--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:58:19 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/bcp/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -668.17 -671.14
2 -668.18 -670.90
--------------------------------------
TOTAL -668.17 -671.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893921 0.088972 0.322268 1.459693 0.864591 1290.23 1325.50 1.000
r(A<->C){all} 0.160751 0.019036 0.000179 0.439043 0.123153 222.54 239.57 1.000
r(A<->G){all} 0.174784 0.020772 0.000037 0.464746 0.138812 208.87 257.17 1.001
r(A<->T){all} 0.159280 0.019376 0.000122 0.452633 0.121841 178.73 219.46 1.001
r(C<->G){all} 0.162248 0.019311 0.000031 0.443438 0.128908 259.43 299.70 1.000
r(C<->T){all} 0.172383 0.022011 0.000116 0.465211 0.130904 338.73 369.23 1.001
r(G<->T){all} 0.170554 0.021483 0.000009 0.469751 0.130808 150.73 230.85 1.001
pi(A){all} 0.221675 0.000356 0.187121 0.260398 0.221973 1313.31 1319.56 1.001
pi(C){all} 0.280740 0.000406 0.241271 0.319069 0.280491 1198.18 1349.59 1.000
pi(G){all} 0.275550 0.000402 0.240000 0.318679 0.274933 1126.95 1151.64 1.003
pi(T){all} 0.222035 0.000341 0.184966 0.256353 0.221148 1168.41 1202.56 1.000
alpha{1,2} 0.429733 0.234479 0.000248 1.400922 0.253700 1273.23 1287.18 1.001
alpha{3} 0.472316 0.242007 0.000195 1.481140 0.310018 1062.07 1146.16 1.000
pinvar{all} 0.996845 0.000014 0.989834 0.999998 0.998079 1295.44 1296.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -648.440542
Model 2: PositiveSelection -648.440428
Model 0: one-ratio -648.440551
Model 7: beta -648.440428
Model 8: beta&w>1 -648.440428
Model 0 vs 1 1.799999995455437E-5
Model 2 vs 1 2.2800000010647636E-4
Model 8 vs 7 0.0
>C1
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C2
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C3
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C4
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C5
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C6
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
C1 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C2 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C3 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C4 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C5 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C6 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
**************************************************
C1 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C2 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C3 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C4 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C5 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C6 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
**************************************************
C1 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C2 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C3 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C4 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C5 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C6 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
**************************************************
C1 LRRDLSLLECC
C2 LRRDLSLLECC
C3 LRRDLSLLECC
C4 LRRDLSLLECC
C5 LRRDLSLLECC
C6 LRRDLSLLECC
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4830]--->[4830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.692 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C2 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C3 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C4 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C5 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C6 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
**************************************************
C1 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C2 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C3 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C4 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C5 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C6 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
**************************************************
C1 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C2 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C3 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C4 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C5 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C6 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
**************************************************
C1 LRRDLSLLECC
C2 LRRDLSLLECC
C3 LRRDLSLLECC
C4 LRRDLSLLECC
C5 LRRDLSLLECC
C6 LRRDLSLLECC
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C2 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C3 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C4 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C5 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C6 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
**************************************************
C1 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C2 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C3 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C4 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C5 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C6 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
**************************************************
C1 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C2 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C3 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C4 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C5 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C6 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
**************************************************
C1 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C2 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C3 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C4 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C5 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C6 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
**************************************************
C1 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C2 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C3 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C4 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C5 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C6 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
**************************************************
C1 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C2 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C3 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C4 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C5 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C6 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
**************************************************
C1 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C2 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C3 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C4 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C5 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C6 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
**************************************************
C1 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C2 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C3 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C4 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C5 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C6 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
**************************************************
C1 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C2 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C3 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C4 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C5 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C6 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
**************************************************
C1 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C2 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C3 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C4 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C5 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C6 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
*********************************
>C1
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C2
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C3
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C4
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C5
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C6
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C1
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C2
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C3
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C4
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C5
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C6
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 483 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773420
Setting output file names to "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 792386519
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8404762428
Seed = 1013778966
Swapseed = 1579773420
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1080.977156 -- -24.965149
Chain 2 -- -1080.977094 -- -24.965149
Chain 3 -- -1080.976991 -- -24.965149
Chain 4 -- -1080.977156 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1080.977156 -- -24.965149
Chain 2 -- -1080.977156 -- -24.965149
Chain 3 -- -1080.977156 -- -24.965149
Chain 4 -- -1080.977094 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1080.977] (-1080.977) (-1080.977) (-1080.977) * [-1080.977] (-1080.977) (-1080.977) (-1080.977)
500 -- (-674.128) (-679.437) [-669.971] (-678.387) * (-677.292) (-680.826) [-682.927] (-682.696) -- 0:00:00
1000 -- (-675.606) (-682.991) (-676.967) [-678.225] * (-677.486) (-680.378) [-670.960] (-679.268) -- 0:00:00
1500 -- [-674.846] (-671.950) (-673.921) (-677.473) * [-677.543] (-688.891) (-673.900) (-681.372) -- 0:00:00
2000 -- (-683.683) (-680.701) (-674.222) [-679.502] * (-674.444) (-683.597) [-676.260] (-672.348) -- 0:00:00
2500 -- (-679.015) [-678.340] (-682.508) (-679.207) * (-682.230) (-680.396) [-678.080] (-683.466) -- 0:00:00
3000 -- (-683.074) (-675.088) (-679.255) [-676.386] * (-680.557) [-674.656] (-682.795) (-680.419) -- 0:00:00
3500 -- [-675.496] (-678.048) (-679.352) (-675.394) * (-674.303) (-680.343) [-675.015] (-680.240) -- 0:00:00
4000 -- [-679.653] (-683.636) (-682.181) (-679.224) * (-686.099) (-679.019) [-674.952] (-681.758) -- 0:00:00
4500 -- (-677.810) [-674.545] (-681.492) (-672.757) * [-678.333] (-675.162) (-675.428) (-688.605) -- 0:00:00
5000 -- [-681.155] (-674.349) (-682.453) (-673.568) * [-680.018] (-676.972) (-679.387) (-679.581) -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- (-681.581) (-686.766) [-676.932] (-676.013) * (-674.904) [-672.302] (-678.446) (-685.023) -- 0:03:00
6000 -- [-671.188] (-677.755) (-685.769) (-675.335) * [-679.927] (-690.506) (-679.068) (-683.770) -- 0:02:45
6500 -- (-674.529) [-673.234] (-678.467) (-672.290) * (-676.392) (-680.748) (-677.257) [-685.991] -- 0:02:32
7000 -- (-688.575) (-674.361) (-692.238) [-672.528] * [-676.880] (-674.882) (-686.558) (-672.780) -- 0:02:21
7500 -- (-682.196) [-689.453] (-676.132) (-681.918) * [-677.558] (-674.827) (-681.925) (-666.666) -- 0:02:12
8000 -- [-672.018] (-667.626) (-679.971) (-681.867) * (-675.099) (-677.826) (-680.442) [-668.706] -- 0:02:04
8500 -- (-678.558) [-667.073] (-678.132) (-671.795) * (-686.291) [-678.717] (-675.340) (-668.314) -- 0:01:56
9000 -- (-674.580) (-668.026) [-682.057] (-677.400) * (-674.517) [-673.109] (-679.062) (-670.128) -- 0:01:50
9500 -- (-686.214) (-667.315) [-678.350] (-674.886) * (-667.729) [-681.637] (-674.767) (-667.445) -- 0:01:44
10000 -- (-683.568) [-668.419] (-677.703) (-670.243) * [-672.131] (-677.863) (-685.335) (-669.568) -- 0:01:39
Average standard deviation of split frequencies: 0.058150
10500 -- [-676.179] (-671.119) (-674.609) (-677.485) * (-669.466) [-676.881] (-676.944) (-671.071) -- 0:01:34
11000 -- (-673.440) (-674.335) [-680.052] (-684.210) * (-668.339) (-680.040) (-681.303) [-666.688] -- 0:01:29
11500 -- (-687.681) (-670.204) [-680.452] (-681.846) * (-667.923) [-680.952] (-681.071) (-668.415) -- 0:01:25
12000 -- (-674.015) (-670.612) [-673.150] (-685.734) * (-674.726) (-681.440) (-675.219) [-667.814] -- 0:01:22
12500 -- (-672.705) (-668.958) (-676.701) [-672.060] * [-669.080] (-681.792) (-674.791) (-667.476) -- 0:01:19
13000 -- (-674.669) (-670.004) (-682.454) [-674.820] * [-667.761] (-679.894) (-675.976) (-669.124) -- 0:01:15
13500 -- (-675.874) (-670.584) (-680.568) [-673.541] * (-669.854) [-679.903] (-674.270) (-669.316) -- 0:01:13
14000 -- (-673.473) (-670.051) [-678.559] (-677.264) * (-669.614) [-673.902] (-674.846) (-670.062) -- 0:01:10
14500 -- (-673.892) (-671.034) (-672.957) [-679.406] * (-671.053) (-688.961) [-675.515] (-668.222) -- 0:01:07
15000 -- (-674.897) (-671.426) (-686.129) [-675.844] * (-669.354) (-700.082) (-687.193) [-666.901] -- 0:01:05
Average standard deviation of split frequencies: 0.051172
15500 -- (-675.912) [-668.639] (-679.247) (-675.240) * (-673.532) (-684.109) [-675.852] (-667.521) -- 0:01:03
16000 -- (-674.114) (-666.878) [-677.363] (-675.064) * (-672.410) (-668.285) [-676.802] (-667.296) -- 0:01:01
16500 -- (-677.746) [-668.483] (-675.570) (-676.676) * (-673.152) (-667.632) [-678.883] (-668.385) -- 0:00:59
17000 -- (-673.415) (-667.653) (-677.374) [-677.706] * (-669.537) [-667.012] (-675.922) (-669.737) -- 0:00:57
17500 -- (-685.812) (-668.398) [-676.365] (-681.705) * [-666.771] (-669.083) (-682.829) (-672.060) -- 0:00:56
18000 -- (-675.847) [-669.707] (-679.261) (-675.408) * (-668.163) (-667.462) [-673.206] (-669.592) -- 0:00:54
18500 -- (-677.536) (-669.147) (-680.007) [-675.529] * (-670.614) (-668.344) (-679.218) [-667.673] -- 0:00:53
19000 -- [-679.077] (-668.230) (-679.348) (-675.766) * (-667.864) [-670.590] (-681.901) (-673.299) -- 0:00:51
19500 -- (-675.438) (-667.496) [-685.894] (-677.801) * (-668.300) (-669.468) (-679.900) [-667.750] -- 0:00:50
20000 -- (-678.843) (-667.357) [-682.061] (-681.137) * (-671.168) [-668.502] (-687.587) (-667.144) -- 0:00:49
Average standard deviation of split frequencies: 0.060026
20500 -- (-678.797) (-669.794) [-673.656] (-686.831) * (-670.408) (-674.568) (-685.661) [-668.780] -- 0:01:35
21000 -- [-678.587] (-667.058) (-677.000) (-690.808) * (-668.928) [-669.963] (-681.439) (-667.660) -- 0:01:33
21500 -- [-677.837] (-668.448) (-681.538) (-666.963) * (-671.253) [-666.868] (-668.852) (-667.787) -- 0:01:31
22000 -- (-689.110) (-667.564) (-672.473) [-670.385] * (-673.791) [-667.213] (-669.397) (-668.686) -- 0:01:28
22500 -- [-670.933] (-668.764) (-673.972) (-670.049) * [-670.715] (-670.525) (-668.232) (-670.891) -- 0:01:26
23000 -- (-678.506) (-668.261) [-674.813] (-668.864) * (-668.258) (-667.456) [-669.030] (-675.245) -- 0:01:24
23500 -- (-676.894) (-668.152) [-672.549] (-667.194) * (-671.272) (-668.001) [-667.120] (-672.529) -- 0:01:23
24000 -- (-676.920) (-671.009) [-685.465] (-666.742) * (-667.416) [-668.159] (-668.126) (-668.282) -- 0:01:21
24500 -- [-678.330] (-669.324) (-686.896) (-669.549) * (-667.886) (-672.105) (-669.590) [-668.233] -- 0:01:19
25000 -- (-688.845) (-667.463) [-682.919] (-669.671) * (-668.329) (-667.685) (-675.199) [-666.776] -- 0:01:18
Average standard deviation of split frequencies: 0.061300
25500 -- (-675.906) [-668.037] (-675.064) (-668.717) * (-669.917) (-670.155) (-667.039) [-668.866] -- 0:01:16
26000 -- (-674.608) (-670.067) [-670.904] (-669.469) * (-673.738) (-673.093) (-669.395) [-669.384] -- 0:01:14
26500 -- [-679.162] (-670.604) (-687.439) (-668.737) * [-667.906] (-667.872) (-670.071) (-670.901) -- 0:01:13
27000 -- (-684.852) (-667.168) [-676.687] (-668.512) * (-669.630) (-667.770) (-668.489) [-668.701] -- 0:01:12
27500 -- (-674.066) (-667.838) [-679.348] (-668.950) * (-668.027) [-666.650] (-669.354) (-673.557) -- 0:01:10
28000 -- [-677.299] (-673.590) (-674.044) (-668.903) * (-668.803) (-667.558) [-669.153] (-669.880) -- 0:01:09
28500 -- [-675.554] (-668.225) (-680.523) (-669.798) * (-670.892) [-667.792] (-668.914) (-668.224) -- 0:01:08
29000 -- (-680.994) (-668.755) [-675.969] (-670.497) * [-669.119] (-668.031) (-667.077) (-668.094) -- 0:01:06
