
641000 -- (-334.098) [-332.691] (-335.208) (-334.907) * (-337.421) [-333.376] (-335.011) (-338.188) -- 0:00:21
641500 -- [-333.932] (-333.525) (-332.928) (-334.748) * (-335.821) (-334.907) (-333.077) [-333.727] -- 0:00:21
642000 -- [-332.560] (-333.968) (-332.700) (-334.913) * (-335.217) [-334.960] (-332.986) (-334.767) -- 0:00:21
642500 -- (-332.436) (-336.696) [-334.056] (-334.675) * (-333.331) (-338.003) (-332.636) [-333.791] -- 0:00:21
643000 -- (-336.048) [-333.817] (-332.727) (-335.272) * (-334.875) (-336.506) [-339.226] (-334.731) -- 0:00:21
643500 -- (-337.055) (-337.957) (-334.840) [-332.649] * (-336.248) (-334.500) (-339.605) [-333.166] -- 0:00:21
644000 -- (-334.350) (-339.999) (-334.759) [-333.798] * [-333.045] (-332.642) (-336.040) (-335.039) -- 0:00:21
644500 -- (-334.887) (-334.684) [-333.277] (-335.753) * (-342.763) [-333.539] (-334.670) (-332.230) -- 0:00:20
645000 -- [-333.193] (-336.922) (-333.556) (-336.162) * (-336.253) (-337.268) (-337.410) [-332.539] -- 0:00:20
Average standard deviation of split frequencies: 0.010560
645500 -- (-332.634) (-337.515) (-332.811) [-332.768] * (-333.205) (-333.479) (-334.360) [-333.976] -- 0:00:20
646000 -- [-335.111] (-335.824) (-334.564) (-333.642) * (-335.431) (-338.490) (-337.079) [-332.852] -- 0:00:20
646500 -- (-334.775) [-335.918] (-333.586) (-334.177) * (-340.509) (-342.732) [-332.785] (-340.972) -- 0:00:20
647000 -- (-333.455) [-336.521] (-333.758) (-337.549) * (-335.723) (-335.824) (-336.362) [-333.591] -- 0:00:21
647500 -- (-334.330) [-334.520] (-335.231) (-340.880) * [-334.063] (-334.049) (-334.147) (-333.565) -- 0:00:21
648000 -- [-335.408] (-332.533) (-333.967) (-342.452) * [-333.078] (-332.189) (-336.201) (-338.416) -- 0:00:21
648500 -- (-333.560) [-334.925] (-333.464) (-340.664) * [-334.536] (-335.408) (-335.329) (-334.946) -- 0:00:21
649000 -- (-335.786) [-332.558] (-335.296) (-339.722) * (-332.913) (-334.583) [-333.766] (-336.589) -- 0:00:21
649500 -- (-340.785) (-333.063) [-333.936] (-338.754) * (-338.024) (-334.111) (-334.936) [-335.673] -- 0:00:21
650000 -- (-337.612) (-334.112) [-334.206] (-335.827) * (-334.988) (-334.409) [-336.375] (-334.640) -- 0:00:21
Average standard deviation of split frequencies: 0.010143
650500 -- (-333.670) [-337.649] (-337.007) (-333.727) * (-335.020) (-333.574) [-336.499] (-338.939) -- 0:00:20
651000 -- [-333.453] (-336.567) (-333.957) (-334.025) * (-334.052) [-335.769] (-333.686) (-334.311) -- 0:00:20
651500 -- (-334.259) (-333.922) [-333.282] (-333.259) * (-333.257) (-336.271) (-332.406) [-333.180] -- 0:00:20
652000 -- (-338.524) (-333.230) (-333.348) [-333.750] * (-336.010) (-333.320) (-332.827) [-333.610] -- 0:00:20
652500 -- (-336.294) [-335.749] (-338.966) (-334.592) * (-336.494) (-337.835) (-345.956) [-333.386] -- 0:00:20
653000 -- (-333.162) (-335.701) (-335.144) [-333.209] * (-333.685) [-334.371] (-339.406) (-333.244) -- 0:00:20
653500 -- (-333.709) (-336.207) [-333.911] (-335.780) * (-335.247) (-340.705) [-336.004] (-333.687) -- 0:00:20
654000 -- (-333.184) (-334.425) (-334.135) [-335.560] * (-336.410) [-333.911] (-335.339) (-333.717) -- 0:00:20
654500 -- (-335.245) (-336.574) (-337.975) [-334.495] * (-336.228) (-333.630) (-337.240) [-333.735] -- 0:00:20
655000 -- [-333.365] (-334.075) (-333.843) (-335.758) * (-339.029) [-332.492] (-336.769) (-333.617) -- 0:00:20
Average standard deviation of split frequencies: 0.009901
655500 -- (-334.254) (-332.630) (-334.320) [-335.304] * [-333.438] (-332.434) (-337.013) (-335.047) -- 0:00:20
656000 -- (-334.923) (-335.889) [-332.553] (-334.362) * (-333.516) (-332.891) [-334.488] (-332.313) -- 0:00:20
656500 -- (-334.117) [-332.681] (-332.661) (-336.589) * (-335.791) [-336.016] (-332.662) (-333.213) -- 0:00:20
657000 -- [-335.740] (-332.922) (-335.733) (-333.882) * (-335.572) [-335.733] (-338.139) (-334.146) -- 0:00:20
657500 -- (-334.975) (-332.861) (-333.619) [-336.869] * (-333.533) (-336.917) [-333.159] (-338.257) -- 0:00:20
658000 -- [-333.503] (-333.136) (-335.244) (-335.322) * (-333.074) (-334.643) (-333.448) [-334.840] -- 0:00:20
658500 -- (-332.493) (-336.704) (-335.048) [-336.137] * (-335.160) (-334.609) [-334.708] (-339.555) -- 0:00:20
659000 -- (-332.858) [-333.032] (-335.475) (-334.335) * [-336.107] (-335.357) (-332.752) (-336.030) -- 0:00:20