29500 -- (-673.130) [-667.506] (-679.526) (-667.320) * [-671.594] (-667.473) (-669.040) (-668.400) -- 0:01:05
30000 -- (-675.342) (-668.573) [-676.582] (-673.304) * (-669.458) (-668.295) (-668.752) [-668.199] -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- [-676.639] (-670.345) (-682.396) (-668.722) * [-669.487] (-667.826) (-669.516) (-668.287) -- 0:01:03
31000 -- (-671.433) (-668.074) (-677.971) [-669.014] * (-670.938) [-667.477] (-669.268) (-670.128) -- 0:01:02
31500 -- [-675.369] (-668.766) (-681.862) (-667.110) * (-670.287) (-670.146) (-667.825) [-670.402] -- 0:01:01
32000 -- (-680.185) (-673.616) (-675.567) [-669.072] * (-668.630) [-671.712] (-668.192) (-672.111) -- 0:01:00
32500 -- (-678.960) [-670.311] (-678.239) (-668.555) * [-668.331] (-669.174) (-668.198) (-673.251) -- 0:00:59
33000 -- (-677.151) (-670.678) (-680.662) [-667.522] * (-667.409) (-669.943) (-667.611) [-668.934] -- 0:00:58
33500 -- (-678.489) (-668.916) [-676.547] (-669.729) * (-669.488) (-668.904) [-668.961] (-669.369) -- 0:00:57
34000 -- (-678.897) (-669.385) [-678.261] (-667.070) * (-670.557) (-668.838) [-675.649] (-669.576) -- 0:00:56
34500 -- (-679.940) [-668.623] (-678.120) (-668.081) * [-668.579] (-669.127) (-672.148) (-668.844) -- 0:00:55
35000 -- [-675.262] (-671.467) (-675.148) (-668.356) * (-669.376) [-668.217] (-668.381) (-666.990) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-678.057) [-669.881] (-689.589) (-668.369) * (-669.923) (-668.614) [-668.128] (-669.670) -- 0:00:54
36000 -- [-680.707] (-670.633) (-676.612) (-673.141) * (-669.342) (-670.000) (-669.374) [-670.160] -- 0:00:53
36500 -- (-680.091) (-669.137) [-670.354] (-669.314) * (-668.152) [-667.979] (-667.636) (-670.959) -- 0:00:52
37000 -- (-680.262) (-668.626) (-688.973) [-668.227] * (-668.909) (-673.828) (-671.136) [-674.702] -- 0:01:18
37500 -- [-680.445] (-672.157) (-677.357) (-670.322) * [-668.909] (-669.846) (-668.433) (-670.991) -- 0:01:17
38000 -- (-688.230) (-671.738) (-673.512) [-670.199] * (-671.848) (-671.834) (-669.756) [-668.296] -- 0:01:15
38500 -- (-678.806) (-669.030) [-673.895] (-668.774) * (-667.972) [-667.869] (-674.109) (-667.580) -- 0:01:14
39000 -- [-675.360] (-671.326) (-675.834) (-669.356) * [-668.473] (-671.568) (-672.414) (-669.443) -- 0:01:13
39500 -- [-679.449] (-669.861) (-678.001) (-671.348) * (-666.767) (-670.108) [-667.532] (-669.593) -- 0:01:12
40000 -- (-683.840) [-670.285] (-680.862) (-668.931) * (-669.200) (-671.425) (-667.345) [-668.115] -- 0:01:12
Average standard deviation of split frequencies: 0.038833
40500 -- (-678.520) (-669.495) (-679.630) [-675.942] * (-670.331) (-669.063) [-667.775] (-668.835) -- 0:01:11
41000 -- [-674.770] (-671.130) (-674.946) (-667.333) * (-669.230) (-670.666) [-667.916] (-670.572) -- 0:01:10
41500 -- (-675.262) [-670.165] (-673.949) (-668.902) * [-673.208] (-671.482) (-668.264) (-669.499) -- 0:01:09
42000 -- (-677.390) (-669.053) [-675.742] (-668.350) * (-671.465) (-668.955) (-667.692) [-668.914] -- 0:01:08
42500 -- [-684.268] (-667.551) (-677.676) (-668.629) * (-668.067) (-666.801) [-667.363] (-669.315) -- 0:01:07
43000 -- (-680.139) (-672.397) (-682.263) [-669.281] * (-668.763) (-669.031) (-668.176) [-670.915] -- 0:01:06
43500 -- [-679.043] (-672.614) (-679.168) (-668.726) * (-669.374) (-672.513) (-671.148) [-670.514] -- 0:01:05
44000 -- (-683.282) (-668.099) (-677.623) [-669.836] * (-668.499) [-667.538] (-669.454) (-669.598) -- 0:01:05
44500 -- (-677.443) [-672.848] (-679.588) (-669.413) * (-669.239) [-667.868] (-668.734) (-672.100) -- 0:01:04
45000 -- (-674.281) (-669.276) [-675.946] (-669.008) * (-670.913) (-671.519) [-667.277] (-671.953) -- 0:01:03
Average standard deviation of split frequencies: 0.039284
45500 -- (-677.962) (-668.161) [-675.591] (-667.652) * (-671.487) (-667.804) (-668.452) [-669.297] -- 0:01:02
46000 -- (-675.918) (-668.879) (-676.203) [-668.821] * (-669.793) (-669.360) (-670.245) [-670.430] -- 0:01:02
46500 -- (-688.582) (-667.095) (-675.279) [-669.301] * (-669.895) (-671.481) [-668.322] (-674.182) -- 0:01:01
47000 -- (-677.901) (-667.391) [-687.357] (-669.615) * (-667.918) [-671.861] (-670.996) (-673.355) -- 0:01:00
47500 -- (-682.728) [-667.636] (-689.286) (-673.468) * (-667.550) [-672.353] (-672.194) (-667.634) -- 0:01:00
48000 -- (-678.410) (-669.564) (-676.667) [-668.716] * (-668.334) (-669.378) (-670.583) [-668.459] -- 0:00:59
48500 -- [-675.190] (-667.150) (-677.882) (-668.887) * (-668.013) [-667.130] (-667.174) (-672.789) -- 0:00:58
49000 -- (-675.832) [-668.491] (-678.644) (-668.270) * [-670.871] (-667.702) (-668.323) (-667.461) -- 0:00:58
49500 -- (-681.176) (-669.069) (-675.469) [-669.879] * (-668.943) (-669.787) (-670.059) [-668.594] -- 0:00:57
50000 -- (-680.759) (-668.388) (-685.365) [-670.970] * (-667.515) (-668.591) [-670.882] (-668.186) -- 0:00:57
Average standard deviation of split frequencies: 0.040048
50500 -- [-684.145] (-667.938) (-684.793) (-672.288) * (-669.955) (-668.722) [-669.934] (-668.698) -- 0:00:56
51000 -- [-678.104] (-669.713) (-674.388) (-669.257) * (-668.199) (-668.191) (-668.919) [-667.023] -- 0:00:55
51500 -- (-686.186) (-672.617) [-675.751] (-668.966) * (-669.044) (-669.030) (-668.492) [-667.576] -- 0:00:55
52000 -- [-680.471] (-671.187) (-688.521) (-668.625) * (-670.553) [-669.948] (-672.775) (-669.564) -- 0:00:54
52500 -- (-678.649) [-668.259] (-671.386) (-668.128) * [-670.401] (-669.656) (-669.914) (-673.432) -- 0:00:54
53000 -- (-676.489) (-669.883) [-670.135] (-668.213) * (-668.847) [-667.571] (-668.072) (-668.704) -- 0:00:53
53500 -- (-675.671) (-669.198) (-671.518) [-671.851] * (-667.006) (-670.149) [-666.784] (-668.014) -- 0:01:10
54000 -- (-681.936) [-669.083] (-670.396) (-670.094) * (-666.935) (-671.206) (-668.931) [-667.143] -- 0:01:10
54500 -- [-672.418] (-673.225) (-669.097) (-668.549) * [-668.469] (-674.786) (-667.880) (-667.061) -- 0:01:09
55000 -- [-674.228] (-671.658) (-669.967) (-667.866) * [-667.771] (-673.852) (-666.819) (-668.897) -- 0:01:08
Average standard deviation of split frequencies: 0.039528
55500 -- (-672.440) [-672.176] (-673.575) (-670.449) * (-668.736) [-668.623] (-666.868) (-671.349) -- 0:01:08
56000 -- (-672.728) [-667.423] (-672.116) (-669.076) * [-668.059] (-669.057) (-671.001) (-668.511) -- 0:01:07
56500 -- [-673.148] (-668.945) (-674.993) (-667.837) * (-668.416) (-670.992) (-669.087) [-669.033] -- 0:01:06
57000 -- (-679.901) (-671.893) (-670.919) [-667.747] * [-666.687] (-668.075) (-667.050) (-670.381) -- 0:01:06
57500 -- (-683.184) (-670.069) [-670.276] (-669.657) * [-667.903] (-670.700) (-672.259) (-670.449) -- 0:01:05
58000 -- (-683.242) [-668.677] (-670.064) (-670.750) * (-667.890) [-667.886] (-673.365) (-669.235) -- 0:01:04
58500 -- (-677.238) (-670.272) (-668.675) [-668.604] * [-667.539] (-668.392) (-669.019) (-672.117) -- 0:01:04
59000 -- (-678.249) (-668.262) (-667.962) [-668.008] * (-668.183) (-666.791) (-672.544) [-667.222] -- 0:01:03
59500 -- (-676.471) [-667.817] (-667.388) (-668.890) * (-676.287) (-666.863) (-677.436) [-666.608] -- 0:01:03
60000 -- (-676.498) (-669.859) (-668.128) [-668.897] * [-669.584] (-667.187) (-668.947) (-669.472) -- 0:01:02
Average standard deviation of split frequencies: 0.036380
60500 -- (-690.429) (-669.516) [-668.337] (-669.118) * (-668.830) [-672.053] (-667.892) (-668.826) -- 0:01:02
61000 -- [-680.163] (-669.816) (-667.141) (-668.956) * (-670.159) (-667.794) (-668.473) [-668.944] -- 0:01:01
61500 -- (-683.094) (-670.767) (-667.880) [-667.723] * [-668.273] (-669.258) (-669.141) (-668.619) -- 0:01:01
62000 -- [-680.024] (-668.645) (-667.406) (-670.855) * (-673.271) (-668.942) [-669.760] (-672.994) -- 0:01:00
62500 -- [-679.224] (-670.322) (-669.638) (-671.219) * [-667.715] (-667.862) (-673.770) (-671.914) -- 0:01:00
63000 -- [-674.302] (-670.498) (-667.597) (-671.387) * (-670.562) (-670.080) (-668.648) [-668.654] -- 0:00:59
63500 -- [-674.241] (-670.035) (-672.017) (-669.562) * (-670.858) (-668.948) (-671.771) [-669.029] -- 0:00:58
64000 -- (-675.780) (-668.294) (-667.778) [-667.296] * [-668.204] (-671.020) (-670.090) (-667.679) -- 0:00:58
64500 -- [-683.809] (-667.382) (-670.071) (-668.969) * (-668.286) (-671.313) (-667.467) [-666.879] -- 0:00:58
65000 -- (-680.573) [-668.581] (-667.693) (-671.332) * (-668.386) (-668.560) [-669.447] (-667.050) -- 0:00:57
Average standard deviation of split frequencies: 0.031492
65500 -- (-678.082) (-669.297) [-668.062] (-669.693) * [-669.492] (-666.825) (-672.298) (-668.342) -- 0:00:57
66000 -- (-680.383) [-669.930] (-668.089) (-672.953) * [-667.552] (-668.138) (-678.768) (-668.272) -- 0:00:56
66500 -- (-672.582) (-669.234) (-667.375) [-670.766] * (-668.183) (-671.798) (-670.262) [-668.985] -- 0:00:56
67000 -- (-669.279) (-669.755) [-667.693] (-669.250) * (-670.312) (-668.491) [-667.818] (-669.523) -- 0:00:55
67500 -- [-668.835] (-666.849) (-669.051) (-671.559) * (-667.456) (-673.645) [-669.674] (-669.682) -- 0:00:55
68000 -- (-668.203) (-667.010) (-667.632) [-668.845] * (-671.136) [-669.189] (-678.201) (-670.026) -- 0:00:54
68500 -- [-667.693] (-669.049) (-668.548) (-669.249) * (-669.076) (-669.779) [-668.972] (-667.018) -- 0:00:54
69000 -- (-672.574) (-667.957) [-671.583] (-668.172) * (-668.288) (-673.172) (-667.598) [-669.100] -- 0:00:53
69500 -- (-670.252) [-669.015] (-669.931) (-667.069) * (-668.831) [-669.737] (-669.983) (-669.314) -- 0:00:53
70000 -- (-667.354) (-670.771) [-669.273] (-667.937) * (-669.513) (-670.558) (-666.713) [-669.028] -- 0:00:53
Average standard deviation of split frequencies: 0.031838
70500 -- [-667.819] (-666.859) (-670.763) (-669.052) * (-670.225) [-673.650] (-668.385) (-667.311) -- 0:01:05
71000 -- (-668.124) (-668.241) (-675.084) [-668.681] * [-669.659] (-668.667) (-668.654) (-667.755) -- 0:01:05
71500 -- (-671.789) (-668.298) [-669.602] (-668.568) * (-670.575) (-668.953) [-673.420] (-668.466) -- 0:01:04
72000 -- (-671.030) (-669.205) [-671.452] (-667.369) * (-668.305) [-669.945] (-668.286) (-667.011) -- 0:01:04
72500 -- [-667.325] (-669.246) (-667.327) (-669.425) * (-667.652) [-668.337] (-668.055) (-669.576) -- 0:01:03
73000 -- [-670.633] (-667.308) (-668.244) (-670.941) * (-670.733) (-667.342) [-666.785] (-669.478) -- 0:01:03
73500 -- (-669.472) [-667.086] (-668.561) (-667.986) * [-670.460] (-668.833) (-666.749) (-668.965) -- 0:01:03
74000 -- (-669.539) (-667.331) (-667.357) [-668.954] * (-667.539) (-668.126) (-667.792) [-671.962] -- 0:01:02
74500 -- (-670.759) (-666.939) (-666.889) [-667.842] * [-671.334] (-668.618) (-669.330) (-667.937) -- 0:01:02
75000 -- (-671.425) [-667.240] (-667.873) (-669.950) * [-670.145] (-668.230) (-668.357) (-671.703) -- 0:01:01
Average standard deviation of split frequencies: 0.030393
75500 -- (-669.221) (-668.976) (-667.233) [-671.245] * [-667.975] (-669.053) (-669.577) (-668.168) -- 0:01:01
76000 -- [-670.634] (-671.962) (-669.945) (-670.755) * (-668.549) (-666.825) (-667.821) [-667.808] -- 0:01:00
76500 -- (-671.921) (-671.977) [-671.175] (-670.925) * [-669.352] (-668.416) (-671.348) (-667.880) -- 0:01:00
77000 -- [-670.973] (-669.257) (-669.674) (-668.728) * (-672.557) [-668.214] (-674.034) (-667.100) -- 0:00:59
77500 -- (-668.144) (-669.097) (-673.311) [-671.419] * (-669.928) (-667.920) [-668.936] (-669.235) -- 0:00:59
78000 -- (-666.899) (-668.627) [-668.235] (-672.757) * (-670.155) (-668.663) (-670.009) [-669.974] -- 0:00:59
78500 -- (-667.435) (-668.457) [-667.406] (-669.204) * [-672.220] (-668.330) (-670.987) (-670.309) -- 0:00:58
79000 -- (-668.513) (-669.007) (-670.662) [-668.156] * (-671.389) [-667.751] (-670.856) (-671.118) -- 0:00:58
79500 -- [-669.016] (-668.390) (-668.448) (-669.277) * [-668.631] (-669.350) (-671.367) (-668.156) -- 0:00:57
80000 -- (-671.010) (-672.099) (-668.593) [-671.838] * (-668.384) (-669.769) (-667.610) [-667.960] -- 0:00:57
Average standard deviation of split frequencies: 0.026144
80500 -- (-671.399) (-669.689) (-668.373) [-672.785] * [-667.543] (-668.595) (-668.901) (-671.714) -- 0:00:57
81000 -- [-669.422] (-667.493) (-668.453) (-671.812) * [-667.421] (-669.345) (-670.301) (-668.770) -- 0:00:56
81500 -- [-667.330] (-670.472) (-668.638) (-670.406) * [-667.308] (-671.270) (-669.357) (-670.433) -- 0:00:56
82000 -- (-674.258) [-667.730] (-671.106) (-671.740) * [-670.517] (-669.381) (-670.066) (-673.200) -- 0:00:55
82500 -- (-675.688) (-671.460) [-668.841] (-670.311) * (-669.356) (-670.406) [-668.284] (-667.522) -- 0:00:55
83000 -- (-675.052) (-669.784) [-668.735] (-676.083) * (-669.092) [-669.041] (-670.439) (-667.590) -- 0:00:55
83500 -- (-668.428) (-669.140) [-670.485] (-670.308) * [-667.351] (-670.887) (-667.392) (-668.547) -- 0:00:54
84000 -- (-670.236) (-667.179) (-670.457) [-669.205] * [-669.520] (-670.426) (-670.531) (-668.421) -- 0:00:54
84500 -- (-667.989) (-670.390) (-669.678) [-666.793] * [-668.062] (-670.294) (-670.523) (-667.443) -- 0:00:54
85000 -- (-668.455) (-667.466) (-669.022) [-666.740] * (-669.294) [-669.698] (-669.549) (-667.827) -- 0:00:53
Average standard deviation of split frequencies: 0.023570
85500 -- (-670.309) [-667.431] (-669.286) (-667.323) * (-668.574) (-668.133) [-668.054] (-668.970) -- 0:00:53
86000 -- (-669.074) [-669.735] (-669.167) (-671.410) * (-669.240) (-667.440) (-668.296) [-670.383] -- 0:00:53
86500 -- (-667.314) [-668.484] (-671.609) (-668.982) * (-669.106) [-667.924] (-667.482) (-670.292) -- 0:00:52
87000 -- (-669.653) (-671.147) [-669.707] (-666.928) * (-675.104) (-670.091) (-669.539) [-671.046] -- 0:01:02
87500 -- [-670.668] (-670.030) (-673.082) (-667.495) * (-671.845) [-671.143] (-673.748) (-668.437) -- 0:01:02
88000 -- (-670.521) [-668.817] (-667.152) (-668.828) * (-673.933) (-669.254) (-669.721) [-668.010] -- 0:01:02
88500 -- (-667.298) (-671.682) (-669.472) [-667.993] * (-671.038) (-668.563) (-668.278) [-668.043] -- 0:01:01
89000 -- (-668.198) (-673.356) [-667.639] (-666.693) * (-669.703) (-667.379) (-668.264) [-668.256] -- 0:01:01
89500 -- [-667.725] (-670.208) (-670.637) (-667.592) * (-670.098) (-667.957) [-670.477] (-667.109) -- 0:01:01
90000 -- (-669.358) [-667.425] (-674.270) (-666.719) * [-667.564] (-670.763) (-669.278) (-670.763) -- 0:01:00
Average standard deviation of split frequencies: 0.020277
90500 -- (-669.515) (-667.688) (-669.916) [-667.086] * (-666.680) (-668.688) (-668.955) [-669.929] -- 0:01:00
91000 -- [-667.630] (-668.996) (-668.722) (-670.124) * (-668.378) (-669.230) (-671.521) [-667.772] -- 0:00:59
91500 -- [-669.322] (-668.868) (-672.331) (-667.750) * (-670.269) [-667.725] (-669.738) (-668.782) -- 0:00:59
92000 -- (-673.861) (-672.663) [-671.063] (-668.350) * (-671.292) (-669.079) [-667.408] (-668.398) -- 0:00:59
92500 -- [-674.102] (-669.993) (-670.699) (-667.156) * (-667.444) [-671.283] (-668.657) (-667.633) -- 0:00:58
93000 -- (-679.668) (-667.794) [-671.419] (-667.642) * (-667.392) (-669.659) (-669.551) [-668.763] -- 0:00:58
93500 -- (-678.842) (-667.800) [-669.806] (-668.658) * (-668.596) [-667.945] (-669.097) (-669.384) -- 0:00:58
94000 -- (-673.729) (-669.125) (-668.574) [-666.550] * (-669.902) (-667.614) [-669.924] (-666.690) -- 0:00:57
94500 -- (-668.061) (-670.796) (-668.535) [-668.744] * (-666.917) (-668.230) (-669.439) [-667.451] -- 0:00:57
95000 -- (-667.546) [-667.817] (-667.894) (-669.127) * (-669.826) [-669.109] (-667.041) (-669.346) -- 0:00:57
Average standard deviation of split frequencies: 0.022214
95500 -- (-667.790) [-667.776] (-668.961) (-672.498) * [-666.921] (-668.710) (-668.187) (-668.820) -- 0:00:56
96000 -- (-668.319) (-669.980) [-667.437] (-667.185) * [-667.055] (-669.320) (-667.514) (-667.143) -- 0:00:56
96500 -- (-671.001) (-671.839) [-667.949] (-667.589) * [-667.696] (-673.279) (-667.050) (-669.023) -- 0:00:56
97000 -- [-668.749] (-670.028) (-667.797) (-670.481) * [-668.364] (-672.113) (-670.635) (-669.887) -- 0:00:55
97500 -- (-668.291) (-669.754) (-669.757) [-667.052] * (-669.609) [-671.388] (-671.548) (-669.648) -- 0:00:55
98000 -- (-669.897) [-669.288] (-667.943) (-667.547) * (-670.104) (-672.478) (-670.658) [-673.141] -- 0:00:55
98500 -- [-668.971] (-670.436) (-667.885) (-668.748) * [-668.638] (-673.140) (-671.787) (-668.112) -- 0:00:54
99000 -- (-669.272) (-667.688) [-670.086] (-671.115) * (-669.420) (-668.958) (-669.695) [-668.992] -- 0:00:54
99500 -- (-670.597) (-670.209) (-671.138) [-668.134] * [-669.655] (-671.384) (-672.499) (-669.859) -- 0:00:54
100000 -- (-667.212) [-667.133] (-667.652) (-668.980) * (-668.196) (-668.826) (-670.417) [-670.626] -- 0:00:54
Average standard deviation of split frequencies: 0.020292
100500 -- (-672.233) [-667.283] (-670.327) (-668.085) * [-668.578] (-671.230) (-667.497) (-671.811) -- 0:00:53
101000 -- (-667.559) [-667.629] (-667.746) (-670.286) * (-667.971) (-669.316) (-668.360) [-667.228] -- 0:00:53
101500 -- (-668.031) [-673.127] (-672.156) (-668.377) * (-668.048) [-669.134] (-667.532) (-669.311) -- 0:00:53
102000 -- (-669.521) (-679.610) (-671.499) [-668.648] * (-667.690) (-670.738) (-667.244) [-666.755] -- 0:00:52
102500 -- (-669.852) (-678.066) [-669.466] (-676.119) * (-669.354) [-670.448] (-671.063) (-667.380) -- 0:00:52
103000 -- (-670.832) (-675.649) (-672.216) [-670.053] * (-668.477) [-668.025] (-668.938) (-667.698) -- 0:00:52
103500 -- (-669.886) [-669.552] (-669.773) (-671.884) * [-669.123] (-668.008) (-672.950) (-668.251) -- 0:00:51
104000 -- [-668.861] (-668.712) (-669.892) (-668.187) * (-668.062) (-670.932) (-671.336) [-668.297] -- 0:01:00
104500 -- (-669.561) [-667.124] (-668.783) (-668.759) * (-666.844) (-668.238) (-672.991) [-669.364] -- 0:00:59
105000 -- (-670.145) (-667.918) (-669.374) [-669.394] * [-669.951] (-671.815) (-668.239) (-669.866) -- 0:00:59
Average standard deviation of split frequencies: 0.020012
105500 -- (-671.684) [-668.698] (-671.818) (-667.437) * (-670.334) (-668.613) [-669.317] (-669.131) -- 0:00:59
106000 -- (-668.628) (-668.399) (-672.880) [-667.695] * (-670.741) (-672.241) (-668.834) [-669.848] -- 0:00:59
106500 -- (-668.892) [-673.221] (-671.937) (-667.954) * [-670.245] (-671.214) (-670.359) (-668.532) -- 0:00:58
107000 -- (-668.018) [-670.704] (-667.809) (-667.239) * [-670.679] (-673.676) (-667.766) (-669.209) -- 0:00:58
107500 -- (-668.395) [-668.246] (-667.624) (-667.228) * (-669.941) (-671.728) [-667.110] (-668.522) -- 0:00:58
108000 -- [-667.466] (-667.634) (-666.887) (-668.330) * (-666.815) [-669.501] (-670.210) (-671.186) -- 0:00:57
108500 -- (-671.091) [-668.619] (-668.030) (-671.815) * (-668.486) (-667.739) [-668.770] (-669.203) -- 0:00:57
109000 -- (-668.836) (-674.988) (-670.495) [-668.597] * (-667.720) (-667.754) (-668.350) [-671.041] -- 0:00:57
109500 -- [-669.218] (-671.335) (-670.076) (-670.945) * [-668.047] (-670.379) (-673.775) (-671.065) -- 0:00:56
110000 -- (-668.061) (-668.013) (-670.488) [-671.592] * (-669.801) [-670.982] (-669.261) (-669.629) -- 0:00:56
Average standard deviation of split frequencies: 0.021062
110500 -- (-667.540) (-670.883) (-667.108) [-670.884] * (-669.837) [-668.595] (-668.039) (-667.499) -- 0:00:56
111000 -- (-674.458) (-669.084) (-667.177) [-668.945] * [-667.602] (-672.400) (-670.189) (-668.118) -- 0:00:56
111500 -- (-676.579) [-668.886] (-668.456) (-667.936) * (-666.725) (-668.450) (-669.541) [-668.482] -- 0:00:55
112000 -- [-667.989] (-670.060) (-672.369) (-669.131) * [-668.061] (-668.540) (-670.757) (-669.568) -- 0:00:55
112500 -- [-669.846] (-667.976) (-669.924) (-667.565) * (-668.830) (-668.661) (-670.503) [-670.379] -- 0:00:55
113000 -- (-668.361) [-671.401] (-670.681) (-668.215) * [-670.193] (-670.135) (-667.621) (-668.981) -- 0:00:54
113500 -- (-673.002) [-667.694] (-667.544) (-669.764) * (-670.389) (-668.027) (-667.807) [-669.071] -- 0:00:54
114000 -- (-667.950) (-670.302) [-669.386] (-667.226) * (-668.864) (-669.095) [-670.247] (-668.652) -- 0:00:54
114500 -- (-670.203) (-673.458) (-669.549) [-667.369] * (-669.551) (-670.150) (-667.681) [-674.652] -- 0:00:54
115000 -- (-670.133) [-670.498] (-670.974) (-667.679) * (-668.911) (-667.437) (-668.888) [-667.907] -- 0:00:53
Average standard deviation of split frequencies: 0.020093
115500 -- (-672.692) [-671.596] (-671.180) (-668.980) * [-667.422] (-666.566) (-668.174) (-670.142) -- 0:00:53
116000 -- (-667.248) (-669.758) [-668.903] (-669.259) * (-670.420) (-669.284) [-668.355] (-668.331) -- 0:00:53
116500 -- (-667.141) (-669.024) (-669.742) [-669.536] * (-667.850) (-671.160) (-668.882) [-669.156] -- 0:00:53
117000 -- (-667.539) (-668.728) [-670.263] (-669.191) * (-670.164) (-675.415) [-668.105] (-669.669) -- 0:00:52
117500 -- (-671.433) (-673.375) (-669.361) [-667.318] * (-668.190) (-671.299) [-668.250] (-672.509) -- 0:00:52
118000 -- (-669.852) (-669.009) [-669.100] (-667.357) * [-672.469] (-668.288) (-667.077) (-669.848) -- 0:00:52
118500 -- (-667.261) [-668.480] (-668.611) (-667.861) * (-669.190) (-668.008) (-668.177) [-667.416] -- 0:00:52
119000 -- [-667.769] (-667.494) (-668.571) (-668.109) * (-667.540) [-672.055] (-667.919) (-667.925) -- 0:00:51
119500 -- (-667.851) (-667.229) [-671.778] (-669.549) * (-671.987) (-667.333) (-669.931) [-667.710] -- 0:00:51
120000 -- (-671.226) (-667.988) [-670.819] (-668.720) * [-670.365] (-669.354) (-667.796) (-669.481) -- 0:00:51
Average standard deviation of split frequencies: 0.018155
120500 -- (-668.279) [-667.458] (-669.054) (-668.891) * (-671.480) (-672.370) (-672.158) [-668.850] -- 0:00:51
121000 -- [-671.029] (-671.014) (-669.109) (-671.890) * [-667.033] (-671.304) (-671.859) (-674.249) -- 0:00:58
121500 -- [-667.557] (-672.821) (-669.229) (-670.122) * (-667.201) [-668.200] (-668.105) (-670.684) -- 0:00:57
122000 -- [-667.935] (-670.704) (-668.016) (-667.227) * (-666.764) (-669.595) (-668.758) [-673.080] -- 0:00:57
122500 -- (-667.825) (-670.497) (-669.290) [-668.605] * (-667.313) (-670.688) (-668.754) [-671.911] -- 0:00:57
123000 -- (-670.320) [-671.098] (-669.440) (-672.569) * (-669.249) [-670.470] (-668.818) (-670.619) -- 0:00:57
123500 -- (-671.206) (-672.252) (-667.513) [-668.325] * (-670.396) (-667.837) (-670.718) [-668.608] -- 0:00:56
124000 -- (-669.679) (-668.450) (-667.199) [-668.271] * [-668.605] (-668.396) (-670.156) (-668.286) -- 0:00:56
124500 -- [-669.737] (-667.710) (-668.302) (-670.317) * (-670.032) (-670.532) (-670.229) [-672.277] -- 0:00:56
125000 -- (-667.936) [-668.948] (-668.488) (-670.550) * [-672.371] (-669.268) (-667.692) (-670.517) -- 0:00:56
Average standard deviation of split frequencies: 0.015185
125500 -- (-669.349) (-668.694) (-670.069) [-675.689] * (-679.008) (-668.827) [-668.453] (-667.815) -- 0:00:55
126000 -- (-667.974) [-669.128] (-667.489) (-671.012) * (-673.285) [-670.120] (-670.222) (-670.479) -- 0:00:55
126500 -- (-667.732) [-668.105] (-671.968) (-674.868) * (-671.597) (-676.297) (-670.050) [-671.166] -- 0:00:55
127000 -- [-670.389] (-669.117) (-671.155) (-669.083) * (-668.337) (-669.226) (-669.383) [-670.143] -- 0:00:54
127500 -- (-673.932) (-668.661) (-672.181) [-668.820] * (-669.135) (-669.292) (-673.098) [-668.957] -- 0:00:54
128000 -- (-667.793) [-668.982] (-669.853) (-668.946) * [-671.751] (-668.922) (-669.135) (-670.533) -- 0:00:54
128500 -- (-666.974) (-672.237) (-668.314) [-666.982] * [-669.748] (-669.574) (-668.854) (-672.074) -- 0:00:54
129000 -- (-668.352) (-669.914) [-667.200] (-667.972) * [-669.685] (-667.772) (-666.724) (-671.776) -- 0:00:54
129500 -- (-668.115) (-673.222) (-668.497) [-669.257] * (-669.351) (-669.526) (-668.959) [-671.379] -- 0:00:53
130000 -- (-669.057) (-668.265) (-670.025) [-671.168] * (-671.074) (-669.704) (-669.075) [-670.388] -- 0:00:53
Average standard deviation of split frequencies: 0.015633
130500 -- (-671.237) (-671.386) [-668.792] (-671.755) * (-670.922) (-672.925) (-670.513) [-668.035] -- 0:00:53
131000 -- [-667.671] (-668.948) (-667.347) (-671.887) * (-669.190) (-675.171) (-671.873) [-666.989] -- 0:00:53
131500 -- [-672.310] (-669.744) (-667.258) (-671.329) * (-670.838) [-670.501] (-670.245) (-666.910) -- 0:00:52
132000 -- (-668.345) (-669.481) [-667.652] (-668.542) * (-670.046) (-668.011) (-668.751) [-668.496] -- 0:00:52
132500 -- (-670.472) (-669.522) [-668.816] (-673.956) * (-668.005) (-670.233) [-668.543] (-669.544) -- 0:00:52
133000 -- (-667.660) (-669.761) (-667.294) [-667.715] * (-670.289) (-668.580) (-667.348) [-668.968] -- 0:00:52
133500 -- (-670.332) [-668.290] (-667.178) (-672.618) * (-669.672) [-667.363] (-669.777) (-668.134) -- 0:00:51
134000 -- (-670.023) [-667.650] (-670.496) (-675.652) * [-667.278] (-667.392) (-670.218) (-668.931) -- 0:00:51
134500 -- (-669.200) (-673.026) [-670.645] (-670.693) * (-668.787) (-667.806) [-668.933] (-666.754) -- 0:00:51
135000 -- (-668.873) [-669.724] (-667.458) (-670.787) * (-669.995) [-667.687] (-668.784) (-668.493) -- 0:00:51
Average standard deviation of split frequencies: 0.016312
135500 -- [-667.394] (-669.602) (-667.819) (-668.426) * (-671.640) [-668.604] (-667.472) (-668.352) -- 0:00:51
136000 -- [-668.213] (-668.869) (-668.230) (-671.130) * (-668.921) (-671.260) (-667.209) [-668.220] -- 0:00:50
136500 -- (-671.576) [-669.380] (-671.172) (-668.911) * (-669.134) [-672.285] (-667.771) (-667.787) -- 0:00:50
137000 -- (-669.770) (-669.375) [-670.797] (-673.100) * (-667.511) (-669.066) [-673.815] (-673.814) -- 0:00:50
137500 -- (-669.859) (-675.036) [-668.327] (-668.525) * (-666.872) [-669.684] (-670.016) (-669.255) -- 0:00:56
138000 -- (-668.207) (-669.859) (-668.642) [-669.520] * [-666.901] (-673.624) (-668.518) (-668.666) -- 0:00:56
138500 -- (-671.241) [-667.290] (-669.715) (-668.779) * (-670.958) [-668.382] (-668.379) (-668.756) -- 0:00:55
139000 -- (-673.263) [-666.605] (-667.838) (-669.040) * (-667.115) [-670.028] (-669.799) (-670.424) -- 0:00:55
139500 -- [-670.541] (-667.991) (-668.536) (-668.750) * (-666.864) [-669.122] (-668.773) (-668.849) -- 0:00:55
140000 -- (-668.379) [-675.981] (-669.917) (-667.865) * (-668.226) (-671.796) [-667.973] (-669.638) -- 0:00:55
Average standard deviation of split frequencies: 0.015376
140500 -- (-668.658) [-667.895] (-668.427) (-668.409) * [-668.480] (-671.148) (-672.773) (-668.444) -- 0:00:55
141000 -- (-669.253) (-670.464) [-668.956] (-667.599) * (-668.767) (-668.238) [-668.213] (-668.786) -- 0:00:54
141500 -- (-668.971) (-670.603) [-668.911] (-667.853) * (-668.810) [-669.017] (-669.350) (-670.141) -- 0:00:54
142000 -- [-667.317] (-670.594) (-668.094) (-668.140) * [-668.282] (-669.464) (-670.470) (-669.805) -- 0:00:54
142500 -- (-670.044) [-669.547] (-667.972) (-669.723) * [-668.537] (-668.669) (-669.921) (-667.892) -- 0:00:54
143000 -- (-671.296) (-668.290) [-667.319] (-674.480) * (-671.716) (-668.086) (-670.745) [-669.223] -- 0:00:53
143500 -- (-671.589) (-668.730) [-667.539] (-670.005) * (-668.010) [-668.820] (-669.863) (-671.314) -- 0:00:53
144000 -- (-670.074) (-669.394) (-668.080) [-667.082] * (-669.053) [-668.557] (-668.417) (-670.108) -- 0:00:53
144500 -- (-670.646) [-667.410] (-671.105) (-668.450) * (-671.887) (-670.716) [-669.361] (-670.079) -- 0:00:53
145000 -- (-667.545) (-668.306) (-673.257) [-667.484] * [-667.603] (-668.673) (-672.665) (-667.106) -- 0:00:53
Average standard deviation of split frequencies: 0.014368
145500 -- (-670.947) (-668.848) (-671.537) [-669.285] * (-669.718) (-672.028) [-668.184] (-668.679) -- 0:00:52
146000 -- [-671.235] (-670.694) (-671.048) (-669.405) * (-668.861) (-670.014) (-669.344) [-667.675] -- 0:00:52
146500 -- (-672.984) (-672.744) (-672.140) [-668.072] * (-669.576) [-669.193] (-669.707) (-668.683) -- 0:00:52
147000 -- (-675.236) (-668.136) (-671.499) [-669.449] * (-668.507) (-669.428) (-667.981) [-669.008] -- 0:00:52
147500 -- (-667.245) [-669.305] (-670.633) (-668.716) * (-668.501) (-669.733) [-669.529] (-668.873) -- 0:00:52
148000 -- (-669.285) (-666.836) [-672.389] (-667.509) * (-667.745) (-669.208) [-668.214] (-668.777) -- 0:00:51
148500 -- (-668.600) (-669.405) (-668.792) [-667.346] * (-667.550) (-670.276) [-668.128] (-673.364) -- 0:00:51
149000 -- (-671.259) [-669.692] (-668.834) (-669.930) * (-670.001) (-670.480) [-668.763] (-666.956) -- 0:00:51
149500 -- [-669.545] (-668.602) (-668.991) (-671.366) * (-671.772) (-668.140) (-669.072) [-669.505] -- 0:00:51
150000 -- [-669.072] (-669.743) (-673.147) (-671.041) * [-666.844] (-670.733) (-670.749) (-669.183) -- 0:00:51
Average standard deviation of split frequencies: 0.012672
150500 -- [-669.042] (-669.760) (-670.211) (-667.645) * (-673.163) (-672.813) (-668.029) [-668.713] -- 0:00:50
151000 -- [-667.674] (-670.562) (-669.273) (-670.112) * [-669.326] (-670.354) (-668.562) (-669.592) -- 0:00:50
151500 -- (-669.269) (-670.660) [-669.133] (-669.402) * [-669.077] (-668.443) (-668.108) (-668.615) -- 0:00:50
152000 -- (-667.873) [-668.079] (-669.786) (-670.430) * (-669.095) (-668.895) [-670.588] (-668.312) -- 0:00:50
152500 -- [-667.653] (-667.414) (-669.715) (-669.317) * [-669.371] (-668.539) (-669.537) (-669.179) -- 0:00:50
153000 -- (-667.856) (-668.755) [-667.863] (-668.755) * [-670.469] (-667.922) (-669.238) (-669.361) -- 0:00:49
153500 -- (-668.234) [-666.536] (-668.075) (-669.480) * (-668.693) (-667.598) (-668.454) [-668.744] -- 0:00:49
154000 -- (-668.477) (-668.347) [-667.346] (-670.016) * (-670.975) [-667.201] (-671.581) (-668.245) -- 0:00:49
154500 -- (-669.909) (-668.303) [-670.595] (-669.105) * (-668.504) (-666.740) [-673.578] (-672.674) -- 0:00:54
155000 -- (-668.376) (-668.133) (-670.541) [-668.126] * (-671.681) (-673.227) [-668.785] (-673.263) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
155500 -- (-667.955) [-668.282] (-671.077) (-667.493) * (-674.413) [-667.574] (-669.436) (-671.817) -- 0:00:54
156000 -- (-670.580) [-667.201] (-668.385) (-667.356) * (-670.336) (-667.572) [-667.014] (-676.306) -- 0:00:54
156500 -- (-670.700) [-671.659] (-674.720) (-668.916) * (-669.895) (-670.073) (-667.748) [-668.745] -- 0:00:53
157000 -- (-670.049) [-667.946] (-671.210) (-667.883) * (-669.991) (-668.013) (-666.998) [-669.717] -- 0:00:53
157500 -- [-670.548] (-669.265) (-673.355) (-667.541) * [-670.052] (-668.665) (-668.143) (-670.897) -- 0:00:53
158000 -- (-668.395) (-668.257) (-667.870) [-668.929] * (-667.399) (-671.083) (-667.187) [-668.812] -- 0:00:53
158500 -- (-668.797) (-667.598) [-669.115] (-668.820) * (-670.984) [-670.637] (-668.647) (-668.074) -- 0:00:53
159000 -- (-669.629) [-668.563] (-667.550) (-667.482) * (-667.398) (-670.768) (-667.113) [-670.948] -- 0:00:52
159500 -- (-667.510) [-668.880] (-671.807) (-667.943) * (-667.988) (-673.974) [-669.589] (-670.110) -- 0:00:52
160000 -- (-667.192) [-667.035] (-672.283) (-667.074) * (-671.408) (-668.618) (-669.316) [-668.997] -- 0:00:52
Average standard deviation of split frequencies: 0.013744
160500 -- [-668.237] (-666.964) (-670.714) (-669.168) * (-668.072) (-669.946) (-666.945) [-668.276] -- 0:00:52
161000 -- (-668.616) (-667.224) (-667.251) [-670.425] * (-668.346) (-670.577) (-671.293) [-667.400] -- 0:00:52
161500 -- (-668.040) (-667.711) (-669.090) [-668.606] * (-668.065) (-670.227) (-670.297) [-670.799] -- 0:00:51
162000 -- (-668.794) (-667.759) (-668.727) [-668.204] * (-668.477) (-670.054) (-673.403) [-669.906] -- 0:00:51
162500 -- (-668.206) (-668.029) [-667.680] (-678.535) * (-667.046) (-667.083) [-669.179] (-673.160) -- 0:00:51
163000 -- [-668.154] (-667.721) (-673.226) (-669.047) * (-668.052) [-668.875] (-670.991) (-674.848) -- 0:00:51
163500 -- [-669.037] (-669.576) (-668.498) (-670.697) * (-668.844) (-668.911) (-670.798) [-672.957] -- 0:00:51
164000 -- [-668.032] (-667.873) (-668.592) (-670.497) * (-667.293) (-672.727) (-667.778) [-669.884] -- 0:00:50
164500 -- [-667.746] (-666.801) (-674.261) (-667.336) * (-670.979) (-670.743) (-670.851) [-667.974] -- 0:00:50
165000 -- (-670.544) [-667.290] (-668.418) (-676.866) * [-669.224] (-670.539) (-668.241) (-668.985) -- 0:00:50
Average standard deviation of split frequencies: 0.012921
165500 -- [-668.022] (-668.373) (-670.783) (-672.090) * (-668.109) (-667.605) (-666.982) [-669.904] -- 0:00:50
166000 -- [-668.575] (-669.713) (-666.986) (-672.066) * (-667.050) (-671.115) (-669.190) [-669.569] -- 0:00:50
166500 -- (-669.583) (-669.283) [-666.753] (-668.766) * [-668.433] (-669.033) (-669.077) (-668.239) -- 0:00:50
167000 -- (-668.406) [-667.970] (-667.148) (-669.633) * (-668.713) (-669.386) (-670.413) [-667.365] -- 0:00:49
167500 -- (-668.240) (-671.900) (-668.422) [-669.538] * [-667.879] (-671.762) (-668.825) (-669.451) -- 0:00:49
168000 -- (-667.598) (-672.049) (-667.979) [-668.653] * (-669.756) [-669.408] (-670.445) (-670.205) -- 0:00:49
168500 -- (-667.267) (-671.134) (-669.587) [-668.606] * (-667.023) (-668.905) [-669.291] (-670.622) -- 0:00:49
169000 -- (-667.397) (-672.138) [-668.311] (-670.436) * (-670.221) [-670.288] (-667.686) (-673.477) -- 0:00:49
169500 -- (-671.822) (-668.452) [-667.865] (-668.435) * (-667.768) (-669.697) [-671.766] (-669.752) -- 0:00:48
170000 -- (-671.055) [-668.941] (-669.014) (-669.993) * (-669.040) (-672.847) (-670.354) [-668.088] -- 0:00:48
Average standard deviation of split frequencies: 0.014731
170500 -- (-668.228) (-669.547) (-667.141) [-667.232] * (-669.734) [-668.639] (-667.677) (-667.330) -- 0:00:48
171000 -- (-667.624) (-669.975) [-668.214] (-666.987) * (-671.442) (-670.949) [-668.227] (-668.085) -- 0:00:53
171500 -- (-669.146) (-669.659) (-671.504) [-668.568] * [-669.173] (-670.421) (-667.592) (-667.644) -- 0:00:53