659500 -- (-333.714) [-332.297] (-334.710) (-335.970) * (-336.130) [-335.872] (-334.424) (-335.171) -- 0:00:20
660000 -- (-332.044) [-336.537] (-334.699) (-334.257) * [-335.520] (-338.845) (-335.907) (-333.226) -- 0:00:20
Average standard deviation of split frequencies: 0.010425
660500 -- [-336.621] (-333.647) (-334.346) (-335.234) * [-333.143] (-334.748) (-336.886) (-333.027) -- 0:00:20
661000 -- (-336.541) (-333.939) [-335.775] (-336.571) * [-333.025] (-333.319) (-336.321) (-335.630) -- 0:00:20
661500 -- (-332.146) (-333.498) [-333.831] (-335.380) * [-332.320] (-335.201) (-338.327) (-335.675) -- 0:00:19
662000 -- (-333.789) (-335.457) (-334.239) [-332.948] * [-337.865] (-333.728) (-335.569) (-339.006) -- 0:00:19
662500 -- (-334.789) (-333.574) (-336.243) [-334.835] * [-333.866] (-335.448) (-333.255) (-335.578) -- 0:00:19
663000 -- (-333.926) (-337.534) [-335.237] (-336.901) * (-332.881) [-334.854] (-337.212) (-337.695) -- 0:00:19
663500 -- (-334.734) (-333.541) [-334.987] (-339.029) * (-335.527) (-335.207) (-339.436) [-335.421] -- 0:00:19
664000 -- (-336.306) (-333.136) (-334.284) [-333.865] * [-335.095] (-339.456) (-335.594) (-337.139) -- 0:00:20
664500 -- [-333.100] (-333.490) (-332.510) (-334.907) * (-339.309) (-332.983) (-345.736) [-334.272] -- 0:00:20
665000 -- (-337.229) (-333.118) (-334.409) [-339.231] * (-335.903) (-335.627) [-338.703] (-334.131) -- 0:00:20
Average standard deviation of split frequencies: 0.010106
665500 -- (-334.666) [-332.560] (-336.423) (-332.858) * (-333.710) (-333.319) (-334.539) [-333.728] -- 0:00:20
666000 -- (-336.963) (-336.715) [-335.748] (-335.239) * (-332.911) (-338.297) (-336.426) [-335.389] -- 0:00:20
666500 -- (-338.879) (-335.020) [-332.463] (-338.858) * (-335.255) (-332.665) (-338.702) [-335.978] -- 0:00:20
667000 -- (-335.087) [-335.050] (-333.255) (-332.999) * [-333.872] (-334.545) (-336.203) (-340.078) -- 0:00:19
667500 -- (-333.674) [-335.042] (-335.866) (-335.437) * (-334.533) (-339.391) [-334.152] (-339.660) -- 0:00:19
668000 -- (-333.714) (-335.061) (-334.210) [-333.335] * (-341.455) (-334.909) (-335.727) [-333.706] -- 0:00:19
668500 -- (-334.016) (-337.216) [-336.029] (-338.069) * [-336.219] (-333.270) (-333.044) (-335.966) -- 0:00:19
669000 -- (-334.395) (-336.372) (-335.709) [-335.265] * (-333.487) [-338.737] (-334.369) (-334.154) -- 0:00:19
669500 -- (-333.249) (-336.614) [-333.887] (-332.169) * [-334.992] (-335.837) (-337.512) (-333.757) -- 0:00:19
670000 -- [-333.337] (-334.044) (-333.296) (-333.864) * (-332.810) (-333.012) [-335.615] (-335.183) -- 0:00:19
Average standard deviation of split frequencies: 0.010582
670500 -- (-336.033) [-336.213] (-338.617) (-335.237) * (-332.493) (-334.095) (-335.765) [-334.364] -- 0:00:19
671000 -- (-333.596) (-337.560) [-334.711] (-336.345) * (-333.690) [-334.040] (-339.794) (-332.202) -- 0:00:19
671500 -- (-332.735) [-333.821] (-339.333) (-334.115) * [-333.442] (-333.274) (-332.379) (-334.124) -- 0:00:19
672000 -- [-333.839] (-336.159) (-336.969) (-333.738) * (-334.718) [-332.684] (-335.185) (-333.347) -- 0:00:19
672500 -- (-333.425) [-335.720] (-332.460) (-335.280) * (-334.089) (-332.935) (-337.385) [-335.458] -- 0:00:19
673000 -- (-335.533) (-335.560) (-334.260) [-337.864] * [-335.237] (-332.257) (-333.842) (-333.212) -- 0:00:19
673500 -- (-339.514) [-332.751] (-334.236) (-338.084) * [-334.793] (-335.071) (-333.572) (-333.977) -- 0:00:19
674000 -- (-334.190) (-332.847) [-333.569] (-333.537) * [-335.932] (-333.890) (-334.470) (-333.993) -- 0:00:19
674500 -- (-335.270) [-334.596] (-336.489) (-334.034) * (-332.729) (-332.918) (-336.577) [-336.578] -- 0:00:19
675000 -- [-334.292] (-338.302) (-335.197) (-334.860) * (-337.150) (-336.859) (-336.737) [-333.564] -- 0:00:19
Average standard deviation of split frequencies: 0.010538
675500 -- [-335.260] (-336.433) (-333.001) (-334.380) * (-334.087) (-332.988) (-336.239) [-336.043] -- 0:00:19
676000 -- (-335.337) (-334.798) [-333.604] (-333.870) * (-333.455) (-334.674) [-333.320] (-334.697) -- 0:00:19
676500 -- (-334.917) (-333.742) (-333.345) [-333.071] * (-333.968) (-335.055) [-335.193] (-333.541) -- 0:00:19
677000 -- (-332.847) (-333.854) (-334.744) [-336.569] * (-334.518) [-334.962] (-335.124) (-335.445) -- 0:00:19
677500 -- (-333.742) [-335.284] (-332.686) (-333.482) * (-333.307) (-332.151) [-336.518] (-337.716) -- 0:00:19
678000 -- (-334.926) [-333.611] (-332.852) (-333.631) * [-333.805] (-332.505) (-333.896) (-333.645) -- 0:00:18
678500 -- (-333.657) (-336.604) [-332.704] (-336.244) * (-333.662) (-334.830) [-334.582] (-336.640) -- 0:00:18
679000 -- [-333.370] (-334.533) (-333.180) (-334.291) * (-334.776) [-336.903] (-336.121) (-335.185) -- 0:00:18
679500 -- (-333.031) [-332.723] (-335.833) (-334.066) * (-336.482) (-332.396) (-335.361) [-333.913] -- 0:00:18
680000 -- (-339.370) [-334.047] (-334.819) (-334.266) * (-334.696) (-333.145) [-333.508] (-334.488) -- 0:00:18
Average standard deviation of split frequencies: 0.011285
680500 -- (-333.926) [-336.233] (-335.096) (-337.070) * (-335.590) (-333.733) (-333.073) [-333.456] -- 0:00:18
681000 -- (-335.231) (-335.752) [-333.672] (-336.568) * (-337.914) (-335.085) (-336.978) [-333.103] -- 0:00:18
681500 -- (-334.439) (-334.984) [-334.178] (-336.272) * (-336.273) (-334.163) [-333.862] (-334.291) -- 0:00:19
682000 -- [-335.491] (-334.606) (-332.908) (-336.018) * (-338.767) (-333.807) [-336.996] (-334.352) -- 0:00:19
682500 -- (-334.810) [-335.918] (-333.871) (-335.029) * [-334.654] (-335.426) (-335.207) (-332.874) -- 0:00:19
683000 -- (-335.210) (-336.395) (-335.050) [-337.467] * (-334.603) (-336.906) [-333.041] (-336.108) -- 0:00:19
683500 -- (-333.363) [-334.669] (-333.069) (-336.685) * [-334.684] (-333.388) (-332.160) (-336.054) -- 0:00:18
684000 -- (-334.137) (-334.007) (-332.327) [-334.356] * (-334.092) (-335.749) [-334.091] (-336.542) -- 0:00:18
684500 -- [-334.470] (-332.869) (-332.763) (-339.271) * (-337.270) (-337.665) [-333.001] (-332.202) -- 0:00:18
685000 -- (-334.312) [-332.614] (-333.055) (-337.416) * (-334.181) [-334.940] (-336.541) (-332.936) -- 0:00:18
Average standard deviation of split frequencies: 0.010613
685500 -- (-332.858) (-334.139) [-333.182] (-333.906) * (-335.041) (-334.468) [-332.190] (-333.487) -- 0:00:18
686000 -- (-337.331) (-339.515) (-332.534) [-332.139] * (-332.740) [-332.824] (-333.575) (-337.319) -- 0:00:18
686500 -- (-332.532) (-337.239) (-334.151) [-334.171] * (-336.270) (-335.245) [-334.058] (-335.724) -- 0:00:18
687000 -- (-334.307) (-336.813) (-332.206) [-333.658] * (-338.500) (-332.919) (-338.692) [-333.013] -- 0:00:18
687500 -- (-337.610) [-333.578] (-337.952) (-334.697) * (-336.005) [-335.386] (-336.612) (-334.663) -- 0:00:18
688000 -- [-334.567] (-337.225) (-337.346) (-332.305) * (-333.897) [-332.401] (-335.250) (-333.433) -- 0:00:18
688500 -- [-334.348] (-336.382) (-337.999) (-332.792) * [-334.971] (-332.840) (-334.269) (-334.579) -- 0:00:18
689000 -- [-334.998] (-338.583) (-334.299) (-337.758) * (-333.379) (-335.074) (-336.609) [-337.568] -- 0:00:18
689500 -- (-335.759) (-333.239) [-336.750] (-335.276) * (-341.760) (-333.541) (-333.511) [-333.673] -- 0:00:18
690000 -- (-333.565) (-335.881) [-332.921] (-335.652) * (-333.233) (-335.963) [-333.743] (-333.409) -- 0:00:18
Average standard deviation of split frequencies: 0.010617
690500 -- (-337.028) (-337.900) [-333.603] (-333.334) * (-337.941) (-333.016) [-333.874] (-336.660) -- 0:00:18
691000 -- (-337.657) (-334.581) (-337.049) [-334.486] * (-337.545) (-335.340) (-334.388) [-335.718] -- 0:00:18
691500 -- (-335.627) (-335.984) [-333.010] (-333.520) * (-340.149) (-336.435) (-336.286) [-334.734] -- 0:00:18
692000 -- (-333.700) [-333.779] (-335.160) (-332.865) * (-334.727) [-336.467] (-333.865) (-337.633) -- 0:00:18
692500 -- (-332.850) (-333.398) (-334.244) [-332.870] * (-334.219) (-334.456) [-333.979] (-334.237) -- 0:00:18
693000 -- (-334.377) (-332.998) (-335.293) [-333.325] * (-335.637) (-334.561) (-334.423) [-334.639] -- 0:00:18
693500 -- (-333.931) (-332.190) [-333.344] (-333.624) * [-335.303] (-334.076) (-333.160) (-335.423) -- 0:00:18
694000 -- (-339.747) [-334.647] (-332.015) (-335.384) * [-333.606] (-333.801) (-335.336) (-333.027) -- 0:00:18
694500 -- (-332.207) (-334.819) [-336.662] (-333.662) * [-335.786] (-337.024) (-334.794) (-332.512) -- 0:00:18
695000 -- (-332.207) (-334.191) [-334.327] (-333.051) * (-335.092) [-334.588] (-333.823) (-333.046) -- 0:00:17
Average standard deviation of split frequencies: 0.010239