172000 -- (-668.630) (-668.625) (-669.556) [-669.018] * (-671.920) (-667.709) [-668.410] (-673.490) -- 0:00:52
172500 -- (-668.954) (-667.733) (-668.617) [-670.639] * (-672.056) [-667.031] (-666.718) (-669.823) -- 0:00:52
173000 -- (-668.951) [-667.755] (-667.364) (-667.485) * (-668.484) (-669.271) (-671.598) [-668.819] -- 0:00:52
173500 -- [-670.878] (-668.987) (-669.645) (-667.851) * (-669.759) (-667.636) (-673.298) [-668.423] -- 0:00:52
174000 -- [-668.733] (-669.872) (-667.958) (-669.633) * [-669.872] (-670.209) (-672.250) (-668.236) -- 0:00:52
174500 -- (-667.941) (-668.409) [-667.633] (-668.797) * (-667.285) (-668.535) (-670.467) [-667.203] -- 0:00:52
175000 -- (-667.469) (-667.014) [-668.415] (-670.704) * (-672.272) (-667.619) (-667.570) [-668.243] -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-669.806) [-666.683] (-671.078) (-670.976) * (-671.348) (-668.760) [-668.444] (-668.058) -- 0:00:51
176000 -- (-667.427) [-669.386] (-669.248) (-669.454) * (-667.966) (-668.168) (-667.260) [-668.132] -- 0:00:51
176500 -- (-668.218) [-670.947] (-667.620) (-670.208) * (-670.022) (-669.341) [-667.932] (-669.489) -- 0:00:51
177000 -- (-670.069) (-668.795) (-666.584) [-668.212] * (-671.566) [-671.721] (-667.403) (-667.586) -- 0:00:51
177500 -- [-667.539] (-670.048) (-667.614) (-667.568) * (-669.820) [-667.649] (-668.692) (-669.089) -- 0:00:50
178000 -- (-667.520) (-668.681) (-667.571) [-668.189] * (-666.766) (-668.472) (-667.625) [-669.096] -- 0:00:50
178500 -- [-670.834] (-667.569) (-670.991) (-667.193) * (-667.963) (-669.575) [-670.165] (-669.225) -- 0:00:50
179000 -- (-668.011) [-668.565] (-672.549) (-667.209) * (-668.217) [-668.757] (-667.857) (-670.437) -- 0:00:50
179500 -- (-667.489) (-668.487) [-667.750] (-666.864) * [-669.834] (-670.096) (-667.426) (-669.279) -- 0:00:50
180000 -- (-667.113) (-674.085) (-667.833) [-667.853] * (-669.564) [-667.101] (-672.044) (-668.918) -- 0:00:50
Average standard deviation of split frequencies: 0.015930
180500 -- (-667.846) [-668.836] (-670.654) (-668.734) * (-668.466) [-667.015] (-668.850) (-671.666) -- 0:00:49
181000 -- (-669.171) (-668.640) (-671.838) [-668.070] * (-667.602) [-668.312] (-670.885) (-667.821) -- 0:00:49
181500 -- [-668.182] (-669.520) (-672.439) (-667.798) * [-668.924] (-668.197) (-670.131) (-667.959) -- 0:00:49
182000 -- [-668.181] (-667.390) (-668.523) (-667.975) * (-667.880) [-667.498] (-669.043) (-669.717) -- 0:00:49
182500 -- (-670.604) (-669.011) (-667.308) [-668.888] * [-667.180] (-671.357) (-670.085) (-670.832) -- 0:00:49
183000 -- (-671.132) [-668.110] (-671.164) (-669.974) * (-667.813) (-667.068) [-670.171] (-672.677) -- 0:00:49
183500 -- (-670.068) [-667.749] (-668.869) (-670.842) * (-667.849) (-669.310) (-669.052) [-669.071] -- 0:00:48
184000 -- (-671.353) (-667.164) (-668.426) [-668.368] * [-671.131] (-667.638) (-667.640) (-668.345) -- 0:00:48
184500 -- (-669.366) (-669.216) [-668.999] (-669.989) * (-671.020) [-673.443] (-669.197) (-667.879) -- 0:00:48
185000 -- (-668.732) (-669.678) (-674.374) [-667.433] * (-672.650) (-667.397) (-671.166) [-667.969] -- 0:00:48
Average standard deviation of split frequencies: 0.015874
185500 -- (-667.252) [-666.476] (-668.699) (-667.984) * (-668.823) (-669.532) [-669.053] (-667.669) -- 0:00:48
186000 -- (-670.212) [-667.249] (-667.109) (-668.066) * (-667.504) (-669.509) (-666.890) [-668.258] -- 0:00:48
186500 -- (-668.199) [-667.068] (-667.122) (-673.861) * (-667.338) [-668.857] (-668.290) (-668.442) -- 0:00:47
187000 -- (-668.240) (-666.877) [-667.974] (-667.859) * (-673.158) (-667.797) [-670.521] (-669.309) -- 0:00:52
187500 -- (-670.490) (-669.275) (-667.605) [-667.803] * (-669.498) [-666.720] (-668.676) (-672.024) -- 0:00:52
188000 -- (-668.299) (-671.058) [-671.665] (-668.856) * (-669.967) (-668.530) (-667.385) [-669.186] -- 0:00:51
188500 -- (-668.092) (-669.434) [-669.600] (-670.209) * (-670.574) [-669.384] (-668.390) (-668.591) -- 0:00:51
189000 -- (-669.143) (-668.746) [-667.756] (-668.892) * (-668.204) (-668.627) (-667.844) [-667.334] -- 0:00:51
189500 -- [-667.692] (-669.402) (-668.365) (-669.934) * (-667.726) (-667.944) (-667.395) [-669.010] -- 0:00:51
190000 -- (-667.215) [-668.676] (-670.501) (-667.002) * (-668.475) (-669.402) (-669.847) [-669.449] -- 0:00:51
Average standard deviation of split frequencies: 0.017827
190500 -- [-666.996] (-670.854) (-671.286) (-667.239) * (-670.540) [-668.474] (-672.450) (-668.940) -- 0:00:50
191000 -- (-666.719) (-668.392) [-669.542] (-667.693) * (-668.948) (-670.062) [-668.036] (-669.313) -- 0:00:50
191500 -- (-668.344) (-670.165) [-669.990] (-670.491) * (-669.661) (-667.780) (-670.320) [-669.205] -- 0:00:50
192000 -- (-672.540) [-669.185] (-674.149) (-670.509) * (-670.683) (-667.874) (-671.015) [-669.788] -- 0:00:50
192500 -- [-668.136] (-669.370) (-667.877) (-668.517) * (-668.737) [-667.366] (-670.448) (-669.274) -- 0:00:50
193000 -- (-667.966) (-670.302) [-670.176] (-676.135) * (-667.221) (-667.478) (-670.125) [-668.855] -- 0:00:50
193500 -- (-667.306) (-670.611) (-672.207) [-669.550] * (-669.618) (-670.728) [-667.762] (-668.947) -- 0:00:50
194000 -- (-667.903) (-675.103) [-668.243] (-668.016) * [-670.980] (-668.361) (-670.500) (-667.699) -- 0:00:49
194500 -- (-667.467) (-669.913) [-668.353] (-667.567) * [-669.667] (-668.101) (-668.149) (-669.864) -- 0:00:49
195000 -- [-667.661] (-668.490) (-668.614) (-673.775) * [-672.029] (-670.994) (-667.037) (-670.284) -- 0:00:49
Average standard deviation of split frequencies: 0.015823
195500 -- (-669.223) (-669.456) (-672.103) [-668.595] * [-667.588] (-669.718) (-666.938) (-667.423) -- 0:00:49
196000 -- (-667.921) (-667.465) [-667.777] (-669.797) * (-670.762) (-667.845) (-667.464) [-671.891] -- 0:00:49
196500 -- (-667.039) [-672.187] (-668.303) (-674.879) * [-669.406] (-668.499) (-666.990) (-669.199) -- 0:00:49
197000 -- (-668.477) (-672.153) [-668.986] (-667.931) * (-668.511) [-670.193] (-667.590) (-670.116) -- 0:00:48
197500 -- (-670.615) (-668.111) [-669.760] (-668.394) * (-671.945) (-668.537) (-673.729) [-669.916] -- 0:00:48
198000 -- (-669.074) (-669.278) (-668.223) [-667.341] * (-667.164) (-667.427) [-672.807] (-667.982) -- 0:00:48
198500 -- [-669.763] (-666.983) (-668.448) (-668.800) * [-668.123] (-671.899) (-670.808) (-669.783) -- 0:00:48
199000 -- (-668.621) [-667.987] (-667.905) (-668.460) * (-668.264) [-668.716] (-667.211) (-668.413) -- 0:00:48
199500 -- [-668.547] (-673.117) (-669.632) (-668.007) * (-670.461) (-668.389) [-668.105] (-668.143) -- 0:00:48
200000 -- [-667.822] (-673.463) (-667.614) (-672.355) * (-667.218) (-667.200) [-671.470] (-670.905) -- 0:00:48
Average standard deviation of split frequencies: 0.016183
200500 -- [-671.052] (-669.161) (-670.024) (-669.930) * (-667.914) [-670.476] (-668.400) (-669.394) -- 0:00:47
201000 -- (-671.039) (-668.394) (-670.264) [-668.348] * (-669.141) (-670.672) (-667.029) [-670.160] -- 0:00:47
201500 -- (-668.901) [-667.668] (-669.524) (-668.940) * (-668.292) (-668.419) [-672.989] (-668.930) -- 0:00:47
202000 -- (-667.703) [-669.215] (-666.917) (-669.456) * (-667.184) [-667.181] (-671.573) (-669.519) -- 0:00:47
202500 -- (-667.472) (-667.492) (-668.514) [-668.568] * [-668.529] (-671.090) (-669.528) (-669.493) -- 0:00:47
203000 -- (-667.543) [-669.994] (-670.819) (-669.750) * (-671.297) (-668.169) [-668.449] (-668.359) -- 0:00:47
203500 -- (-668.957) (-668.255) [-670.193] (-668.432) * (-673.640) [-668.385] (-671.804) (-669.084) -- 0:00:46
204000 -- (-668.161) (-669.190) (-672.388) [-668.505] * [-672.832] (-667.304) (-668.983) (-666.566) -- 0:00:50
204500 -- [-670.540] (-670.475) (-673.342) (-667.165) * [-670.776] (-668.586) (-668.395) (-670.380) -- 0:00:50
205000 -- (-671.151) [-668.251] (-668.774) (-667.350) * (-667.625) [-666.899] (-668.649) (-671.007) -- 0:00:50
Average standard deviation of split frequencies: 0.014747
205500 -- (-667.705) [-670.344] (-669.941) (-667.416) * (-668.005) (-669.643) (-667.450) [-672.030] -- 0:00:50
206000 -- [-668.460] (-668.247) (-669.481) (-667.995) * (-667.638) (-672.530) (-666.979) [-667.751] -- 0:00:50
206500 -- [-667.055] (-670.060) (-669.014) (-672.807) * (-668.870) (-672.852) (-668.507) [-668.033] -- 0:00:49
207000 -- [-668.553] (-669.733) (-668.454) (-670.291) * (-668.361) [-670.734] (-667.848) (-669.152) -- 0:00:49
207500 -- [-667.594] (-669.222) (-666.930) (-674.221) * (-667.587) (-668.135) [-667.071] (-672.725) -- 0:00:49
208000 -- (-670.629) (-669.579) (-666.434) [-671.168] * (-667.066) (-669.671) [-667.146] (-675.101) -- 0:00:49
208500 -- (-668.769) [-670.954] (-669.379) (-668.522) * (-668.065) (-667.793) (-667.919) [-671.624] -- 0:00:49
209000 -- (-669.185) (-669.302) (-667.599) [-669.155] * [-668.688] (-670.496) (-668.759) (-668.009) -- 0:00:49
209500 -- (-671.065) (-668.186) (-669.476) [-668.316] * (-666.899) (-668.764) [-666.949] (-670.260) -- 0:00:49
210000 -- [-670.175] (-670.588) (-671.965) (-667.573) * (-670.155) (-669.154) (-668.870) [-668.254] -- 0:00:48
Average standard deviation of split frequencies: 0.015539
210500 -- (-667.610) [-667.979] (-668.588) (-667.518) * [-667.563] (-668.561) (-667.723) (-668.983) -- 0:00:48
211000 -- (-668.681) (-667.701) (-668.724) [-668.100] * (-669.192) [-668.245] (-669.239) (-668.850) -- 0:00:48
211500 -- (-669.246) (-668.218) (-668.796) [-672.526] * (-670.824) (-667.038) [-674.017] (-671.838) -- 0:00:48
212000 -- (-673.408) [-671.660] (-667.659) (-672.279) * (-667.966) (-667.722) (-667.988) [-668.269] -- 0:00:48
212500 -- (-670.288) [-667.180] (-667.985) (-669.737) * (-669.460) [-666.721] (-670.824) (-670.749) -- 0:00:48
213000 -- [-669.828] (-667.399) (-668.516) (-669.278) * [-671.559] (-667.296) (-667.641) (-668.617) -- 0:00:48
213500 -- (-668.186) (-670.518) [-668.307] (-668.768) * [-669.790] (-666.934) (-672.561) (-669.104) -- 0:00:47
214000 -- (-666.745) (-669.987) (-668.358) [-667.354] * [-667.885] (-667.631) (-668.842) (-668.807) -- 0:00:47
214500 -- [-666.866] (-673.560) (-668.972) (-669.643) * [-666.907] (-667.629) (-669.593) (-670.882) -- 0:00:47
215000 -- (-674.353) (-672.493) (-674.868) [-668.639] * [-667.099] (-669.528) (-668.002) (-667.584) -- 0:00:47
Average standard deviation of split frequencies: 0.015883
215500 -- (-667.809) (-667.617) (-674.620) [-668.779] * [-667.407] (-670.742) (-671.130) (-669.350) -- 0:00:47
216000 -- [-668.910] (-669.397) (-671.528) (-668.187) * (-670.055) (-668.053) [-667.114] (-669.302) -- 0:00:47
216500 -- (-668.199) (-669.071) (-674.319) [-673.508] * (-670.329) (-667.334) [-668.909] (-669.349) -- 0:00:47
217000 -- (-667.574) [-669.371] (-671.123) (-667.125) * (-670.611) (-670.995) [-667.747] (-668.137) -- 0:00:46
217500 -- (-668.226) (-669.330) [-670.346] (-670.382) * (-668.749) (-671.311) (-667.720) [-667.120] -- 0:00:46
218000 -- (-667.315) [-671.487] (-670.264) (-670.385) * (-668.701) (-668.126) [-667.596] (-669.317) -- 0:00:46
218500 -- [-670.267] (-668.143) (-668.903) (-667.096) * (-667.474) [-668.053] (-670.523) (-671.069) -- 0:00:46
219000 -- (-667.235) [-667.186] (-668.522) (-667.038) * (-667.617) [-667.653] (-669.978) (-668.211) -- 0:00:46
219500 -- [-668.475] (-669.365) (-666.832) (-668.069) * (-667.341) [-669.669] (-671.359) (-668.776) -- 0:00:46
220000 -- [-667.038] (-667.866) (-667.303) (-669.731) * [-667.186] (-670.594) (-672.418) (-670.270) -- 0:00:46
Average standard deviation of split frequencies: 0.016972
220500 -- (-668.196) (-667.489) [-668.866] (-667.682) * [-668.691] (-668.220) (-673.582) (-668.301) -- 0:00:49
221000 -- [-669.643] (-667.722) (-669.427) (-667.108) * (-671.301) [-669.543] (-674.512) (-668.616) -- 0:00:49
221500 -- (-667.877) (-667.323) (-669.862) [-667.914] * (-672.110) [-667.500] (-668.908) (-671.427) -- 0:00:49
222000 -- (-669.143) (-667.905) [-669.836] (-667.831) * (-667.157) [-666.824] (-675.012) (-669.188) -- 0:00:49
222500 -- [-667.779] (-667.669) (-668.923) (-668.317) * (-672.163) [-669.107] (-669.231) (-667.985) -- 0:00:48
223000 -- (-667.507) (-670.471) [-667.004] (-669.100) * (-669.538) (-669.873) [-667.724] (-668.074) -- 0:00:48
223500 -- (-668.921) (-667.916) [-667.689] (-668.868) * [-667.774] (-669.969) (-668.330) (-668.814) -- 0:00:48
224000 -- (-667.202) [-666.897] (-669.651) (-669.088) * [-669.526] (-671.564) (-669.121) (-668.670) -- 0:00:48
224500 -- [-669.118] (-669.454) (-669.415) (-668.915) * [-667.360] (-667.574) (-671.952) (-670.412) -- 0:00:48
225000 -- [-667.850] (-668.795) (-669.276) (-670.347) * (-666.779) (-667.510) [-671.999] (-674.341) -- 0:00:48
Average standard deviation of split frequencies: 0.015296
225500 -- (-667.997) (-668.302) [-668.868] (-669.946) * (-671.417) [-667.261] (-669.416) (-667.626) -- 0:00:48
226000 -- (-667.213) (-670.172) (-668.441) [-668.907] * (-669.288) [-667.842] (-669.333) (-673.904) -- 0:00:47
226500 -- (-668.162) (-667.867) (-668.656) [-667.578] * [-668.526] (-668.928) (-678.196) (-672.665) -- 0:00:47
227000 -- [-669.715] (-667.243) (-667.496) (-666.904) * (-667.511) (-668.157) (-674.612) [-672.642] -- 0:00:47
227500 -- (-668.115) (-673.623) [-668.128] (-668.353) * (-667.428) [-668.909] (-671.614) (-670.526) -- 0:00:47
228000 -- (-666.867) (-670.282) [-669.905] (-668.719) * (-668.881) [-667.137] (-669.952) (-670.066) -- 0:00:47
228500 -- (-666.871) [-667.785] (-666.966) (-668.677) * (-666.905) (-669.988) [-667.925] (-669.274) -- 0:00:47
229000 -- (-668.260) (-669.176) (-668.795) [-669.650] * [-673.701] (-668.446) (-669.125) (-669.827) -- 0:00:47
229500 -- [-668.441] (-667.833) (-667.132) (-669.107) * (-671.177) [-667.343] (-668.475) (-668.066) -- 0:00:47
230000 -- (-668.102) (-669.303) (-667.904) [-670.876] * (-670.758) [-668.339] (-668.377) (-674.219) -- 0:00:46
Average standard deviation of split frequencies: 0.014760
230500 -- (-669.502) (-668.286) (-668.156) [-668.276] * (-671.305) (-667.319) (-670.736) [-666.941] -- 0:00:46
231000 -- (-668.618) [-668.907] (-667.878) (-680.342) * [-667.990] (-668.551) (-668.124) (-667.590) -- 0:00:46
231500 -- (-667.553) (-670.806) [-668.001] (-671.429) * [-667.906] (-675.487) (-669.760) (-669.027) -- 0:00:46
232000 -- [-668.829] (-669.916) (-669.066) (-668.270) * [-667.546] (-670.472) (-670.352) (-670.163) -- 0:00:46
232500 -- (-668.963) (-670.206) [-669.404] (-668.038) * (-667.506) (-669.825) (-673.132) [-669.976] -- 0:00:46
233000 -- (-668.701) (-669.154) [-666.665] (-667.617) * (-670.023) (-675.097) (-668.863) [-667.247] -- 0:00:46
233500 -- [-673.658] (-669.367) (-666.554) (-667.846) * (-667.887) [-668.950] (-674.961) (-669.869) -- 0:00:45
234000 -- [-672.299] (-670.712) (-667.953) (-670.566) * [-667.736] (-669.617) (-671.131) (-667.271) -- 0:00:45
234500 -- [-668.720] (-668.233) (-668.222) (-671.426) * [-668.232] (-668.620) (-670.526) (-667.369) -- 0:00:45
235000 -- [-668.283] (-667.866) (-668.711) (-670.534) * (-670.214) [-666.997] (-668.484) (-668.660) -- 0:00:45
Average standard deviation of split frequencies: 0.014426
235500 -- [-667.829] (-667.761) (-667.833) (-668.906) * [-667.654] (-668.697) (-671.315) (-668.564) -- 0:00:45
236000 -- [-669.736] (-670.812) (-670.731) (-668.570) * (-671.241) (-668.540) [-667.830] (-669.060) -- 0:00:45
236500 -- (-667.619) (-669.457) (-671.056) [-670.012] * [-667.883] (-668.963) (-668.492) (-667.214) -- 0:00:45
237000 -- (-667.976) [-675.268] (-668.865) (-667.778) * (-666.769) [-670.055] (-667.529) (-667.583) -- 0:00:45
237500 -- (-667.639) (-668.816) (-669.417) [-669.196] * [-670.826] (-671.223) (-668.208) (-668.618) -- 0:00:48
238000 -- (-667.589) (-669.250) (-669.555) [-667.832] * [-667.608] (-668.146) (-668.115) (-668.805) -- 0:00:48
238500 -- (-667.432) [-669.125] (-673.841) (-667.122) * (-668.396) (-669.272) (-668.378) [-670.399] -- 0:00:47
239000 -- [-668.591] (-670.540) (-667.345) (-668.316) * (-672.729) [-668.701] (-667.289) (-677.192) -- 0:00:47
239500 -- [-666.966] (-669.347) (-669.211) (-668.315) * (-672.144) (-668.730) [-668.535] (-669.963) -- 0:00:47
240000 -- (-667.159) [-667.027] (-672.436) (-669.484) * [-671.668] (-669.058) (-666.934) (-668.391) -- 0:00:47
Average standard deviation of split frequencies: 0.014146
240500 -- (-668.946) (-670.716) [-668.996] (-669.907) * [-667.639] (-669.451) (-668.433) (-670.321) -- 0:00:47
241000 -- (-667.903) (-670.213) [-669.058] (-670.670) * [-670.088] (-670.386) (-672.623) (-669.630) -- 0:00:47
241500 -- [-669.157] (-668.154) (-667.824) (-672.509) * (-667.215) (-667.412) (-671.356) [-667.095] -- 0:00:47
242000 -- (-669.359) (-668.165) [-670.053] (-672.346) * (-670.131) (-669.928) (-669.885) [-667.411] -- 0:00:46
242500 -- (-671.707) [-671.070] (-667.524) (-668.805) * (-669.580) (-668.497) [-670.646] (-668.968) -- 0:00:46