695500 -- (-336.190) (-335.849) (-337.703) [-332.420] * (-336.859) (-337.132) [-332.581] (-333.441) -- 0:00:17
696000 -- (-332.595) [-333.646] (-332.808) (-334.107) * [-334.797] (-336.502) (-336.537) (-334.315) -- 0:00:17
696500 -- (-332.261) (-332.638) [-337.855] (-333.845) * (-334.865) (-334.346) [-335.108] (-333.280) -- 0:00:17
697000 -- (-333.977) [-335.104] (-336.182) (-335.992) * (-335.214) (-332.927) [-337.138] (-333.222) -- 0:00:17
697500 -- (-337.903) (-333.506) (-336.693) [-333.982] * (-334.447) [-334.554] (-334.781) (-337.874) -- 0:00:17
698000 -- [-334.085] (-333.432) (-333.036) (-332.670) * (-338.762) (-337.948) (-332.417) [-333.949] -- 0:00:17
698500 -- (-332.894) [-333.429] (-334.875) (-335.399) * (-334.269) [-336.806] (-333.122) (-341.932) -- 0:00:18
699000 -- (-333.726) [-336.970] (-338.516) (-336.445) * (-338.482) (-337.230) (-334.499) [-335.704] -- 0:00:18
699500 -- (-332.767) (-333.500) (-334.491) [-332.681] * (-334.280) (-334.402) [-333.687] (-334.829) -- 0:00:18
700000 -- (-333.462) (-333.231) [-333.428] (-332.270) * (-334.036) (-333.559) (-333.088) [-333.782] -- 0:00:18
Average standard deviation of split frequencies: 0.010171
700500 -- (-332.531) (-333.497) (-334.239) [-332.870] * (-333.240) [-333.522] (-332.429) (-339.144) -- 0:00:17
701000 -- (-337.528) [-334.543] (-335.800) (-332.359) * [-333.634] (-332.876) (-332.230) (-333.806) -- 0:00:17
701500 -- [-332.714] (-336.954) (-340.662) (-334.474) * (-334.489) [-333.003] (-334.225) (-337.156) -- 0:00:17
702000 -- (-337.077) (-335.142) (-333.078) [-334.211] * [-333.382] (-333.447) (-333.749) (-336.741) -- 0:00:17
702500 -- (-340.697) (-334.559) (-332.586) [-336.109] * [-333.792] (-334.393) (-336.952) (-333.649) -- 0:00:17
703000 -- [-340.547] (-334.313) (-333.138) (-336.322) * [-334.925] (-333.862) (-334.104) (-333.991) -- 0:00:17
703500 -- (-338.652) [-333.463] (-337.688) (-333.300) * (-333.632) [-332.085] (-333.175) (-336.705) -- 0:00:17
704000 -- [-334.746] (-334.215) (-333.333) (-333.995) * [-332.966] (-332.313) (-337.256) (-333.702) -- 0:00:17
704500 -- (-334.333) (-337.479) (-333.510) [-333.636] * (-333.756) (-332.626) (-335.251) [-334.069] -- 0:00:17
705000 -- (-336.179) (-333.834) (-336.367) [-334.021] * [-334.161] (-333.102) (-333.934) (-334.322) -- 0:00:17
Average standard deviation of split frequencies: 0.010605
705500 -- (-336.639) [-335.404] (-336.149) (-335.452) * (-334.638) (-332.697) [-332.896] (-334.570) -- 0:00:17
706000 -- (-334.769) (-332.451) [-332.914] (-333.873) * (-338.490) (-332.902) [-334.299] (-332.697) -- 0:00:17
706500 -- (-335.074) (-334.497) [-333.135] (-333.383) * (-333.024) (-332.362) [-334.654] (-336.265) -- 0:00:17
707000 -- (-333.494) (-333.215) (-333.356) [-339.406] * (-333.321) (-333.560) (-337.466) [-333.897] -- 0:00:17
707500 -- [-333.538] (-333.357) (-334.752) (-333.504) * [-333.733] (-333.843) (-333.720) (-336.229) -- 0:00:17
708000 -- (-333.961) (-333.715) (-334.483) [-332.770] * (-333.050) (-336.178) (-334.571) [-335.197] -- 0:00:17
708500 -- (-334.006) (-335.475) [-335.450] (-332.308) * [-334.482] (-333.502) (-334.770) (-334.092) -- 0:00:17
709000 -- (-332.601) (-334.129) (-338.073) [-332.491] * (-335.418) (-334.574) (-333.575) [-334.701] -- 0:00:17
709500 -- [-335.588] (-335.317) (-335.478) (-337.399) * (-333.789) (-334.382) [-333.739] (-337.755) -- 0:00:17
710000 -- (-332.719) [-335.926] (-335.518) (-335.385) * (-336.736) (-333.628) [-334.623] (-341.217) -- 0:00:17
Average standard deviation of split frequencies: 0.010418
710500 -- (-332.115) (-334.441) (-339.145) [-332.569] * (-332.891) (-335.380) (-335.122) [-339.308] -- 0:00:17
711000 -- [-332.911] (-335.588) (-333.808) (-333.010) * [-337.604] (-337.332) (-333.497) (-334.396) -- 0:00:17
711500 -- [-333.179] (-333.466) (-334.324) (-332.928) * (-338.440) [-332.492] (-333.375) (-332.268) -- 0:00:17
712000 -- [-332.737] (-334.889) (-333.443) (-335.948) * [-335.067] (-332.604) (-333.919) (-334.796) -- 0:00:16
712500 -- (-332.096) [-334.840] (-334.906) (-339.081) * [-334.319] (-334.698) (-334.499) (-332.663) -- 0:00:16
713000 -- (-334.370) [-337.032] (-332.781) (-332.974) * (-332.996) (-333.641) (-332.537) [-333.645] -- 0:00:16
713500 -- (-333.930) [-336.910] (-333.031) (-333.854) * (-336.655) (-332.962) [-336.335] (-332.975) -- 0:00:16
714000 -- (-334.224) (-335.398) [-339.057] (-333.372) * [-339.471] (-332.605) (-338.422) (-332.646) -- 0:00:16
714500 -- (-333.749) [-338.639] (-339.202) (-336.339) * [-337.294] (-332.968) (-333.794) (-333.172) -- 0:00:16
715000 -- (-334.569) (-336.955) [-335.663] (-334.886) * (-334.763) [-333.410] (-333.916) (-338.104) -- 0:00:17
Average standard deviation of split frequencies: 0.010147
715500 -- [-334.193] (-337.792) (-332.626) (-334.111) * (-336.103) [-335.146] (-332.917) (-332.832) -- 0:00:17
716000 -- [-333.073] (-337.071) (-333.141) (-332.902) * (-335.682) (-335.711) (-335.090) [-333.154] -- 0:00:17
716500 -- (-333.709) (-335.602) (-334.190) [-333.994] * (-335.245) (-335.608) [-333.348] (-333.735) -- 0:00:17
717000 -- (-335.050) (-336.045) (-336.164) [-337.584] * [-334.991] (-333.469) (-337.541) (-332.657) -- 0:00:16
717500 -- (-336.817) (-336.179) [-334.770] (-334.843) * [-332.213] (-335.761) (-333.835) (-333.634) -- 0:00:16
718000 -- (-335.180) (-333.849) (-333.899) [-333.335] * [-335.648] (-334.156) (-333.907) (-338.994) -- 0:00:16
718500 -- [-333.752] (-334.474) (-335.362) (-335.558) * (-334.191) [-333.722] (-332.486) (-337.531) -- 0:00:16
719000 -- [-334.857] (-332.937) (-336.611) (-333.576) * (-335.382) (-336.329) (-333.694) [-332.691] -- 0:00:16
719500 -- (-334.401) [-336.014] (-333.274) (-333.734) * (-334.785) (-334.846) [-334.730] (-333.182) -- 0:00:16
720000 -- [-334.205] (-334.284) (-334.698) (-340.520) * [-333.632] (-334.002) (-334.581) (-335.507) -- 0:00:16
Average standard deviation of split frequencies: 0.010262
720500 -- [-334.029] (-335.317) (-334.849) (-335.492) * (-332.969) (-335.436) [-333.423] (-334.616) -- 0:00:16
721000 -- (-333.899) [-335.254] (-336.978) (-335.023) * [-334.071] (-333.072) (-333.241) (-335.740) -- 0:00:16
721500 -- [-334.417] (-332.471) (-332.967) (-333.023) * [-333.444] (-335.608) (-337.530) (-334.663) -- 0:00:16
722000 -- (-336.376) (-333.421) (-337.275) [-336.186] * (-334.645) (-338.419) [-335.443] (-340.113) -- 0:00:16
722500 -- (-335.708) (-333.454) (-332.755) [-335.690] * [-333.857] (-338.303) (-334.236) (-335.454) -- 0:00:16
723000 -- (-332.775) (-336.394) [-334.450] (-334.274) * (-335.161) [-333.730] (-336.083) (-335.430) -- 0:00:16
723500 -- [-333.345] (-335.988) (-333.303) (-332.897) * [-333.282] (-334.287) (-335.541) (-335.262) -- 0:00:16
724000 -- (-333.787) [-338.473] (-335.170) (-332.994) * (-333.414) [-335.849] (-333.444) (-340.758) -- 0:00:16
724500 -- (-335.008) [-334.644] (-335.885) (-333.538) * (-335.084) [-333.705] (-334.055) (-340.873) -- 0:00:16
725000 -- [-337.891] (-333.403) (-333.916) (-333.655) * (-334.150) (-335.147) (-337.651) [-332.951] -- 0:00:16
Average standard deviation of split frequencies: 0.010186
725500 -- (-336.430) (-333.765) [-333.104] (-334.270) * (-334.758) (-336.802) (-340.318) [-334.255] -- 0:00:16
726000 -- (-336.917) (-334.452) (-333.174) [-332.885] * [-332.255] (-332.534) (-336.285) (-332.778) -- 0:00:16
726500 -- [-332.167] (-334.889) (-334.953) (-332.226) * [-333.836] (-333.077) (-336.247) (-332.729) -- 0:00:16
727000 -- [-334.664] (-334.754) (-333.927) (-332.325) * [-335.214] (-336.875) (-337.422) (-333.175) -- 0:00:16
727500 -- (-335.612) (-334.375) [-334.026] (-333.659) * [-332.439] (-336.891) (-332.680) (-332.727) -- 0:00:16
728000 -- (-341.994) (-333.586) (-333.748) [-333.110] * (-334.592) (-337.520) (-334.108) [-336.203] -- 0:00:16
728500 -- (-335.765) (-332.734) (-333.691) [-332.983] * [-334.456] (-334.167) (-334.221) (-335.950) -- 0:00:16
729000 -- [-335.526] (-334.640) (-338.664) (-333.719) * [-333.023] (-339.662) (-334.522) (-334.598) -- 0:00:15
729500 -- (-332.545) (-334.227) [-334.252] (-333.494) * [-335.019] (-337.673) (-338.516) (-334.833) -- 0:00:15
730000 -- [-333.747] (-334.173) (-333.995) (-337.317) * (-334.341) (-339.971) (-333.416) [-334.070] -- 0:00:15
Average standard deviation of split frequencies: 0.010403
730500 -- [-332.918] (-334.503) (-338.309) (-335.803) * (-334.055) (-338.727) [-333.050] (-334.425) -- 0:00:15
731000 -- (-333.601) (-335.842) (-335.733) [-332.532] * (-333.706) (-333.249) [-335.177] (-333.293) -- 0:00:15
731500 -- (-334.005) (-338.519) (-333.980) [-337.118] * (-335.553) [-334.274] (-335.732) (-333.294) -- 0:00:15