243000 -- [-671.044] (-668.151) (-667.821) (-671.459) * [-669.546] (-670.575) (-669.340) (-670.887) -- 0:00:46
243500 -- (-671.800) (-669.776) (-668.088) [-670.324] * [-669.261] (-672.078) (-670.825) (-666.942) -- 0:00:46
244000 -- (-668.547) (-667.940) (-669.004) [-667.532] * (-668.439) (-668.920) (-668.948) [-668.554] -- 0:00:46
244500 -- (-669.776) (-670.744) (-669.188) [-668.602] * (-668.471) (-673.500) [-666.924] (-667.896) -- 0:00:46
245000 -- [-666.846] (-670.622) (-669.740) (-668.140) * [-667.764] (-669.399) (-668.265) (-669.241) -- 0:00:46
Average standard deviation of split frequencies: 0.013414
245500 -- [-668.202] (-671.832) (-667.300) (-668.903) * (-668.270) (-668.130) [-668.130] (-670.709) -- 0:00:46
246000 -- (-668.876) (-667.268) [-667.582] (-669.909) * (-669.019) [-671.985] (-668.276) (-670.065) -- 0:00:45
246500 -- (-668.617) (-671.316) (-668.704) [-668.488] * (-671.749) (-671.638) [-667.444] (-667.732) -- 0:00:45
247000 -- (-668.140) (-669.077) [-667.211] (-667.123) * (-674.206) (-669.993) [-666.991] (-670.462) -- 0:00:45
247500 -- [-669.985] (-667.541) (-667.671) (-670.655) * (-669.703) (-668.676) [-668.876] (-671.731) -- 0:00:45
248000 -- (-671.482) (-669.723) (-668.545) [-669.105] * (-671.101) (-667.925) [-670.095] (-675.150) -- 0:00:45
248500 -- (-669.453) [-668.657] (-668.900) (-670.939) * (-667.705) (-667.446) (-670.567) [-670.781] -- 0:00:45
249000 -- (-667.935) (-668.245) (-667.536) [-667.067] * (-669.799) [-670.590] (-668.460) (-671.663) -- 0:00:45
249500 -- [-667.361] (-669.374) (-669.980) (-669.090) * (-666.888) (-669.384) (-667.690) [-667.077] -- 0:00:45
250000 -- [-668.548] (-673.377) (-668.800) (-676.754) * (-675.027) (-668.297) [-667.414] (-668.170) -- 0:00:45
Average standard deviation of split frequencies: 0.014105
250500 -- (-667.308) [-667.473] (-668.046) (-672.280) * (-672.599) (-668.293) [-667.863] (-670.904) -- 0:00:44
251000 -- (-668.960) (-667.264) [-669.794] (-667.898) * [-669.572] (-669.447) (-671.649) (-670.004) -- 0:00:44
251500 -- (-667.968) (-669.398) (-673.295) [-667.538] * [-670.256] (-669.137) (-666.931) (-669.004) -- 0:00:44
252000 -- (-668.413) [-670.638] (-670.144) (-670.011) * [-674.618] (-669.436) (-667.225) (-670.095) -- 0:00:44
252500 -- (-667.789) [-667.491] (-668.526) (-673.867) * (-669.617) (-667.431) [-668.794] (-668.484) -- 0:00:44
253000 -- [-667.493] (-668.836) (-668.225) (-668.077) * (-669.580) [-668.705] (-676.952) (-670.664) -- 0:00:44
253500 -- [-669.350] (-671.352) (-673.028) (-668.519) * (-668.311) [-667.548] (-672.064) (-669.218) -- 0:00:44
254000 -- (-668.559) [-667.751] (-667.291) (-668.194) * (-672.998) (-666.723) [-669.437] (-672.848) -- 0:00:46
254500 -- (-669.054) (-667.752) [-669.719] (-669.055) * [-668.246] (-669.716) (-671.565) (-669.982) -- 0:00:46
255000 -- (-668.670) (-669.684) (-667.630) [-668.773] * (-667.809) (-669.626) (-668.847) [-667.544] -- 0:00:46
Average standard deviation of split frequencies: 0.013606
255500 -- (-669.194) (-671.720) [-668.024] (-668.984) * [-667.363] (-668.014) (-672.825) (-669.275) -- 0:00:46
256000 -- [-667.965] (-667.844) (-672.397) (-669.026) * (-667.859) [-666.665] (-669.953) (-670.939) -- 0:00:46
256500 -- (-668.814) (-668.937) [-669.794] (-669.655) * (-668.812) (-668.744) (-669.576) [-671.733] -- 0:00:46
257000 -- (-673.683) (-671.321) (-667.854) [-669.150] * (-669.535) [-667.459] (-668.989) (-669.745) -- 0:00:46
257500 -- (-667.124) (-671.556) (-666.912) [-669.522] * (-668.491) (-669.652) (-673.214) [-668.389] -- 0:00:46
258000 -- (-668.553) (-668.202) [-667.211] (-671.829) * (-672.164) (-669.375) [-666.797] (-668.305) -- 0:00:46
258500 -- (-669.016) (-669.088) [-672.209] (-671.003) * [-668.316] (-668.506) (-671.423) (-668.449) -- 0:00:45
259000 -- (-669.766) (-670.658) [-669.837] (-668.651) * (-670.763) (-667.820) [-667.250] (-677.598) -- 0:00:45
259500 -- (-668.508) (-671.620) (-667.976) [-671.432] * (-667.059) [-666.920] (-668.230) (-673.084) -- 0:00:45
260000 -- (-671.110) (-669.098) [-667.155] (-670.634) * [-667.262] (-668.148) (-670.981) (-668.543) -- 0:00:45
Average standard deviation of split frequencies: 0.013362
260500 -- [-668.172] (-670.449) (-667.581) (-666.934) * (-669.601) (-668.164) [-669.471] (-672.569) -- 0:00:45
261000 -- [-669.762] (-670.203) (-668.507) (-666.806) * (-666.903) [-667.122] (-671.721) (-671.389) -- 0:00:45
261500 -- (-670.510) (-667.833) [-668.378] (-670.000) * (-670.175) (-666.699) [-667.539] (-667.040) -- 0:00:45
262000 -- (-666.893) [-668.415] (-667.300) (-668.016) * (-668.565) [-668.269] (-670.273) (-666.880) -- 0:00:45
262500 -- (-666.909) (-669.450) [-668.217] (-668.665) * (-670.481) (-669.128) (-669.644) [-669.500] -- 0:00:44
263000 -- (-670.107) (-668.986) [-669.590] (-670.795) * [-667.006] (-669.417) (-668.945) (-676.887) -- 0:00:44
263500 -- (-670.652) (-671.033) (-668.181) [-667.858] * (-666.821) (-677.731) [-670.043] (-675.783) -- 0:00:44
264000 -- [-669.102] (-672.089) (-670.742) (-673.798) * (-667.664) (-670.904) [-668.807] (-668.775) -- 0:00:44
264500 -- (-666.964) [-670.073] (-671.304) (-669.490) * (-668.366) (-669.833) [-667.837] (-667.806) -- 0:00:44
265000 -- (-668.055) (-668.390) (-667.069) [-666.830] * [-667.656] (-670.434) (-667.327) (-667.696) -- 0:00:44
Average standard deviation of split frequencies: 0.012799
265500 -- (-667.635) (-668.173) (-667.864) [-670.365] * (-667.439) (-670.410) [-668.349] (-669.186) -- 0:00:44
266000 -- (-667.651) (-668.670) (-670.675) [-671.927] * (-667.572) [-669.578] (-669.441) (-668.669) -- 0:00:44
266500 -- (-669.632) [-670.660] (-671.706) (-667.690) * [-668.176] (-668.445) (-669.543) (-668.649) -- 0:00:44
267000 -- (-671.742) (-672.137) (-671.683) [-670.510] * (-667.350) [-667.974] (-668.108) (-667.865) -- 0:00:43
267500 -- (-671.109) (-667.736) (-668.053) [-667.148] * (-671.942) (-668.664) (-672.269) [-668.717] -- 0:00:43
268000 -- (-667.758) (-668.075) [-671.875] (-667.183) * (-669.971) (-670.949) [-669.387] (-671.351) -- 0:00:43
268500 -- [-668.006] (-667.395) (-667.682) (-667.764) * (-671.519) (-670.098) (-669.131) [-668.778] -- 0:00:43
269000 -- (-670.468) [-666.847] (-668.790) (-669.377) * [-671.914] (-670.347) (-669.504) (-668.781) -- 0:00:43
269500 -- [-668.063] (-669.192) (-668.285) (-668.739) * (-668.384) [-667.943] (-667.217) (-669.163) -- 0:00:43
270000 -- (-668.662) (-667.180) (-667.996) [-668.992] * (-672.540) (-669.695) [-667.220] (-668.313) -- 0:00:43
Average standard deviation of split frequencies: 0.012288
270500 -- (-669.572) (-668.128) [-668.516] (-668.344) * (-668.012) (-671.849) (-668.844) [-667.091] -- 0:00:43
271000 -- (-667.675) (-669.502) [-672.718] (-668.010) * (-668.174) (-669.781) [-669.609] (-668.900) -- 0:00:45
271500 -- [-667.724] (-670.225) (-671.376) (-669.452) * (-669.696) (-668.095) [-668.293] (-667.791) -- 0:00:45
272000 -- [-668.027] (-669.006) (-667.783) (-668.026) * [-667.917] (-668.965) (-668.127) (-668.142) -- 0:00:45
272500 -- [-670.127] (-667.958) (-667.900) (-669.299) * (-667.213) (-667.749) (-668.690) [-670.358] -- 0:00:45
273000 -- (-673.488) [-667.625] (-668.553) (-668.502) * (-667.108) (-669.077) (-669.310) [-669.896] -- 0:00:45
273500 -- (-667.285) (-668.025) [-667.897] (-669.350) * (-670.791) [-668.026] (-669.674) (-669.154) -- 0:00:45
274000 -- [-667.370] (-669.344) (-669.117) (-666.910) * (-668.538) [-667.206] (-670.662) (-668.312) -- 0:00:45
274500 -- [-670.166] (-668.642) (-667.490) (-671.865) * [-671.801] (-667.826) (-670.900) (-666.957) -- 0:00:44
275000 -- (-669.675) [-667.657] (-669.449) (-669.545) * [-669.275] (-667.363) (-670.482) (-669.070) -- 0:00:44
Average standard deviation of split frequencies: 0.011956
275500 -- [-667.206] (-667.042) (-670.571) (-669.609) * (-670.025) (-669.320) [-667.998] (-667.627) -- 0:00:44
276000 -- (-668.581) (-671.039) [-667.118] (-668.882) * [-669.763] (-674.922) (-669.258) (-668.014) -- 0:00:44
276500 -- (-669.606) (-671.318) [-668.069] (-666.806) * (-674.749) [-672.053] (-669.923) (-671.853) -- 0:00:44
277000 -- (-668.120) (-671.616) [-667.922] (-667.921) * (-674.902) [-669.067] (-670.058) (-667.105) -- 0:00:44
277500 -- (-670.712) (-669.312) (-669.096) [-666.863] * [-669.178] (-668.580) (-668.380) (-670.405) -- 0:00:44
278000 -- (-669.582) (-669.170) [-667.535] (-667.496) * [-672.873] (-671.069) (-669.767) (-669.680) -- 0:00:44
278500 -- (-670.864) (-667.039) (-668.704) [-667.403] * (-671.033) (-668.063) [-670.441] (-669.109) -- 0:00:44
279000 -- [-669.927] (-667.308) (-671.117) (-667.475) * (-670.387) (-669.006) [-670.321] (-668.576) -- 0:00:43
279500 -- (-667.297) (-670.215) (-670.657) [-667.355] * (-669.221) (-669.226) [-667.830] (-668.120) -- 0:00:43
280000 -- (-668.564) (-668.248) [-670.300] (-668.065) * [-668.300] (-667.915) (-668.446) (-667.957) -- 0:00:43
Average standard deviation of split frequencies: 0.012037
280500 -- [-667.653] (-668.259) (-672.472) (-668.549) * (-667.432) (-669.802) (-669.040) [-667.709] -- 0:00:43
281000 -- (-668.473) (-668.055) (-669.960) [-671.537] * [-667.564] (-669.670) (-670.103) (-669.795) -- 0:00:43
281500 -- (-670.952) (-669.170) (-670.295) [-669.196] * [-667.627] (-669.638) (-667.437) (-668.908) -- 0:00:43
282000 -- (-669.064) [-668.422] (-676.367) (-667.937) * [-667.590] (-669.016) (-669.613) (-668.898) -- 0:00:43
282500 -- (-668.727) (-668.983) [-670.981] (-667.403) * (-670.141) (-669.016) [-670.275] (-668.898) -- 0:00:43
283000 -- (-673.472) [-667.420] (-672.763) (-666.535) * (-672.137) (-667.285) (-669.683) [-671.490] -- 0:00:43
283500 -- (-669.474) [-669.337] (-673.155) (-667.689) * (-671.569) [-669.065] (-670.712) (-670.778) -- 0:00:42
284000 -- (-667.258) [-669.722] (-668.556) (-666.738) * (-674.928) [-668.237] (-672.410) (-668.861) -- 0:00:42
284500 -- (-671.617) (-669.853) [-668.553] (-667.554) * (-669.626) (-668.903) [-668.720] (-669.751) -- 0:00:42
285000 -- (-667.047) (-668.068) (-669.161) [-668.684] * (-669.702) (-669.821) [-668.819] (-670.091) -- 0:00:42
Average standard deviation of split frequencies: 0.010931
285500 -- [-670.111] (-672.211) (-667.670) (-668.219) * (-667.419) [-668.111] (-667.731) (-669.190) -- 0:00:42
286000 -- (-671.148) (-668.695) (-667.305) [-667.487] * [-668.681] (-671.157) (-672.332) (-668.537) -- 0:00:42
286500 -- [-668.224] (-669.113) (-666.724) (-671.895) * (-669.280) (-667.193) [-668.858] (-669.417) -- 0:00:42
287000 -- (-669.975) (-668.913) (-668.636) [-668.323] * (-670.286) (-666.877) (-670.076) [-668.928] -- 0:00:42
287500 -- [-667.788] (-668.461) (-669.817) (-670.482) * (-669.491) (-669.532) [-672.634] (-671.503) -- 0:00:42
288000 -- (-668.473) (-667.411) [-674.087] (-669.831) * (-668.899) [-670.269] (-672.181) (-672.863) -- 0:00:44
288500 -- (-667.669) (-667.867) (-668.584) [-668.030] * (-669.003) [-669.086] (-668.838) (-669.727) -- 0:00:44
289000 -- (-667.073) (-667.788) [-669.699] (-668.496) * (-669.301) (-668.128) (-667.557) [-666.989] -- 0:00:44
289500 -- [-668.523] (-669.875) (-667.886) (-669.619) * (-668.349) [-668.047] (-667.032) (-666.968) -- 0:00:44
290000 -- (-669.317) [-667.473] (-673.580) (-669.591) * [-671.574] (-670.139) (-668.668) (-671.652) -- 0:00:44
Average standard deviation of split frequencies: 0.011097
290500 -- (-666.795) (-668.342) [-670.033] (-668.906) * [-668.990] (-669.986) (-668.249) (-670.768) -- 0:00:43
291000 -- [-668.633] (-667.067) (-667.662) (-667.156) * (-668.360) (-667.495) (-666.889) [-667.103] -- 0:00:43
291500 -- (-667.900) [-666.947] (-668.860) (-669.175) * [-669.712] (-668.385) (-666.966) (-668.949) -- 0:00:43
292000 -- (-667.940) [-666.997] (-668.364) (-672.671) * (-672.184) [-668.446] (-667.580) (-671.476) -- 0:00:43
292500 -- [-669.320] (-667.772) (-666.906) (-668.696) * [-667.233] (-668.934) (-668.189) (-669.028) -- 0:00:43
293000 -- (-669.240) (-669.857) [-671.314] (-669.355) * [-668.024] (-669.483) (-670.933) (-669.979) -- 0:00:43
293500 -- (-668.390) (-669.052) (-675.092) [-669.544] * (-667.286) [-671.000] (-670.172) (-671.190) -- 0:00:43
294000 -- [-668.812] (-669.355) (-671.772) (-669.085) * (-671.856) (-671.661) [-668.354] (-667.784) -- 0:00:43
294500 -- (-670.130) (-675.059) [-667.454] (-666.884) * (-675.807) (-669.574) [-669.073] (-671.330) -- 0:00:43
295000 -- (-670.788) (-667.079) [-668.587] (-672.251) * (-669.802) (-668.708) [-668.971] (-669.487) -- 0:00:43
Average standard deviation of split frequencies: 0.010883
295500 -- (-667.754) (-667.641) (-668.079) [-670.490] * (-670.141) [-670.635] (-668.505) (-671.189) -- 0:00:42
296000 -- (-669.882) [-668.249] (-670.715) (-673.632) * (-669.333) [-670.312] (-667.771) (-671.074) -- 0:00:42
296500 -- (-668.815) [-667.410] (-668.872) (-671.931) * [-670.669] (-669.506) (-666.871) (-673.075) -- 0:00:42
297000 -- (-667.371) [-671.376] (-669.330) (-667.541) * [-668.819] (-673.304) (-666.903) (-670.628) -- 0:00:42
297500 -- [-668.488] (-672.107) (-667.508) (-670.156) * (-672.570) (-669.602) [-667.549] (-669.518) -- 0:00:42
298000 -- (-667.480) (-669.721) (-668.532) [-670.664] * [-671.507] (-668.145) (-671.982) (-670.775) -- 0:00:42
298500 -- (-669.194) [-667.584] (-671.030) (-668.603) * [-670.566] (-667.384) (-669.819) (-666.896) -- 0:00:42
299000 -- (-669.507) (-671.996) [-668.362] (-667.513) * (-667.439) (-668.494) (-669.939) [-667.593] -- 0:00:42
299500 -- (-672.327) (-669.271) (-670.062) [-668.376] * [-667.916] (-667.752) (-669.519) (-670.640) -- 0:00:42
300000 -- (-671.175) (-669.825) (-671.316) [-671.951] * [-667.215] (-669.546) (-666.917) (-670.802) -- 0:00:42
Average standard deviation of split frequencies: 0.010975
300500 -- [-670.109] (-670.516) (-667.488) (-670.212) * (-669.421) [-670.186] (-671.358) (-667.790) -- 0:00:41
301000 -- (-668.502) (-668.504) [-668.380] (-672.082) * (-668.040) [-668.343] (-671.930) (-669.985) -- 0:00:41
301500 -- (-672.002) (-669.938) (-668.983) [-668.996] * (-669.376) [-672.375] (-668.555) (-671.310) -- 0:00:41
302000 -- (-670.958) (-668.137) [-667.806] (-667.353) * (-668.406) [-667.892] (-669.366) (-668.341) -- 0:00:41
302500 -- (-671.664) (-668.484) (-668.842) [-667.909] * (-673.441) (-669.800) (-670.522) [-669.188] -- 0:00:41
303000 -- [-669.019] (-668.356) (-668.314) (-670.088) * (-667.430) (-671.795) (-672.341) [-668.123] -- 0:00:41
303500 -- [-668.085] (-667.886) (-672.268) (-670.023) * (-669.896) (-668.589) (-668.877) [-668.803] -- 0:00:41
304000 -- (-668.730) (-671.007) (-669.010) [-674.503] * (-669.429) (-668.109) (-668.270) [-668.526] -- 0:00:41
304500 -- (-671.080) (-671.100) [-669.092] (-667.579) * (-672.681) (-669.867) (-668.128) [-668.626] -- 0:00:43
305000 -- (-669.306) [-667.513] (-668.871) (-669.218) * (-667.735) (-669.516) (-666.827) [-668.975] -- 0:00:43
Average standard deviation of split frequencies: 0.010622
305500 -- [-668.822] (-673.845) (-667.126) (-671.221) * (-667.616) (-668.264) [-667.002] (-672.718) -- 0:00:43
306000 -- (-670.506) (-670.360) (-667.340) [-671.426] * [-667.168] (-667.791) (-666.782) (-670.360) -- 0:00:43
306500 -- [-670.281] (-670.559) (-667.925) (-668.740) * (-668.163) [-669.280] (-666.937) (-667.738) -- 0:00:42
307000 -- (-670.138) (-667.595) [-668.717] (-676.411) * (-672.500) (-669.043) (-668.663) [-667.776] -- 0:00:42
307500 -- (-668.225) (-668.148) [-671.756] (-670.488) * (-668.713) (-667.500) (-670.492) [-670.077] -- 0:00:42
308000 -- (-667.863) (-668.286) [-668.407] (-670.513) * [-668.291] (-668.516) (-668.145) (-673.129) -- 0:00:42
308500 -- (-669.567) (-668.644) [-667.733] (-668.516) * [-669.934] (-668.818) (-669.595) (-669.265) -- 0:00:42
309000 -- [-668.801] (-670.643) (-668.611) (-672.304) * (-671.033) [-669.188] (-670.441) (-668.951) -- 0:00:42
309500 -- (-667.698) [-668.320] (-671.051) (-670.852) * [-672.017] (-669.795) (-667.927) (-668.174) -- 0:00:42
310000 -- (-668.692) [-669.357] (-671.867) (-667.870) * [-667.072] (-671.693) (-669.319) (-666.914) -- 0:00:42
Average standard deviation of split frequencies: 0.011021
310500 -- (-672.076) (-667.505) (-669.858) [-667.409] * [-668.642] (-668.191) (-669.777) (-670.499) -- 0:00:42
311000 -- (-669.152) [-667.380] (-670.428) (-667.472) * (-667.901) [-667.425] (-668.824) (-667.362) -- 0:00:42
311500 -- (-668.375) (-669.530) (-667.096) [-667.547] * (-667.431) [-667.425] (-668.056) (-669.641) -- 0:00:41
312000 -- (-667.266) [-669.378] (-669.441) (-668.215) * (-669.723) (-669.477) [-668.040] (-668.568) -- 0:00:41
312500 -- (-667.409) (-672.623) [-673.415] (-668.016) * (-668.966) (-671.103) (-668.802) [-668.185] -- 0:00:41
313000 -- [-669.796] (-672.298) (-672.455) (-671.423) * [-669.706] (-678.238) (-668.544) (-669.621) -- 0:00:41
313500 -- (-668.961) (-672.199) [-668.159] (-672.705) * (-669.158) (-668.025) (-669.694) [-670.650] -- 0:00:41