732000 -- (-338.132) (-338.641) [-333.379] (-336.924) * (-335.333) (-334.258) [-333.838] (-334.009) -- 0:00:16
732500 -- (-333.775) (-336.873) (-332.638) [-336.055] * [-336.897] (-338.285) (-334.015) (-332.835) -- 0:00:16
733000 -- (-333.709) [-333.131] (-333.317) (-334.609) * [-333.154] (-335.922) (-332.831) (-332.461) -- 0:00:16
733500 -- (-333.734) (-333.738) [-332.201] (-333.402) * [-334.166] (-333.334) (-337.553) (-333.803) -- 0:00:15
734000 -- (-334.410) (-336.937) (-333.587) [-333.738] * (-332.843) (-333.219) (-340.987) [-332.813] -- 0:00:15
734500 -- (-335.991) [-335.859] (-334.277) (-333.169) * (-336.362) (-334.009) (-333.547) [-332.856] -- 0:00:15
735000 -- (-336.905) [-334.984] (-333.343) (-335.236) * [-335.604] (-334.755) (-335.625) (-337.972) -- 0:00:15
Average standard deviation of split frequencies: 0.010568
735500 -- [-332.798] (-334.049) (-332.148) (-334.312) * (-333.688) [-334.419] (-339.043) (-333.862) -- 0:00:15
736000 -- (-335.601) [-333.557] (-335.095) (-335.345) * (-334.645) (-333.731) (-336.243) [-332.794] -- 0:00:15
736500 -- (-334.916) [-339.578] (-337.034) (-333.956) * (-338.264) (-332.806) (-332.962) [-332.632] -- 0:00:15
737000 -- [-336.273] (-335.341) (-333.907) (-333.934) * (-333.731) (-335.250) [-335.000] (-335.331) -- 0:00:15
737500 -- (-333.761) (-335.443) [-339.989] (-335.440) * (-333.121) (-335.031) [-332.500] (-334.842) -- 0:00:15
738000 -- [-333.684] (-333.307) (-335.312) (-333.005) * [-336.045] (-338.090) (-333.187) (-336.688) -- 0:00:15
738500 -- (-333.110) (-336.875) [-334.665] (-335.424) * (-332.994) (-338.883) [-335.809] (-334.475) -- 0:00:15
739000 -- (-333.234) (-334.018) [-335.604] (-333.630) * (-334.080) (-337.803) [-333.903] (-332.760) -- 0:00:15
739500 -- (-337.279) [-332.809] (-334.465) (-332.830) * (-334.011) (-335.227) [-335.993] (-334.385) -- 0:00:15
740000 -- (-339.272) (-334.168) [-333.982] (-333.773) * (-335.330) (-334.961) (-334.192) [-333.290] -- 0:00:15
Average standard deviation of split frequencies: 0.011138
740500 -- (-336.921) [-333.485] (-333.316) (-335.119) * (-333.290) (-333.432) [-338.176] (-335.386) -- 0:00:15
741000 -- (-333.782) (-334.302) [-332.603] (-335.210) * [-334.273] (-335.091) (-334.381) (-333.897) -- 0:00:15
741500 -- (-337.646) (-338.128) (-335.723) [-332.154] * (-333.877) (-333.707) (-333.922) [-333.214] -- 0:00:15
742000 -- (-333.853) (-333.318) (-334.584) [-335.660] * [-333.996] (-338.719) (-333.200) (-336.295) -- 0:00:15
742500 -- [-333.802] (-333.993) (-338.455) (-339.954) * [-333.159] (-334.774) (-333.181) (-339.668) -- 0:00:15
743000 -- (-334.616) [-336.678] (-334.129) (-339.067) * (-332.925) [-337.514] (-334.202) (-339.033) -- 0:00:15
743500 -- [-333.504] (-334.268) (-333.152) (-334.326) * [-332.634] (-333.269) (-335.605) (-333.867) -- 0:00:15
744000 -- (-334.069) (-335.143) (-333.813) [-335.959] * [-335.056] (-334.248) (-332.265) (-335.317) -- 0:00:15
744500 -- (-333.012) (-336.754) (-336.009) [-336.306] * (-333.418) [-335.690] (-336.431) (-332.304) -- 0:00:15
745000 -- (-334.067) (-336.271) [-333.266] (-333.103) * (-332.527) (-337.230) (-332.935) [-332.172] -- 0:00:15
Average standard deviation of split frequencies: 0.011189
745500 -- (-335.374) [-334.773] (-333.496) (-335.058) * [-336.245] (-336.048) (-334.601) (-333.213) -- 0:00:15
746000 -- (-336.901) (-338.168) (-334.567) [-334.800] * [-333.442] (-333.673) (-336.489) (-336.900) -- 0:00:14
746500 -- (-332.943) (-335.476) (-336.048) [-335.533] * (-334.698) (-335.501) (-337.857) [-334.414] -- 0:00:14
747000 -- [-334.109] (-336.426) (-335.192) (-338.039) * (-333.787) (-336.533) [-340.080] (-336.954) -- 0:00:14
747500 -- [-333.831] (-334.985) (-332.497) (-340.134) * (-335.321) [-334.107] (-335.070) (-335.725) -- 0:00:14
748000 -- (-333.877) [-335.389] (-332.711) (-337.375) * (-334.779) [-335.682] (-333.882) (-333.107) -- 0:00:14
748500 -- (-333.187) (-334.533) [-334.187] (-334.785) * [-333.158] (-336.068) (-332.596) (-332.372) -- 0:00:15
749000 -- (-339.603) [-333.824] (-335.667) (-336.765) * (-335.620) [-333.390] (-332.578) (-333.529) -- 0:00:15
749500 -- [-333.391] (-332.842) (-335.526) (-334.952) * (-336.133) (-335.420) [-334.845] (-333.426) -- 0:00:15
750000 -- [-332.843] (-338.583) (-335.728) (-334.944) * (-337.197) (-334.492) (-334.897) [-334.306] -- 0:00:15