314000 -- (-669.685) (-668.162) (-667.470) [-669.155] * (-669.879) [-669.212] (-668.662) (-672.259) -- 0:00:41
314500 -- (-668.243) [-670.603] (-673.294) (-666.977) * (-670.711) (-670.638) (-669.776) [-670.309] -- 0:00:41
315000 -- (-668.695) [-669.782] (-670.535) (-667.957) * (-668.664) (-669.677) (-669.280) [-669.900] -- 0:00:41
Average standard deviation of split frequencies: 0.010521
315500 -- [-670.601] (-667.789) (-671.057) (-667.430) * (-668.856) [-670.064] (-669.326) (-668.045) -- 0:00:41
316000 -- (-672.728) [-669.646] (-669.419) (-668.292) * [-668.973] (-666.732) (-667.595) (-669.796) -- 0:00:41
316500 -- (-667.794) (-669.884) [-668.091] (-668.052) * (-670.373) (-669.133) (-668.853) [-670.182] -- 0:00:41
317000 -- [-668.675] (-669.281) (-667.538) (-668.833) * (-668.905) [-667.790] (-670.216) (-670.698) -- 0:00:40
317500 -- [-667.128] (-668.022) (-668.079) (-670.981) * (-668.996) (-674.849) [-668.191] (-669.719) -- 0:00:40
318000 -- (-668.875) (-667.963) [-667.651] (-674.542) * (-668.384) (-668.093) [-667.363] (-669.226) -- 0:00:40
318500 -- (-669.644) (-669.052) [-669.534] (-668.345) * [-668.569] (-670.739) (-669.158) (-668.721) -- 0:00:40
319000 -- [-671.114] (-670.436) (-669.450) (-669.856) * [-670.990] (-670.706) (-672.882) (-668.699) -- 0:00:40
319500 -- (-672.093) (-668.265) [-668.258] (-668.328) * (-670.861) (-669.301) (-669.328) [-671.517] -- 0:00:40
320000 -- (-668.886) [-667.729] (-667.128) (-668.407) * (-667.067) (-670.234) (-671.219) [-670.404] -- 0:00:40
Average standard deviation of split frequencies: 0.011242
320500 -- (-675.328) [-669.318] (-667.159) (-669.084) * [-667.523] (-668.801) (-670.730) (-671.616) -- 0:00:40
321000 -- (-668.193) (-668.304) (-666.711) [-667.348] * (-671.132) (-672.851) (-669.198) [-668.065] -- 0:00:42
321500 -- (-669.210) (-667.656) (-667.684) [-673.478] * [-668.523] (-667.271) (-669.000) (-670.506) -- 0:00:42
322000 -- (-667.939) (-671.507) [-667.613] (-668.834) * (-669.883) [-668.603] (-669.023) (-667.920) -- 0:00:42
322500 -- (-668.313) [-675.856] (-669.284) (-669.122) * (-670.643) (-668.331) (-669.776) [-670.179] -- 0:00:42
323000 -- (-668.566) (-671.151) (-669.007) [-668.186] * (-668.722) (-667.931) [-668.234] (-667.630) -- 0:00:41
323500 -- [-670.943] (-670.453) (-669.850) (-671.983) * (-668.170) (-668.248) [-670.225] (-667.865) -- 0:00:41
324000 -- (-668.436) (-667.605) (-670.184) [-669.119] * (-673.858) (-668.437) (-668.543) [-668.953] -- 0:00:41
324500 -- (-666.974) (-673.635) (-670.085) [-668.607] * (-672.774) (-668.139) (-668.847) [-669.204] -- 0:00:41
325000 -- [-669.774] (-668.389) (-669.462) (-668.347) * [-667.217] (-668.663) (-671.735) (-667.612) -- 0:00:41
Average standard deviation of split frequencies: 0.010351
325500 -- [-666.895] (-666.934) (-669.341) (-668.199) * (-670.563) [-671.196] (-669.193) (-667.435) -- 0:00:41
326000 -- (-668.910) (-666.792) [-669.837] (-667.824) * (-668.110) (-669.298) [-667.129] (-670.119) -- 0:00:41
326500 -- (-668.654) [-667.098] (-667.158) (-668.524) * (-670.153) [-669.316] (-667.460) (-667.673) -- 0:00:41
327000 -- (-667.376) (-670.829) [-668.153] (-667.333) * (-670.053) (-670.756) [-667.103] (-668.929) -- 0:00:41
327500 -- (-672.204) [-668.931] (-673.151) (-667.858) * (-668.118) (-668.903) [-667.163] (-667.931) -- 0:00:41
328000 -- [-666.586] (-667.733) (-670.067) (-669.265) * [-667.937] (-666.991) (-667.686) (-668.420) -- 0:00:40
328500 -- (-667.769) [-667.949] (-667.734) (-668.885) * (-668.693) (-667.652) [-668.079] (-667.802) -- 0:00:40
329000 -- [-666.556] (-669.600) (-672.652) (-667.908) * (-668.763) [-669.320] (-667.259) (-670.474) -- 0:00:40
329500 -- [-668.229] (-668.284) (-668.414) (-671.558) * (-667.477) [-667.027] (-668.747) (-667.554) -- 0:00:40
330000 -- (-669.779) (-668.227) [-669.093] (-669.432) * (-668.144) [-667.168] (-667.317) (-669.521) -- 0:00:40
Average standard deviation of split frequencies: 0.011070
330500 -- (-667.473) [-671.035] (-667.507) (-668.214) * (-668.724) (-673.089) (-669.046) [-668.010] -- 0:00:40
331000 -- (-672.413) (-668.232) [-668.739] (-670.550) * (-670.763) (-672.559) (-672.575) [-669.118] -- 0:00:40
331500 -- (-668.521) [-671.326] (-669.523) (-669.427) * (-668.714) [-669.035] (-667.667) (-668.491) -- 0:00:40
332000 -- (-667.694) (-671.529) (-668.587) [-666.902] * (-671.443) (-668.960) [-669.150] (-673.373) -- 0:00:40
332500 -- [-669.421] (-670.677) (-667.757) (-668.691) * (-668.603) [-667.988] (-670.394) (-671.551) -- 0:00:40
333000 -- (-669.095) (-669.122) [-673.394] (-669.799) * [-668.752] (-670.533) (-667.200) (-668.725) -- 0:00:40
333500 -- (-668.974) (-668.227) [-667.466] (-670.640) * [-670.016] (-670.674) (-669.753) (-668.885) -- 0:00:39
334000 -- [-668.761] (-667.801) (-668.280) (-670.819) * [-672.790] (-670.069) (-671.182) (-670.525) -- 0:00:39
334500 -- [-668.306] (-667.584) (-668.657) (-669.710) * (-668.418) (-668.704) [-667.518] (-669.556) -- 0:00:39
335000 -- (-674.383) [-672.309] (-668.137) (-668.057) * (-669.209) (-667.071) (-666.826) [-666.544] -- 0:00:39
Average standard deviation of split frequencies: 0.009599
335500 -- (-671.239) (-669.354) [-669.092] (-672.248) * [-666.959] (-668.184) (-669.375) (-672.515) -- 0:00:39
336000 -- (-673.153) (-668.638) [-670.430] (-671.212) * [-668.099] (-672.823) (-672.369) (-671.101) -- 0:00:39
336500 -- (-669.286) (-668.955) (-666.856) [-669.870] * [-667.850] (-668.811) (-672.966) (-671.390) -- 0:00:39
337000 -- (-668.292) [-669.253] (-666.783) (-667.757) * (-667.938) [-669.542] (-666.969) (-669.930) -- 0:00:39
337500 -- (-668.251) (-670.994) (-669.258) [-671.870] * (-667.555) (-669.759) [-666.901] (-668.865) -- 0:00:41
338000 -- (-677.347) (-670.514) [-667.759] (-670.186) * [-667.932] (-670.513) (-666.772) (-667.984) -- 0:00:41
338500 -- [-669.932] (-668.868) (-670.765) (-668.190) * [-668.282] (-669.412) (-667.869) (-668.200) -- 0:00:41
339000 -- [-670.465] (-671.210) (-667.401) (-668.527) * [-669.240] (-673.120) (-668.101) (-667.369) -- 0:00:40
339500 -- [-669.185] (-669.838) (-668.163) (-668.264) * (-670.000) (-672.434) [-668.620] (-667.432) -- 0:00:40
340000 -- (-669.071) (-668.546) [-668.057] (-668.434) * [-669.950] (-667.360) (-669.564) (-667.151) -- 0:00:40
Average standard deviation of split frequencies: 0.010532
340500 -- (-668.651) (-673.560) [-667.517] (-668.314) * (-672.221) [-667.818] (-669.357) (-670.420) -- 0:00:40
341000 -- (-668.357) (-668.016) (-670.410) [-669.300] * (-672.532) (-667.673) [-668.992] (-669.710) -- 0:00:40
341500 -- (-672.529) (-668.663) [-667.411] (-668.570) * (-667.987) (-669.298) [-668.406] (-666.766) -- 0:00:40
342000 -- (-669.213) (-668.397) [-668.274] (-669.345) * (-671.301) (-667.066) [-666.903] (-668.787) -- 0:00:40
342500 -- (-670.194) (-670.341) [-672.624] (-668.627) * (-668.904) (-668.029) (-667.580) [-666.938] -- 0:00:40
343000 -- (-672.590) (-670.930) [-667.662] (-669.849) * (-670.441) [-670.336] (-669.854) (-667.635) -- 0:00:40
343500 -- (-669.015) (-667.959) (-669.333) [-668.639] * (-668.038) [-668.971] (-670.342) (-670.632) -- 0:00:40
344000 -- (-669.760) (-669.773) (-672.429) [-669.081] * [-669.209] (-670.076) (-670.322) (-668.866) -- 0:00:40
344500 -- (-675.088) [-669.391] (-670.310) (-668.606) * (-667.388) (-668.869) (-669.889) [-666.810] -- 0:00:39
345000 -- (-669.878) (-671.819) [-669.707] (-670.565) * [-667.388] (-667.718) (-669.440) (-668.345) -- 0:00:39
Average standard deviation of split frequencies: 0.009967
345500 -- (-667.621) (-667.399) (-669.261) [-668.469] * (-669.344) (-671.139) [-670.421] (-669.912) -- 0:00:39
346000 -- (-669.977) (-668.113) (-670.833) [-668.622] * (-669.361) (-668.829) [-670.962] (-672.497) -- 0:00:39
346500 -- (-668.549) [-670.365] (-669.384) (-669.865) * (-674.266) [-666.844] (-666.693) (-669.141) -- 0:00:39
347000 -- (-668.155) (-669.737) [-669.858] (-667.027) * (-671.853) (-669.889) (-666.857) [-670.669] -- 0:00:39
347500 -- (-670.966) [-667.430] (-672.253) (-668.029) * (-667.876) [-667.225] (-668.084) (-669.192) -- 0:00:39
348000 -- [-669.687] (-667.318) (-667.395) (-671.671) * (-668.939) [-666.906] (-668.058) (-667.491) -- 0:00:39
348500 -- (-669.652) [-668.027] (-668.848) (-668.952) * (-667.702) (-668.981) [-671.825] (-668.354) -- 0:00:39
349000 -- (-669.240) [-667.513] (-668.531) (-671.259) * (-669.475) (-670.735) (-668.696) [-668.576] -- 0:00:39
349500 -- (-669.130) (-669.423) (-670.321) [-669.972] * (-671.715) (-670.928) [-669.043] (-667.444) -- 0:00:39
350000 -- (-668.419) [-668.270] (-669.346) (-669.792) * (-668.076) [-669.417] (-669.076) (-667.681) -- 0:00:39
Average standard deviation of split frequencies: 0.009933
350500 -- (-670.232) (-668.297) [-667.855] (-668.007) * (-670.533) (-670.489) [-669.047] (-667.338) -- 0:00:38
351000 -- (-668.074) [-671.454] (-667.632) (-668.193) * (-670.625) [-669.221] (-667.147) (-667.404) -- 0:00:38
351500 -- [-668.758] (-667.955) (-667.699) (-670.124) * (-669.951) (-669.208) [-669.887] (-668.392) -- 0:00:38
352000 -- (-675.494) (-674.579) [-667.540] (-670.498) * (-672.978) [-671.176] (-669.533) (-669.805) -- 0:00:38
352500 -- [-669.401] (-668.500) (-671.370) (-670.119) * (-673.070) (-671.373) (-668.274) [-667.697] -- 0:00:38
353000 -- (-670.061) [-667.904] (-670.957) (-668.426) * (-667.670) (-670.418) (-669.468) [-668.959] -- 0:00:38
353500 -- (-669.139) (-669.030) (-670.664) [-668.930] * [-670.207] (-673.276) (-669.278) (-670.603) -- 0:00:38
354000 -- (-670.072) (-671.908) (-668.184) [-668.624] * (-667.695) (-667.288) (-668.030) [-669.682] -- 0:00:40
354500 -- (-671.307) (-671.844) (-669.190) [-668.811] * (-667.899) [-666.992] (-667.837) (-669.762) -- 0:00:40
355000 -- (-670.719) [-667.267] (-669.152) (-671.861) * [-670.026] (-668.634) (-670.957) (-668.858) -- 0:00:39
Average standard deviation of split frequencies: 0.009711
355500 -- (-670.653) (-669.799) [-668.940] (-670.003) * (-672.028) (-671.195) [-669.118] (-669.132) -- 0:00:39
356000 -- (-668.665) [-671.263] (-669.214) (-669.292) * (-668.531) [-671.752] (-670.619) (-668.884) -- 0:00:39
356500 -- (-669.764) (-669.090) [-668.559] (-669.858) * (-668.623) [-673.182] (-668.110) (-667.262) -- 0:00:39
357000 -- (-667.693) (-668.852) (-667.747) [-669.168] * (-668.166) (-670.850) [-668.296] (-667.445) -- 0:00:39
357500 -- (-667.997) (-667.897) (-667.773) [-669.656] * [-667.519] (-667.878) (-667.103) (-667.503) -- 0:00:39
358000 -- (-671.991) [-667.881] (-667.870) (-672.563) * (-669.442) (-667.336) (-668.424) [-667.874] -- 0:00:39
358500 -- (-667.488) [-672.345] (-668.250) (-674.738) * (-669.306) (-668.624) [-668.762] (-675.758) -- 0:00:39
359000 -- [-667.519] (-669.902) (-668.944) (-670.695) * [-667.800] (-670.706) (-672.184) (-672.308) -- 0:00:39
359500 -- (-668.983) [-671.169] (-667.572) (-671.219) * (-667.812) (-668.189) (-668.489) [-672.328] -- 0:00:39
360000 -- (-668.789) (-668.539) [-668.802] (-667.131) * (-668.559) (-668.214) [-668.689] (-670.036) -- 0:00:39
Average standard deviation of split frequencies: 0.011400
360500 -- (-668.248) [-667.850] (-671.011) (-670.094) * [-672.814] (-668.952) (-668.040) (-667.816) -- 0:00:39
361000 -- [-668.916] (-669.188) (-669.612) (-670.864) * (-670.745) (-671.539) [-671.011] (-669.546) -- 0:00:38
361500 -- (-671.069) [-667.979] (-667.974) (-669.472) * (-666.715) (-671.229) (-668.422) [-668.285] -- 0:00:38
362000 -- [-667.212] (-667.678) (-669.336) (-667.517) * [-667.159] (-671.398) (-669.703) (-670.751) -- 0:00:38
362500 -- (-668.244) (-671.612) [-668.892] (-667.892) * [-672.634] (-672.574) (-669.364) (-669.241) -- 0:00:38
363000 -- (-669.115) (-668.048) (-671.597) [-667.296] * [-668.542] (-673.221) (-670.888) (-668.004) -- 0:00:38
363500 -- (-669.441) (-667.617) [-668.345] (-670.779) * [-669.407] (-669.251) (-668.603) (-668.242) -- 0:00:38
364000 -- (-669.014) [-666.941] (-668.109) (-669.871) * (-668.335) [-673.301] (-671.357) (-670.318) -- 0:00:38
364500 -- (-668.991) (-666.961) (-669.429) [-671.541] * [-669.934] (-667.968) (-670.263) (-670.319) -- 0:00:38
365000 -- (-671.980) [-667.636] (-667.009) (-668.508) * [-669.209] (-668.435) (-670.654) (-668.023) -- 0:00:38
Average standard deviation of split frequencies: 0.011449
365500 -- (-670.418) (-671.053) (-668.716) [-668.907] * (-670.044) (-668.282) (-671.667) [-668.091] -- 0:00:38
366000 -- [-668.615] (-670.496) (-669.347) (-674.631) * [-669.227] (-667.602) (-668.303) (-668.339) -- 0:00:38
366500 -- [-668.684] (-671.503) (-667.287) (-675.063) * [-667.536] (-668.234) (-668.595) (-672.572) -- 0:00:38
367000 -- (-673.375) [-666.862] (-667.864) (-672.578) * (-669.615) [-669.160] (-667.223) (-667.102) -- 0:00:37
367500 -- (-669.757) [-667.876] (-670.479) (-668.927) * (-668.236) [-670.795] (-669.346) (-670.465) -- 0:00:37
368000 -- (-670.371) (-668.467) (-672.872) [-672.153] * (-666.988) (-671.323) [-667.734] (-669.757) -- 0:00:37
368500 -- [-669.096] (-670.055) (-671.871) (-669.232) * (-667.819) (-675.309) [-667.701] (-671.992) -- 0:00:37
369000 -- (-671.535) (-667.328) [-668.474] (-669.162) * (-668.207) (-669.572) [-667.141] (-671.259) -- 0:00:37
369500 -- (-667.452) (-670.861) (-672.626) [-669.150] * (-668.468) (-669.845) [-670.873] (-667.948) -- 0:00:37
370000 -- (-670.250) (-675.008) [-669.476] (-671.758) * (-666.984) [-670.230] (-667.068) (-667.704) -- 0:00:39
Average standard deviation of split frequencies: 0.011305
370500 -- (-666.920) (-674.706) (-671.567) [-668.355] * [-667.993] (-668.021) (-667.533) (-668.181) -- 0:00:39
371000 -- (-668.758) [-667.756] (-670.744) (-669.600) * (-670.747) (-667.765) [-668.567] (-670.592) -- 0:00:38
371500 -- (-669.554) (-667.788) (-669.236) [-669.036] * (-671.052) (-668.854) [-667.124] (-667.713) -- 0:00:38
372000 -- (-668.446) (-672.405) [-668.126] (-667.915) * [-668.298] (-667.392) (-666.874) (-669.002) -- 0:00:38
372500 -- (-667.773) (-669.172) [-669.960] (-670.747) * (-670.324) (-670.061) [-667.229] (-668.703) -- 0:00:38
373000 -- (-669.331) (-668.168) (-670.764) [-668.816] * [-674.539] (-670.010) (-669.083) (-669.552) -- 0:00:38
373500 -- (-667.613) (-669.172) (-669.992) [-669.323] * (-671.163) (-670.983) (-671.266) [-671.350] -- 0:00:38
374000 -- (-666.866) [-669.495] (-671.764) (-672.837) * (-671.017) [-674.507] (-667.287) (-667.553) -- 0:00:38
374500 -- [-666.973] (-668.131) (-670.682) (-668.390) * (-668.859) (-670.035) (-671.324) [-667.783] -- 0:00:38
375000 -- [-667.626] (-668.738) (-668.140) (-667.441) * [-668.624] (-668.548) (-669.468) (-670.004) -- 0:00:38
Average standard deviation of split frequencies: 0.012169
375500 -- (-669.699) [-670.319] (-668.009) (-669.903) * [-669.519] (-668.423) (-668.633) (-673.375) -- 0:00:38
376000 -- (-668.151) (-669.904) [-672.457] (-672.058) * (-667.194) [-667.907] (-668.111) (-668.739) -- 0:00:38
376500 -- (-668.512) (-668.318) (-673.132) [-672.672] * [-667.677] (-670.466) (-667.760) (-676.759) -- 0:00:38
377000 -- [-668.127] (-667.505) (-667.874) (-674.078) * (-667.479) [-676.089] (-669.533) (-669.433) -- 0:00:38
377500 -- (-668.755) (-670.172) [-669.068] (-668.651) * (-668.162) [-672.246] (-669.508) (-666.996) -- 0:00:37
378000 -- (-670.213) [-668.230] (-668.420) (-671.469) * [-669.252] (-673.691) (-670.238) (-669.168) -- 0:00:37
378500 -- (-668.619) (-668.667) [-670.490] (-671.034) * (-667.881) (-669.184) (-670.057) [-668.905] -- 0:00:37
379000 -- (-668.632) (-670.106) (-669.319) [-668.515] * (-670.053) (-671.423) [-667.706] (-668.665) -- 0:00:37
379500 -- (-668.782) (-670.439) (-674.054) [-672.320] * (-670.059) [-670.439] (-668.108) (-671.145) -- 0:00:37
380000 -- (-669.520) [-666.825] (-669.545) (-670.220) * (-667.962) [-668.363] (-669.705) (-668.554) -- 0:00:37
Average standard deviation of split frequencies: 0.013158
380500 -- (-670.175) (-666.827) [-673.283] (-671.062) * (-668.432) [-668.808] (-667.949) (-666.895) -- 0:00:37
381000 -- (-670.426) (-667.774) (-669.978) [-670.399] * (-669.605) [-666.909] (-672.583) (-668.905) -- 0:00:37
381500 -- [-669.296] (-671.116) (-669.662) (-671.222) * (-669.253) (-668.031) (-670.323) [-669.637] -- 0:00:37
382000 -- (-667.339) (-668.010) (-668.282) [-671.270] * (-670.898) [-669.927] (-668.940) (-669.372) -- 0:00:37
382500 -- [-668.316] (-668.404) (-670.386) (-669.554) * (-669.198) (-670.101) [-667.472] (-668.566) -- 0:00:37
383000 -- (-670.787) [-666.869] (-668.610) (-668.907) * (-669.673) (-668.058) [-667.094] (-670.119) -- 0:00:37
383500 -- (-669.636) [-667.735] (-668.637) (-670.984) * (-669.290) (-669.473) [-667.274] (-670.410) -- 0:00:36
384000 -- [-668.594] (-667.145) (-667.773) (-670.577) * (-669.500) (-668.928) [-674.714] (-672.612) -- 0:00:36
384500 -- (-672.494) [-671.477] (-670.128) (-666.716) * (-668.035) [-669.889] (-675.668) (-668.847) -- 0:00:36
385000 -- (-668.331) (-676.572) (-670.899) [-667.610] * [-668.970] (-669.906) (-671.537) (-670.869) -- 0:00:36
Average standard deviation of split frequencies: 0.012959
385500 -- (-668.220) (-671.200) (-667.915) [-668.787] * (-668.115) (-668.318) (-668.975) [-668.874] -- 0:00:36
386000 -- (-667.555) (-674.820) [-668.490] (-667.104) * (-669.025) (-667.797) [-668.615] (-670.046) -- 0:00:36
386500 -- (-668.924) (-668.830) [-672.164] (-668.028) * (-672.351) (-668.122) [-671.948] (-670.188) -- 0:00:38
387000 -- (-669.127) [-670.268] (-672.704) (-671.890) * (-670.430) (-667.414) [-673.907] (-668.859) -- 0:00:38
387500 -- (-671.986) (-670.166) [-667.984] (-670.915) * (-669.886) [-669.786] (-670.592) (-671.701) -- 0:00:37
388000 -- (-668.089) (-668.595) [-669.486] (-670.494) * (-673.398) [-669.475] (-667.775) (-673.127) -- 0:00:37
388500 -- (-667.082) (-666.743) [-669.586] (-669.213) * [-668.124] (-667.826) (-667.542) (-671.858) -- 0:00:37
389000 -- (-668.132) (-668.314) [-668.965] (-671.239) * (-667.299) (-668.459) (-667.289) [-668.702] -- 0:00:37
389500 -- (-671.140) (-668.210) [-668.745] (-667.988) * (-670.247) (-669.918) (-669.462) [-668.254] -- 0:00:37
390000 -- (-668.540) [-669.274] (-668.300) (-670.007) * (-671.805) (-670.242) [-668.422] (-667.705) -- 0:00:37
Average standard deviation of split frequencies: 0.012536
390500 -- (-667.373) (-670.651) [-667.454] (-672.663) * (-668.018) (-669.471) (-666.899) [-671.312] -- 0:00:37
391000 -- (-670.348) [-671.685] (-668.288) (-672.312) * [-667.336] (-667.579) (-667.140) (-670.342) -- 0:00:37
391500 -- [-667.761] (-670.439) (-668.077) (-670.101) * (-667.522) (-668.387) (-667.117) [-669.942] -- 0:00:37
392000 -- [-668.526] (-668.239) (-668.721) (-669.414) * (-670.321) [-669.700] (-668.024) (-670.085) -- 0:00:37
392500 -- [-667.920] (-670.054) (-669.825) (-669.965) * (-672.023) [-666.844] (-667.338) (-668.265) -- 0:00:37
393000 -- (-668.082) (-667.142) (-668.201) [-672.579] * (-667.121) (-667.899) [-669.192] (-668.610) -- 0:00:37
393500 -- (-667.293) [-667.938] (-670.978) (-668.718) * (-669.286) (-668.040) [-669.028] (-669.431) -- 0:00:36
394000 -- (-668.372) [-668.131] (-667.051) (-670.207) * (-669.520) (-668.389) (-668.157) [-668.515] -- 0:00:36
394500 -- (-667.312) (-669.386) (-672.698) [-668.132] * (-667.866) [-667.606] (-668.139) (-670.158) -- 0:00:36
395000 -- (-668.285) (-669.559) (-667.481) [-667.451] * [-667.448] (-668.615) (-670.474) (-672.780) -- 0:00:36
Average standard deviation of split frequencies: 0.012394
395500 -- (-668.737) (-670.689) (-668.851) [-667.858] * (-674.573) (-667.006) (-669.267) [-671.065] -- 0:00:36
396000 -- (-667.226) (-669.988) [-670.007] (-667.877) * (-673.969) (-666.506) [-667.578] (-673.284) -- 0:00:36
396500 -- (-667.505) (-669.155) (-672.348) [-668.433] * [-673.206] (-670.837) (-669.796) (-669.005) -- 0:00:36
397000 -- (-668.179) (-667.778) (-671.429) [-669.848] * (-669.894) (-667.633) [-671.643] (-667.871) -- 0:00:36
397500 -- [-666.766] (-669.383) (-670.134) (-671.727) * (-668.790) (-668.147) (-669.064) [-668.006] -- 0:00:36
398000 -- (-666.678) [-667.914] (-671.313) (-669.990) * (-671.247) (-674.978) (-670.898) [-667.564] -- 0:00:36
398500 -- [-667.237] (-668.785) (-668.089) (-666.669) * (-667.668) [-672.905] (-667.953) (-667.545) -- 0:00:36
399000 -- (-668.569) (-668.427) (-671.258) [-667.451] * [-669.034] (-668.952) (-667.057) (-667.622) -- 0:00:36
399500 -- (-668.080) (-667.380) (-667.265) [-668.069] * (-667.318) (-668.117) [-668.299] (-667.421) -- 0:00:36
400000 -- [-676.657] (-671.244) (-667.431) (-668.968) * (-667.753) [-666.869] (-669.221) (-666.966) -- 0:00:36
Average standard deviation of split frequencies: 0.012681
400500 -- (-668.635) (-670.347) [-667.766] (-670.608) * (-667.936) (-667.972) [-668.168] (-667.602) -- 0:00:35
401000 -- (-669.128) (-672.141) (-667.380) [-669.316] * (-673.593) [-668.258] (-667.168) (-669.092) -- 0:00:35
401500 -- (-669.290) (-670.257) [-669.233] (-667.176) * (-667.447) [-669.037] (-671.876) (-668.779) -- 0:00:35
402000 -- (-671.416) (-670.993) (-672.743) [-670.463] * (-669.043) (-667.939) [-667.552] (-670.623) -- 0:00:35
402500 -- (-668.810) (-668.120) [-668.476] (-672.309) * [-669.192] (-673.066) (-668.094) (-668.942) -- 0:00:35
403000 -- [-669.550] (-670.341) (-669.361) (-672.481) * [-669.422] (-673.407) (-667.161) (-668.609) -- 0:00:37
403500 -- (-669.131) (-669.752) [-668.596] (-670.021) * (-668.334) [-667.253] (-675.006) (-668.003) -- 0:00:36
404000 -- (-667.816) (-668.966) (-669.875) [-668.612] * [-668.382] (-668.416) (-667.678) (-668.019) -- 0:00:36
404500 -- (-666.757) (-670.664) (-668.736) [-669.561] * (-667.582) [-667.706] (-671.006) (-668.028) -- 0:00:36
405000 -- (-668.106) [-667.827] (-667.893) (-670.298) * (-668.050) [-668.007] (-669.971) (-668.783) -- 0:00:36
Average standard deviation of split frequencies: 0.012222
405500 -- (-667.424) (-669.796) (-671.612) [-669.105] * [-674.792] (-667.752) (-671.605) (-669.048) -- 0:00:36
406000 -- (-668.571) (-667.634) [-669.511] (-669.658) * (-672.205) [-669.207] (-668.617) (-668.595) -- 0:00:36
406500 -- (-670.243) (-671.101) (-667.567) [-672.163] * (-672.240) [-667.517] (-669.293) (-672.582) -- 0:00:36
407000 -- (-669.478) (-671.996) (-667.550) [-670.297] * [-671.858] (-670.472) (-667.959) (-673.366) -- 0:00:36
407500 -- (-670.179) (-670.498) [-668.422] (-667.820) * (-668.817) [-669.845] (-666.946) (-672.453) -- 0:00:36
408000 -- (-670.234) (-671.816) (-667.931) [-668.668] * [-667.927] (-667.898) (-672.516) (-670.365) -- 0:00:36
408500 -- (-667.789) [-669.418] (-670.345) (-667.572) * (-668.339) (-668.181) (-667.930) [-666.923] -- 0:00:36
409000 -- (-669.828) [-669.319] (-668.057) (-668.931) * (-668.287) (-668.758) [-668.039] (-668.280) -- 0:00:36
409500 -- (-669.672) (-667.503) [-671.971] (-667.862) * (-669.613) (-668.247) (-668.086) [-669.537] -- 0:00:36
410000 -- (-670.726) (-669.064) [-669.181] (-669.109) * (-667.714) [-667.738] (-668.035) (-668.025) -- 0:00:35
Average standard deviation of split frequencies: 0.012446
410500 -- [-670.499] (-669.274) (-668.641) (-674.915) * (-671.626) (-667.256) (-668.462) [-670.181] -- 0:00:35
411000 -- (-673.870) (-668.403) (-670.029) [-669.676] * (-676.396) (-668.012) [-669.470] (-669.368) -- 0:00:35
411500 -- (-669.505) (-671.251) (-668.915) [-669.522] * (-669.249) (-668.080) (-669.049) [-669.639] -- 0:00:35
412000 -- (-669.593) (-667.916) [-668.511] (-670.671) * (-676.959) (-669.017) [-668.530] (-669.602) -- 0:00:35
412500 -- (-670.790) [-669.519] (-670.970) (-670.247) * (-674.062) [-670.692] (-672.482) (-669.774) -- 0:00:35
413000 -- (-671.710) [-668.046] (-669.027) (-669.204) * (-669.895) (-670.823) (-670.418) [-670.249] -- 0:00:35
413500 -- [-670.443] (-670.716) (-670.344) (-671.822) * (-670.675) (-670.533) [-668.285] (-669.442) -- 0:00:35
414000 -- (-669.944) (-671.961) [-669.132] (-667.013) * (-667.916) (-669.956) (-672.116) [-669.955] -- 0:00:35
414500 -- (-667.564) (-668.767) (-667.946) [-667.180] * [-671.125] (-668.235) (-669.482) (-667.818) -- 0:00:35
415000 -- (-668.323) (-671.298) (-668.590) [-668.556] * (-669.274) (-669.547) [-669.554] (-668.210) -- 0:00:35
Average standard deviation of split frequencies: 0.012865
415500 -- (-667.699) (-671.376) (-669.565) [-671.289] * (-668.577) (-671.739) [-668.736] (-668.711) -- 0:00:35
416000 -- (-669.911) (-669.893) [-670.400] (-671.733) * (-669.729) (-670.581) [-666.975] (-669.569) -- 0:00:35
416500 -- (-670.651) (-668.289) (-668.226) [-667.425] * (-670.804) (-671.671) [-668.049] (-672.374) -- 0:00:35
417000 -- (-672.197) (-668.368) [-668.313] (-667.198) * (-667.237) (-672.055) (-668.736) [-668.896] -- 0:00:34
417500 -- (-673.756) (-669.506) [-669.437] (-668.194) * (-668.136) [-669.237] (-668.678) (-668.223) -- 0:00:34
418000 -- (-670.089) (-667.932) (-669.467) [-668.663] * (-669.036) (-667.349) [-669.127] (-667.950) -- 0:00:34
418500 -- (-669.041) (-669.369) [-667.169] (-668.536) * [-666.863] (-670.272) (-670.004) (-669.990) -- 0:00:34
419000 -- (-667.728) (-667.475) [-668.456] (-671.084) * [-667.916] (-667.073) (-669.042) (-670.926) -- 0:00:34
419500 -- [-670.267] (-672.171) (-667.571) (-669.575) * [-667.524] (-667.662) (-670.221) (-669.800) -- 0:00:34
420000 -- (-668.948) (-672.132) [-669.442] (-670.023) * (-668.166) (-668.076) [-672.723] (-670.068) -- 0:00:35
Average standard deviation of split frequencies: 0.012788
420500 -- (-667.309) [-671.749] (-671.303) (-670.757) * (-669.405) [-667.789] (-666.904) (-669.426) -- 0:00:35
421000 -- (-666.920) (-670.672) (-669.829) [-668.241] * [-667.891] (-667.454) (-667.487) (-668.296) -- 0:00:35
421500 -- (-672.479) (-676.747) [-667.958] (-668.795) * [-667.832] (-668.687) (-667.357) (-671.617) -- 0:00:35
422000 -- (-667.297) (-674.629) [-667.400] (-668.588) * [-667.805] (-669.823) (-668.132) (-667.891) -- 0:00:35
422500 -- [-669.108] (-669.851) (-668.373) (-670.127) * (-667.237) (-668.636) (-669.712) [-671.338] -- 0:00:35
423000 -- (-669.359) [-669.582] (-668.367) (-671.717) * (-670.547) (-669.892) [-668.913] (-670.273) -- 0:00:35
423500 -- (-670.888) (-669.630) [-669.477] (-674.054) * (-667.487) [-669.710] (-671.218) (-669.007) -- 0:00:35
424000 -- [-668.210] (-671.121) (-668.192) (-670.403) * (-667.677) [-668.413] (-670.346) (-666.795) -- 0:00:35
424500 -- [-667.528] (-667.906) (-669.051) (-669.494) * (-667.297) (-669.406) [-668.438] (-667.693) -- 0:00:35
425000 -- (-669.535) [-666.888] (-667.481) (-668.263) * (-673.807) (-668.683) [-669.809] (-668.943) -- 0:00:35
Average standard deviation of split frequencies: 0.013279
425500 -- [-668.108] (-668.414) (-667.010) (-667.555) * (-667.089) (-669.763) (-672.314) [-669.661] -- 0:00:35
426000 -- (-668.338) (-671.339) (-669.256) [-669.396] * (-668.515) [-671.020] (-669.154) (-667.451) -- 0:00:35
426500 -- (-667.255) (-668.285) (-670.003) [-667.722] * [-667.018] (-668.017) (-669.295) (-667.885) -- 0:00:34
427000 -- (-669.130) [-670.333] (-676.518) (-667.905) * (-672.477) [-668.579] (-669.739) (-666.934) -- 0:00:34
427500 -- (-670.931) (-671.056) (-669.618) [-670.133] * (-669.309) (-668.625) (-668.583) [-667.176] -- 0:00:34
428000 -- (-668.902) (-667.939) (-668.530) [-668.943] * (-670.387) [-666.757] (-668.849) (-667.362) -- 0:00:34
428500 -- [-668.114] (-669.176) (-670.313) (-668.287) * (-667.232) (-671.005) (-669.260) [-666.793] -- 0:00:34
429000 -- (-667.503) (-669.415) (-669.340) [-667.185] * (-667.560) (-668.028) (-667.658) [-667.248] -- 0:00:34
429500 -- (-667.937) (-671.609) (-669.191) [-667.829] * (-668.004) (-668.211) [-667.206] (-668.835) -- 0:00:34
430000 -- (-670.106) (-667.765) [-671.545] (-668.450) * (-667.696) (-670.548) (-668.801) [-669.272] -- 0:00:34
Average standard deviation of split frequencies: 0.013071
430500 -- (-669.198) (-669.341) [-667.937] (-671.013) * (-668.164) (-668.876) [-671.886] (-668.256) -- 0:00:34
431000 -- (-671.106) (-667.477) (-669.138) [-671.653] * (-667.010) [-668.350] (-671.813) (-667.446) -- 0:00:34
431500 -- [-669.706] (-667.603) (-674.417) (-672.464) * [-666.596] (-667.661) (-667.527) (-669.977) -- 0:00:34
432000 -- [-671.016] (-673.977) (-673.976) (-674.322) * (-667.150) (-666.837) (-669.192) [-669.554] -- 0:00:34
432500 -- [-668.714] (-671.820) (-669.368) (-667.457) * [-667.548] (-668.215) (-667.815) (-667.304) -- 0:00:34
433000 -- (-670.314) (-668.439) (-670.094) [-667.828] * (-669.401) (-668.668) (-669.108) [-667.416] -- 0:00:34
433500 -- [-668.495] (-674.339) (-668.729) (-668.013) * (-667.646) (-671.522) [-667.274] (-671.330) -- 0:00:33
434000 -- (-668.434) (-670.135) [-668.110] (-669.419) * [-669.891] (-668.142) (-670.813) (-670.323) -- 0:00:33
434500 -- [-666.899] (-667.659) (-670.013) (-666.483) * [-669.062] (-669.596) (-668.468) (-669.249) -- 0:00:33
435000 -- (-667.154) (-667.269) (-670.576) [-667.835] * (-669.758) [-670.141] (-670.812) (-667.904) -- 0:00:33
Average standard deviation of split frequencies: 0.013229
435500 -- (-667.163) [-669.004] (-668.514) (-671.449) * [-669.473] (-671.265) (-668.564) (-667.077) -- 0:00:33
436000 -- (-666.858) [-667.553] (-669.041) (-667.085) * [-669.115] (-669.649) (-670.411) (-667.969) -- 0:00:33
436500 -- [-668.910] (-668.672) (-671.500) (-668.430) * [-667.075] (-672.021) (-667.582) (-668.457) -- 0:00:34
437000 -- (-668.592) (-671.659) [-671.992] (-667.372) * (-671.169) (-668.666) (-672.481) [-668.166] -- 0:00:34
437500 -- (-667.022) [-669.475] (-669.678) (-669.929) * (-675.086) (-671.335) [-668.707] (-669.468) -- 0:00:34
438000 -- [-668.374] (-667.736) (-668.794) (-667.641) * (-669.778) (-667.729) (-668.215) [-667.836] -- 0:00:34
438500 -- (-667.895) (-668.790) (-668.213) [-669.074] * (-672.120) (-668.754) (-668.474) [-669.043] -- 0:00:34
439000 -- (-669.125) [-667.827] (-670.855) (-668.418) * (-668.615) (-668.214) (-671.191) [-666.993] -- 0:00:34
439500 -- (-669.932) [-668.038] (-668.167) (-667.922) * (-670.997) (-677.233) [-671.456] (-668.220) -- 0:00:34
440000 -- (-674.006) (-670.657) [-669.055] (-667.045) * [-666.940] (-673.065) (-671.387) (-669.656) -- 0:00:34
Average standard deviation of split frequencies: 0.012837
440500 -- [-671.689] (-669.655) (-669.697) (-672.366) * (-668.204) (-668.514) (-670.918) [-669.625] -- 0:00:34
441000 -- (-668.602) (-670.958) [-668.486] (-671.142) * (-667.962) [-667.689] (-670.854) (-669.564) -- 0:00:34
441500 -- (-669.051) [-669.538] (-669.941) (-670.504) * (-667.555) (-667.399) [-673.655] (-669.356) -- 0:00:34
442000 -- (-666.556) (-667.709) (-668.196) [-668.918] * (-672.276) (-672.984) (-669.681) [-666.989] -- 0:00:34
442500 -- (-669.160) (-669.131) (-671.144) [-672.905] * [-668.744] (-671.018) (-667.379) (-667.276) -- 0:00:34
443000 -- [-667.463] (-670.109) (-670.644) (-672.944) * (-672.562) (-669.089) (-673.082) [-668.481] -- 0:00:33
443500 -- (-667.819) (-668.833) [-670.856] (-670.076) * (-671.814) (-670.537) (-668.185) [-672.239] -- 0:00:33
444000 -- (-668.101) (-668.249) [-670.092] (-671.124) * (-669.887) (-670.949) [-669.060] (-668.869) -- 0:00:33
444500 -- (-673.033) (-669.240) (-670.209) [-668.100] * (-671.919) (-670.545) [-668.058] (-667.837) -- 0:00:33
445000 -- (-674.922) [-669.232] (-670.021) (-668.284) * (-670.522) (-668.612) [-669.061] (-667.405) -- 0:00:33
Average standard deviation of split frequencies: 0.012559
445500 -- (-670.119) (-669.899) [-667.409] (-670.225) * (-673.068) [-674.083] (-668.140) (-668.874) -- 0:00:33
446000 -- (-671.857) (-673.167) [-668.880] (-668.335) * (-668.402) (-668.562) [-669.057] (-668.753) -- 0:00:33
446500 -- (-674.014) (-667.262) (-669.673) [-668.345] * (-669.493) [-672.636] (-669.058) (-667.640) -- 0:00:33
447000 -- (-668.246) [-669.276] (-668.675) (-670.593) * (-669.011) (-668.924) [-668.865] (-670.433) -- 0:00:33
447500 -- [-668.207] (-670.711) (-671.569) (-671.361) * (-668.840) (-666.675) [-668.326] (-671.235) -- 0:00:33
448000 -- (-668.712) (-669.591) (-673.326) [-669.345] * (-669.671) (-669.832) [-669.695] (-671.839) -- 0:00:33
448500 -- [-668.270] (-669.727) (-668.217) (-668.998) * [-670.235] (-667.871) (-671.283) (-669.941) -- 0:00:33
449000 -- (-668.410) (-671.309) [-667.468] (-670.460) * (-667.134) (-667.976) [-667.021] (-675.636) -- 0:00:33
449500 -- (-668.102) (-669.015) [-667.474] (-668.357) * (-668.730) (-667.931) [-669.345] (-670.238) -- 0:00:33
450000 -- (-668.111) (-676.001) (-667.396) [-667.667] * [-669.724] (-673.525) (-671.335) (-668.351) -- 0:00:33
Average standard deviation of split frequencies: 0.012614
450500 -- (-670.066) (-668.870) [-666.659] (-667.679) * [-668.269] (-671.794) (-667.564) (-667.509) -- 0:00:32
451000 -- (-672.078) (-667.585) [-670.918] (-669.516) * (-668.100) (-668.433) [-669.888] (-667.611) -- 0:00:32
451500 -- (-670.640) (-671.560) [-670.175] (-672.364) * (-668.774) (-671.003) [-670.914] (-668.399) -- 0:00:32
452000 -- (-668.334) (-669.299) [-669.568] (-671.297) * (-667.087) [-667.226] (-673.206) (-668.582) -- 0:00:32
452500 -- (-670.250) (-669.947) (-673.038) [-670.435] * (-670.012) [-670.487] (-668.239) (-667.852) -- 0:00:32
453000 -- (-669.557) [-668.571] (-669.739) (-668.865) * (-668.698) [-669.920] (-670.337) (-668.616) -- 0:00:33
453500 -- (-669.181) (-669.896) (-667.675) [-667.691] * (-669.485) [-670.516] (-668.703) (-668.906) -- 0:00:33
454000 -- [-670.107] (-668.712) (-670.938) (-667.254) * (-670.439) [-671.472] (-668.162) (-667.294) -- 0:00:33
454500 -- [-670.049] (-668.177) (-668.077) (-668.691) * (-670.718) [-672.188] (-668.165) (-668.678) -- 0:00:33
455000 -- (-670.420) (-668.311) (-668.906) [-667.190] * [-670.099] (-674.559) (-666.941) (-668.699) -- 0:00:33
Average standard deviation of split frequencies: 0.013375