Average standard deviation of split frequencies: 0.010519
750500 -- (-332.916) (-333.222) [-336.224] (-333.774) * [-333.104] (-333.134) (-335.969) (-334.292) -- 0:00:14
751000 -- (-333.978) (-336.351) [-339.567] (-334.749) * (-333.653) (-334.526) [-336.369] (-333.979) -- 0:00:14
751500 -- (-334.420) (-334.435) (-338.224) [-336.089] * (-334.212) [-334.515] (-334.279) (-333.286) -- 0:00:14
752000 -- [-335.623] (-333.802) (-336.289) (-335.581) * (-338.035) (-336.740) [-332.756] (-334.181) -- 0:00:14
752500 -- (-336.970) [-335.468] (-336.443) (-333.091) * (-338.720) [-333.913] (-333.334) (-333.443) -- 0:00:14
753000 -- [-334.701] (-334.590) (-333.259) (-336.178) * (-333.007) (-334.404) (-334.158) [-332.924] -- 0:00:14
753500 -- (-333.286) (-333.859) (-333.574) [-333.890] * [-333.005] (-333.760) (-335.051) (-336.962) -- 0:00:14
754000 -- [-333.683] (-333.796) (-334.064) (-332.618) * (-333.152) (-336.101) (-339.282) [-337.431] -- 0:00:14
754500 -- (-333.462) (-336.854) (-340.164) [-334.369] * (-335.342) (-335.527) [-334.825] (-335.649) -- 0:00:14
755000 -- (-335.892) [-336.244] (-339.726) (-334.387) * [-333.482] (-337.618) (-334.838) (-338.195) -- 0:00:14
Average standard deviation of split frequencies: 0.010600
755500 -- [-334.718] (-333.136) (-339.375) (-334.778) * [-333.036] (-336.682) (-333.989) (-339.703) -- 0:00:14
756000 -- (-335.980) (-334.365) [-336.610] (-334.460) * (-333.457) (-336.336) [-333.649] (-335.117) -- 0:00:14
756500 -- (-334.847) (-333.853) [-333.463] (-335.004) * (-339.118) (-336.601) [-332.929] (-335.142) -- 0:00:14
757000 -- (-334.913) (-336.734) [-333.077] (-335.064) * (-332.752) (-335.237) [-335.459] (-332.777) -- 0:00:14
757500 -- (-332.970) (-336.824) (-334.654) [-332.907] * (-334.046) (-333.565) (-333.286) [-332.704] -- 0:00:14
758000 -- (-335.100) [-333.648] (-336.696) (-332.420) * (-334.772) (-333.776) (-341.321) [-332.768] -- 0:00:14
758500 -- (-334.382) [-340.500] (-332.906) (-334.801) * [-335.384] (-333.545) (-340.260) (-333.546) -- 0:00:14
759000 -- [-334.654] (-334.529) (-333.875) (-334.118) * (-334.724) [-332.694] (-338.348) (-333.332) -- 0:00:14
759500 -- (-336.493) (-335.281) (-332.766) [-334.381] * (-334.798) (-334.419) [-333.222] (-332.701) -- 0:00:14
760000 -- (-334.900) (-334.496) [-333.001] (-334.798) * [-333.845] (-336.990) (-333.077) (-333.701) -- 0:00:14
Average standard deviation of split frequencies: 0.011000
760500 -- (-336.449) (-333.587) (-332.760) [-333.971] * (-341.471) (-333.244) (-335.680) [-334.314] -- 0:00:14
761000 -- [-333.999] (-335.722) (-335.442) (-341.015) * (-339.046) [-333.366] (-336.225) (-335.600) -- 0:00:14
761500 -- (-333.309) [-334.097] (-334.686) (-336.042) * (-334.960) (-337.213) (-333.011) [-337.367] -- 0:00:14
762000 -- [-333.846] (-333.269) (-336.079) (-334.467) * (-334.410) (-333.758) (-334.514) [-334.380] -- 0:00:14
762500 -- (-334.938) (-333.743) [-335.723] (-333.595) * (-332.005) (-333.140) [-339.610] (-336.898) -- 0:00:14
763000 -- (-333.140) [-334.352] (-337.249) (-339.650) * (-332.398) (-332.587) (-337.686) [-332.213] -- 0:00:13
763500 -- [-334.641] (-333.584) (-333.178) (-334.997) * [-332.658] (-332.569) (-336.906) (-335.489) -- 0:00:13
764000 -- (-333.606) (-335.936) [-334.940] (-336.228) * (-336.842) (-333.866) (-337.785) [-333.881] -- 0:00:13
764500 -- [-333.618] (-336.269) (-337.117) (-338.039) * (-335.716) (-336.029) [-337.892] (-337.380) -- 0:00:13
765000 -- (-339.251) [-333.500] (-338.632) (-334.203) * (-332.627) [-332.954] (-336.886) (-336.569) -- 0:00:13
Average standard deviation of split frequencies: 0.010607
765500 -- [-332.598] (-332.938) (-332.688) (-333.525) * (-336.821) (-332.957) [-334.301] (-334.152) -- 0:00:14
766000 -- (-340.004) (-333.655) [-334.776] (-335.485) * [-334.024] (-338.228) (-334.186) (-333.720) -- 0:00:14
766500 -- (-334.663) (-336.627) [-332.363] (-334.711) * [-333.512] (-333.672) (-332.594) (-338.119) -- 0:00:14
767000 -- (-337.139) (-335.827) (-332.890) [-334.090] * (-335.613) (-335.992) (-332.937) [-333.475] -- 0:00:13
767500 -- (-336.343) [-332.470] (-334.571) (-337.914) * (-336.288) (-336.078) [-333.588] (-335.096) -- 0:00:13
768000 -- (-339.921) [-333.216] (-338.256) (-334.232) * (-334.699) (-333.086) (-334.299) [-335.734] -- 0:00:13
768500 -- [-334.361] (-333.848) (-335.774) (-334.512) * (-332.449) [-333.452] (-333.834) (-335.791) -- 0:00:13
769000 -- (-336.697) (-335.929) (-337.926) [-335.324] * (-332.969) [-333.476] (-333.251) (-333.493) -- 0:00:13
769500 -- (-335.883) (-332.907) [-337.506] (-334.627) * [-333.335] (-333.760) (-333.880) (-334.464) -- 0:00:13
770000 -- (-335.476) [-333.117] (-333.959) (-337.234) * (-335.376) (-335.217) [-334.085] (-336.446) -- 0:00:13
Average standard deviation of split frequencies: 0.010147
770500 -- [-332.605] (-334.425) (-333.791) (-333.771) * [-333.340] (-334.932) (-333.029) (-334.012) -- 0:00:13
771000 -- (-332.603) [-333.447] (-334.723) (-334.453) * (-337.319) (-333.234) [-332.634] (-334.572) -- 0:00:13
771500 -- (-337.318) [-333.386] (-338.871) (-333.334) * [-334.955] (-333.473) (-333.196) (-332.770) -- 0:00:13
772000 -- [-332.701] (-332.665) (-337.403) (-335.003) * (-333.925) (-338.310) [-335.539] (-335.345) -- 0:00:13
772500 -- [-332.518] (-332.501) (-334.936) (-335.697) * (-333.582) [-335.305] (-335.705) (-334.938) -- 0:00:13
773000 -- [-333.178] (-334.525) (-334.188) (-336.809) * (-334.145) (-332.576) [-332.930] (-332.683) -- 0:00:13
773500 -- (-333.240) (-332.925) [-334.422] (-335.830) * [-334.135] (-333.858) (-333.103) (-333.614) -- 0:00:13
774000 -- (-333.832) (-334.009) (-336.907) [-335.442] * (-334.535) (-335.323) [-333.508] (-333.890) -- 0:00:13
774500 -- (-335.072) (-333.135) [-332.809] (-344.596) * (-338.234) (-341.367) [-334.702] (-332.584) -- 0:00:13
775000 -- (-333.805) [-333.243] (-334.480) (-339.010) * (-336.562) (-334.919) (-334.983) [-335.958] -- 0:00:13
Average standard deviation of split frequencies: 0.010327
775500 -- (-335.362) (-333.139) (-336.269) [-335.165] * (-335.065) [-333.916] (-335.079) (-332.257) -- 0:00:13
776000 -- (-333.366) (-335.446) [-336.558] (-335.139) * (-334.571) (-333.408) (-336.021) [-334.587] -- 0:00:13
776500 -- [-334.502] (-334.053) (-333.514) (-334.368) * (-335.476) (-337.037) [-337.850] (-335.304) -- 0:00:13
777000 -- [-334.994] (-335.994) (-335.213) (-334.177) * [-333.560] (-336.055) (-334.956) (-335.255) -- 0:00:13
777500 -- [-333.675] (-334.624) (-333.252) (-333.987) * (-334.290) [-333.395] (-334.735) (-333.196) -- 0:00:13
778000 -- (-333.870) (-334.767) (-334.494) [-332.770] * (-337.623) [-332.531] (-335.470) (-333.631) -- 0:00:13
778500 -- (-333.540) [-332.824] (-333.123) (-334.073) * (-338.812) [-334.804] (-335.700) (-333.215) -- 0:00:13
779000 -- (-336.095) (-337.059) (-335.647) [-333.820] * [-335.289] (-337.189) (-335.727) (-334.016) -- 0:00:13
779500 -- [-340.404] (-337.997) (-333.931) (-334.406) * (-337.677) (-335.480) (-334.842) [-332.501] -- 0:00:13
780000 -- (-332.817) [-340.860] (-333.574) (-333.659) * (-333.499) [-333.350] (-333.593) (-333.876) -- 0:00:12
Average standard deviation of split frequencies: 0.009742
780500 -- (-332.974) (-338.610) [-335.493] (-334.587) * (-332.865) (-333.178) [-334.189] (-333.295) -- 0:00:12
781000 -- (-332.860) (-337.757) (-336.446) [-333.737] * (-336.293) (-335.434) [-334.212] (-333.094) -- 0:00:12
781500 -- [-333.184] (-334.882) (-337.010) (-333.220) * (-334.723) (-334.085) (-334.485) [-332.566] -- 0:00:12
782000 -- [-332.667] (-337.646) (-335.778) (-334.767) * [-333.897] (-334.119) (-335.582) (-333.005) -- 0:00:12
782500 -- (-333.917) (-336.509) [-333.755] (-333.778) * (-334.243) [-333.031] (-337.988) (-334.429) -- 0:00:13
783000 -- (-332.938) [-332.914] (-337.442) (-337.819) * (-334.563) (-334.294) (-333.424) [-334.121] -- 0:00:13
783500 -- [-335.578] (-334.064) (-335.664) (-333.975) * (-335.288) (-336.417) (-332.535) [-336.557] -- 0:00:12
784000 -- [-335.344] (-332.969) (-332.379) (-337.076) * (-333.202) [-337.582] (-335.621) (-332.959) -- 0:00:12
784500 -- (-334.955) (-334.952) (-332.501) [-335.529] * (-333.145) (-337.216) [-334.681] (-337.960) -- 0:00:12
785000 -- (-335.612) (-336.647) [-334.730] (-335.109) * (-335.077) [-334.176] (-333.037) (-334.686) -- 0:00:12
Average standard deviation of split frequencies: 0.010271
785500 -- (-334.745) (-339.315) (-337.952) [-332.953] * (-334.430) [-332.870] (-333.473) (-338.130) -- 0:00:12
786000 -- [-335.593] (-335.910) (-337.128) (-334.966) * [-336.660] (-333.662) (-336.794) (-335.032) -- 0:00:12
786500 -- (-334.510) [-333.093] (-337.408) 