455500 -- (-668.521) [-670.212] (-669.211) (-666.978) * (-667.794) (-668.036) (-670.386) [-667.941] -- 0:00:33
456000 -- (-671.274) [-669.050] (-667.048) (-670.181) * (-669.759) [-668.360] (-668.783) (-668.841) -- 0:00:33
456500 -- [-668.122] (-668.809) (-667.491) (-669.323) * [-668.059] (-668.557) (-668.147) (-668.614) -- 0:00:33
457000 -- [-666.975] (-668.870) (-670.210) (-668.343) * (-669.358) (-668.750) [-668.719] (-670.880) -- 0:00:33
457500 -- (-667.918) [-668.327] (-668.814) (-669.121) * (-673.358) (-672.519) (-668.274) [-668.712] -- 0:00:33
458000 -- (-668.649) [-669.125] (-668.427) (-668.525) * (-673.421) [-670.892] (-666.888) (-669.035) -- 0:00:33
458500 -- (-669.978) (-669.173) [-669.168] (-669.045) * (-670.309) (-672.919) (-669.592) [-669.974] -- 0:00:33
459000 -- (-669.222) (-667.271) [-669.427] (-667.779) * (-668.529) (-669.268) (-669.475) [-669.165] -- 0:00:33
459500 -- (-669.295) (-667.522) [-668.166] (-667.759) * (-668.197) (-669.018) (-670.699) [-672.444] -- 0:00:32
460000 -- (-667.329) [-668.442] (-669.716) (-670.380) * (-667.060) [-669.282] (-668.119) (-669.762) -- 0:00:32
Average standard deviation of split frequencies: 0.013367
460500 -- (-667.918) [-668.513] (-670.764) (-668.149) * (-667.606) (-669.187) [-667.347] (-667.021) -- 0:00:32
461000 -- [-669.182] (-668.969) (-669.790) (-668.017) * (-667.775) (-670.267) (-669.711) [-668.118] -- 0:00:32
461500 -- (-668.867) (-668.044) [-668.509] (-668.632) * [-668.467] (-668.796) (-667.063) (-670.753) -- 0:00:32
462000 -- (-671.365) [-669.470] (-668.581) (-672.285) * [-667.311] (-667.909) (-670.801) (-669.056) -- 0:00:32
462500 -- [-671.158] (-671.486) (-669.134) (-669.055) * (-667.012) (-670.783) [-670.750] (-668.144) -- 0:00:32
463000 -- (-672.721) (-667.692) [-667.467] (-671.208) * [-669.012] (-667.784) (-668.035) (-667.216) -- 0:00:32
463500 -- [-668.930] (-667.191) (-667.944) (-667.387) * (-669.097) [-669.777] (-672.850) (-667.850) -- 0:00:32
464000 -- (-668.926) (-667.830) (-671.571) [-668.317] * (-671.825) [-669.156] (-671.206) (-669.441) -- 0:00:32
464500 -- [-668.885] (-668.295) (-670.047) (-667.961) * (-670.875) (-670.322) (-671.468) [-668.548] -- 0:00:32
465000 -- (-673.363) [-669.925] (-666.575) (-668.055) * (-670.057) (-668.049) (-671.314) [-669.856] -- 0:00:32
Average standard deviation of split frequencies: 0.014099
465500 -- (-669.346) (-670.033) (-670.400) [-668.312] * (-671.376) (-672.804) (-669.049) [-669.956] -- 0:00:32
466000 -- [-667.023] (-669.711) (-669.360) (-667.581) * (-672.975) (-668.579) (-668.719) [-669.417] -- 0:00:32
466500 -- (-668.772) (-672.557) (-668.720) [-668.279] * [-667.465] (-666.899) (-668.705) (-667.787) -- 0:00:32
467000 -- (-668.033) (-670.367) (-669.299) [-669.205] * (-671.901) (-667.713) [-666.970] (-669.185) -- 0:00:31
467500 -- [-668.332] (-669.858) (-669.242) (-668.771) * (-669.663) (-670.720) (-668.593) [-668.140] -- 0:00:31
468000 -- (-668.504) (-667.786) (-667.701) [-669.705] * (-669.574) (-667.629) [-668.493] (-670.151) -- 0:00:31
468500 -- (-668.601) (-669.633) [-666.829] (-667.754) * (-668.046) (-672.052) (-667.824) [-669.588] -- 0:00:31
469000 -- (-669.474) (-670.668) (-667.189) [-668.443] * [-667.532] (-671.124) (-670.161) (-670.057) -- 0:00:31
469500 -- (-667.706) (-667.403) [-668.178] (-670.098) * [-669.464] (-669.680) (-671.644) (-667.532) -- 0:00:31
470000 -- (-671.292) (-669.872) (-670.508) [-667.369] * [-668.278] (-668.760) (-670.065) (-668.372) -- 0:00:32
Average standard deviation of split frequencies: 0.013897
470500 -- (-670.375) (-668.325) [-669.153] (-669.114) * (-668.893) (-670.292) (-667.667) [-667.393] -- 0:00:32
471000 -- (-669.925) (-674.810) (-672.353) [-667.134] * (-667.529) [-667.215] (-667.699) (-668.132) -- 0:00:32
471500 -- (-669.799) (-673.399) [-673.984] (-668.579) * (-667.382) [-669.167] (-667.165) (-667.553) -- 0:00:32
472000 -- (-669.694) [-669.855] (-669.829) (-668.778) * (-671.559) (-668.192) (-668.504) [-666.988] -- 0:00:32
472500 -- [-667.069] (-668.635) (-667.703) (-668.704) * (-672.768) (-668.839) (-669.707) [-669.180] -- 0:00:32
473000 -- (-667.771) [-668.677] (-667.452) (-669.775) * [-671.741] (-669.555) (-672.610) (-668.184) -- 0:00:32
473500 -- (-669.253) (-667.155) (-668.326) [-668.989] * [-672.062] (-670.567) (-670.463) (-669.345) -- 0:00:32
474000 -- (-666.757) (-671.207) [-668.500] (-667.540) * (-670.226) (-667.788) [-673.861] (-668.057) -- 0:00:32
474500 -- (-670.222) [-666.987] (-675.020) (-668.249) * (-670.681) (-668.518) [-670.723] (-667.967) -- 0:00:32
475000 -- (-670.181) (-670.552) (-673.046) [-667.220] * (-668.779) (-669.771) (-671.939) [-668.995] -- 0:00:32
Average standard deviation of split frequencies: 0.014484
475500 -- (-668.246) (-668.113) (-670.913) [-667.220] * [-667.239] (-668.912) (-669.218) (-669.126) -- 0:00:31
476000 -- (-668.680) (-667.584) [-668.105] (-669.276) * (-669.719) [-669.296] (-669.135) (-668.507) -- 0:00:31
476500 -- (-669.874) (-667.233) [-669.598] (-667.872) * (-671.031) [-670.567] (-671.734) (-667.969) -- 0:00:31
477000 -- [-668.505] (-667.269) (-671.633) (-668.095) * [-675.071] (-668.022) (-669.903) (-669.472) -- 0:00:31
477500 -- (-670.471) (-668.500) (-668.875) [-669.587] * (-671.612) (-668.245) [-668.480] (-671.061) -- 0:00:31
478000 -- (-671.102) (-674.633) (-668.091) [-667.840] * (-669.075) (-670.255) (-667.597) [-667.138] -- 0:00:31
478500 -- (-668.245) (-670.292) [-668.362] (-668.728) * [-671.713] (-669.866) (-668.144) (-669.380) -- 0:00:31
479000 -- (-669.116) [-669.528] (-668.562) (-668.243) * [-668.412] (-671.598) (-667.157) (-670.144) -- 0:00:31
479500 -- (-668.613) (-672.240) (-667.258) [-667.875] * (-668.640) (-671.531) (-667.798) [-667.346] -- 0:00:31
480000 -- (-667.514) (-666.711) [-668.240] (-670.088) * [-668.337] (-668.446) (-668.239) (-668.489) -- 0:00:31
Average standard deviation of split frequencies: 0.013615
480500 -- (-670.442) (-668.048) [-666.743] (-667.667) * (-666.756) [-668.564] (-667.847) (-670.312) -- 0:00:31
481000 -- [-667.070] (-668.269) (-671.192) (-667.877) * [-667.577] (-673.156) (-667.813) (-667.471) -- 0:00:31
481500 -- (-669.625) [-669.023] (-670.223) (-669.426) * (-669.790) (-671.423) [-670.192] (-669.708) -- 0:00:31
482000 -- (-667.927) (-673.231) [-668.169] (-673.129) * (-669.781) (-673.480) (-671.265) [-668.204] -- 0:00:31
482500 -- (-668.562) (-668.760) [-670.724] (-669.213) * [-673.754] (-671.405) (-668.183) (-675.014) -- 0:00:31
483000 -- (-669.871) [-671.316] (-671.071) (-672.631) * (-669.264) [-666.787] (-669.122) (-670.300) -- 0:00:31
483500 -- [-669.717] (-668.379) (-670.593) (-669.899) * (-670.218) [-666.777] (-669.225) (-672.993) -- 0:00:30
484000 -- (-671.845) (-668.910) (-674.034) [-667.768] * [-669.407] (-667.943) (-674.266) (-672.534) -- 0:00:30
484500 -- (-667.597) [-669.463] (-671.307) (-667.102) * (-668.569) [-667.545] (-668.771) (-670.451) -- 0:00:30
485000 -- (-666.673) (-669.258) [-668.956] (-672.241) * (-669.146) (-667.923) (-668.984) [-671.217] -- 0:00:30
Average standard deviation of split frequencies: 0.013180
485500 -- (-667.364) [-673.688] (-669.626) (-670.342) * [-667.818] (-670.796) (-669.688) (-671.353) -- 0:00:30
486000 -- (-668.794) (-669.108) [-667.233] (-668.745) * [-666.786] (-667.636) (-670.001) (-668.908) -- 0:00:30
486500 -- [-669.490] (-669.499) (-667.845) (-671.169) * (-666.867) [-667.179] (-673.291) (-671.168) -- 0:00:31
487000 -- (-667.484) (-668.606) [-667.966] (-671.344) * (-667.586) (-666.955) [-668.242] (-669.220) -- 0:00:31
487500 -- (-668.783) [-669.428] (-668.324) (-670.008) * [-668.302] (-667.813) (-667.863) (-668.574) -- 0:00:31
488000 -- (-667.900) [-667.365] (-668.969) (-672.980) * (-667.013) (-670.000) [-667.905] (-668.084) -- 0:00:31
488500 -- (-675.678) (-667.863) (-668.920) [-671.916] * (-666.899) (-667.697) [-672.650] (-669.433) -- 0:00:31
489000 -- (-668.691) (-667.234) [-670.607] (-671.847) * (-668.609) (-674.786) [-667.575] (-669.017) -- 0:00:31
489500 -- [-666.641] (-667.064) (-667.923) (-670.210) * [-669.037] (-669.762) (-667.022) (-669.168) -- 0:00:31
490000 -- [-669.485] (-669.302) (-667.932) (-669.606) * (-668.735) (-667.449) (-667.721) [-669.864] -- 0:00:31
Average standard deviation of split frequencies: 0.012757
490500 -- [-668.291] (-668.953) (-668.122) (-669.530) * (-669.604) [-667.545] (-669.553) (-669.609) -- 0:00:31
491000 -- (-671.129) (-668.443) (-667.838) [-669.176] * (-668.262) (-670.304) [-668.178] (-671.279) -- 0:00:31
491500 -- (-668.824) [-667.735] (-669.552) (-667.768) * (-668.706) (-668.822) (-672.920) [-668.433] -- 0:00:31
492000 -- (-670.722) (-670.500) [-669.625] (-673.991) * (-669.218) [-670.715] (-671.364) (-667.403) -- 0:00:30
492500 -- [-667.955] (-668.599) (-670.432) (-673.680) * (-670.227) (-670.311) (-669.450) [-669.207] -- 0:00:30
493000 -- (-669.680) [-670.991] (-670.487) (-667.416) * (-668.049) (-667.523) (-667.093) [-669.047] -- 0:00:30
493500 -- (-668.689) (-672.272) (-667.974) [-668.323] * (-669.054) [-668.223] (-666.783) (-668.448) -- 0:00:30
494000 -- [-667.029] (-668.979) (-668.145) (-667.530) * (-668.492) (-669.647) [-669.362] (-667.546) -- 0:00:30
494500 -- (-669.430) [-669.117] (-667.762) (-668.683) * (-670.219) [-668.062] (-672.216) (-671.696) -- 0:00:30
495000 -- (-667.541) [-668.041] (-668.432) (-671.671) * (-667.610) (-668.271) [-670.416] (-672.478) -- 0:00:30
Average standard deviation of split frequencies: 0.012883
495500 -- (-672.428) [-668.096] (-668.864) (-670.869) * (-669.055) [-671.381] (-669.596) (-671.457) -- 0:00:30
496000 -- (-667.742) (-667.013) (-670.572) [-670.704] * [-668.820] (-668.314) (-671.526) (-666.858) -- 0:00:30
496500 -- (-671.852) [-667.796] (-672.156) (-673.788) * [-669.524] (-668.203) (-672.598) (-669.514) -- 0:00:30
497000 -- [-667.754] (-668.571) (-668.126) (-670.372) * (-669.772) [-669.298] (-667.953) (-669.619) -- 0:00:30
497500 -- (-676.832) (-669.592) [-670.079] (-669.445) * [-667.468] (-668.535) (-669.771) (-669.378) -- 0:00:30
498000 -- (-667.451) (-669.410) (-668.105) [-668.322] * (-669.148) (-669.228) [-670.790] (-666.934) -- 0:00:30
498500 -- (-668.966) (-670.045) (-670.002) [-669.945] * (-669.420) (-671.777) (-671.963) [-666.895] -- 0:00:30
499000 -- [-674.238] (-671.336) (-669.380) (-668.975) * [-669.173] (-671.623) (-668.558) (-668.407) -- 0:00:30
499500 -- [-670.589] (-669.355) (-670.981) (-673.593) * (-667.811) [-667.290] (-674.002) (-668.240) -- 0:00:30
500000 -- (-667.584) (-668.113) [-669.451] (-669.668) * (-669.486) (-666.997) [-672.904] (-667.965) -- 0:00:30
Average standard deviation of split frequencies: 0.013403
500500 -- [-669.225] (-670.216) (-669.568) (-668.782) * (-667.468) [-668.667] (-669.200) (-669.727) -- 0:00:29
501000 -- [-670.379] (-669.320) (-668.675) (-676.057) * [-669.614] (-672.849) (-667.626) (-668.105) -- 0:00:29
501500 -- (-669.517) (-667.678) [-674.401] (-672.732) * (-667.232) (-671.994) (-668.430) [-668.401] -- 0:00:29
502000 -- [-668.070] (-670.693) (-669.100) (-675.090) * (-667.761) (-671.494) (-670.159) [-667.734] -- 0:00:29
502500 -- (-672.304) (-670.332) [-669.134] (-670.042) * [-667.951] (-669.909) (-668.070) (-670.152) -- 0:00:29
503000 -- (-671.513) (-670.235) (-669.893) [-668.798] * (-667.547) (-671.687) [-672.158] (-669.335) -- 0:00:29
503500 -- (-668.920) (-668.019) (-668.408) [-669.016] * [-667.751] (-668.151) (-670.022) (-668.360) -- 0:00:30
504000 -- (-669.918) (-669.804) (-671.296) [-666.960] * (-667.594) (-668.155) (-669.203) [-667.255] -- 0:00:30
504500 -- (-669.380) (-671.381) [-667.405] (-669.137) * [-667.599] (-668.554) (-669.282) (-670.166) -- 0:00:30
505000 -- (-669.094) [-668.637] (-669.941) (-669.553) * [-668.526] (-667.085) (-666.926) (-670.648) -- 0:00:30
Average standard deviation of split frequencies: 0.012714
505500 -- (-669.519) (-668.303) (-669.057) [-668.621] * (-668.855) (-670.854) [-669.519] (-667.273) -- 0:00:30
506000 -- [-669.564] (-669.478) (-669.406) (-671.356) * (-667.585) (-667.581) (-668.835) [-670.677] -- 0:00:30
506500 -- (-667.475) [-669.135] (-669.680) (-679.272) * (-668.851) (-668.299) [-669.738] (-666.937) -- 0:00:30
507000 -- (-666.768) [-667.605] (-672.495) (-669.759) * [-669.766] (-672.265) (-668.257) (-667.762) -- 0:00:30
507500 -- (-669.452) (-668.161) (-669.998) [-667.210] * (-671.306) (-673.204) [-668.038] (-667.135) -- 0:00:30
508000 -- (-670.005) (-667.562) [-670.281] (-670.310) * [-668.211] (-667.550) (-671.676) (-667.610) -- 0:00:30
508500 -- (-667.725) (-667.180) (-668.093) [-667.818] * (-668.793) (-668.577) [-668.975] (-670.786) -- 0:00:29
509000 -- (-669.087) (-669.857) [-670.643] (-670.230) * [-667.463] (-669.710) (-667.371) (-671.004) -- 0:00:29
509500 -- (-668.228) [-667.101] (-671.619) (-671.426) * (-669.011) (-667.795) [-667.756] (-673.768) -- 0:00:29
510000 -- [-666.804] (-667.679) (-670.754) (-669.747) * [-671.836] (-667.890) (-669.179) (-672.896) -- 0:00:29
Average standard deviation of split frequencies: 0.012272
510500 -- (-668.445) (-675.150) [-668.132] (-673.512) * [-670.082] (-666.929) (-668.574) (-669.550) -- 0:00:29
511000 -- (-669.484) (-668.926) (-669.027) [-667.166] * (-670.376) [-667.512] (-667.222) (-668.192) -- 0:00:29
511500 -- (-668.115) (-668.399) (-668.189) [-667.844] * [-667.376] (-667.303) (-667.601) (-669.271) -- 0:00:29
512000 -- (-668.542) [-669.154] (-671.121) (-668.902) * [-666.807] (-670.058) (-670.007) (-672.275) -- 0:00:29
512500 -- [-667.760] (-670.870) (-672.656) (-668.125) * (-668.720) (-669.568) (-667.968) [-672.028] -- 0:00:29
513000 -- [-668.063] (-668.229) (-669.814) (-668.896) * (-668.123) [-667.715] (-669.407) (-668.284) -- 0:00:29
513500 -- (-668.598) [-669.460] (-667.885) (-667.243) * (-666.781) (-669.191) [-668.558] (-667.261) -- 0:00:29
514000 -- (-668.363) [-670.952] (-672.290) (-668.103) * (-666.519) [-667.140] (-671.980) (-667.516) -- 0:00:29
514500 -- [-668.582] (-668.188) (-674.665) (-667.468) * [-667.648] (-669.734) (-671.125) (-668.198) -- 0:00:29
515000 -- (-667.583) (-668.821) (-670.573) [-668.553] * (-669.834) (-667.896) [-668.699] (-668.734) -- 0:00:29
Average standard deviation of split frequencies: 0.011769
515500 -- [-671.687] (-669.269) (-669.646) (-668.513) * (-668.537) (-669.520) (-667.422) [-668.447] -- 0:00:29
516000 -- [-668.751] (-668.085) (-670.283) (-675.928) * [-667.957] (-668.972) (-669.033) (-668.822) -- 0:00:29
516500 -- (-669.149) [-667.017] (-669.472) (-668.760) * (-667.644) (-668.998) (-667.252) [-668.044] -- 0:00:29
517000 -- (-668.127) (-666.781) (-667.209) [-668.955] * (-668.363) (-670.034) [-667.888] (-670.797) -- 0:00:28
517500 -- [-668.143] (-666.781) (-667.238) (-678.525) * (-667.342) [-670.506] (-667.422) (-668.410) -- 0:00:28
518000 -- (-667.427) (-671.194) (-667.413) [-669.960] * (-667.583) (-669.525) (-672.752) [-667.931] -- 0:00:28
518500 -- (-669.451) [-668.781] (-667.551) (-669.091) * [-667.125] (-673.656) (-669.727) (-667.682) -- 0:00:28
519000 -- (-669.998) (-670.620) [-668.222] (-678.247) * (-670.555) [-668.471] (-667.950) (-667.719) -- 0:00:28
519500 -- (-667.065) (-670.040) (-670.186) [-672.674] * [-667.799] (-673.685) (-669.415) (-666.755) -- 0:00:28
520000 -- [-667.065] (-670.802) (-667.019) (-668.090) * (-668.726) (-670.054) [-667.618] (-669.487) -- 0:00:29
Average standard deviation of split frequencies: 0.012090
520500 -- (-667.309) (-667.349) [-666.881] (-668.593) * [-668.667] (-668.913) (-671.146) (-676.219) -- 0:00:29
521000 -- [-668.489] (-668.895) (-667.603) (-670.810) * [-667.288] (-670.032) (-670.018) (-669.125) -- 0:00:29
521500 -- (-668.271) (-666.793) (-670.268) [-671.488] * (-670.278) (-672.151) (-671.640) [-668.577] -- 0:00:29
522000 -- (-668.359) (-668.507) (-666.736) [-673.205] * (-670.345) [-667.347] (-671.858) (-669.203) -- 0:00:29
522500 -- [-669.492] (-667.270) (-667.076) (-668.165) * (-670.178) [-669.176] (-673.085) (-667.979) -- 0:00:29
523000 -- (-673.749) (-668.062) [-669.129] (-668.644) * (-669.020) (-666.842) (-669.589) [-667.324] -- 0:00:29
523500 -- (-668.822) [-667.757] (-673.168) (-668.854) * (-669.349) (-668.111) [-666.807] (-668.779) -- 0:00:29
524000 -- (-666.832) [-669.400] (-669.591) (-669.329) * (-667.701) [-669.409] (-669.237) (-667.825) -- 0:00:29
524500 -- [-668.887] (-667.555) (-668.770) (-667.407) * (-667.091) (-670.133) (-668.435) [-667.954] -- 0:00:29
525000 -- (-672.341) (-667.253) [-667.193] (-667.733) * (-668.211) (-669.680) (-671.159) [-668.794] -- 0:00:28
Average standard deviation of split frequencies: 0.012494
525500 -- [-667.383] (-667.176) (-676.487) (-667.522) * [-669.508] (-670.383) (-669.733) (-668.233) -- 0:00:28
526000 -- (-667.669) (-669.287) (-667.454) [-670.649] * (-668.612) (-671.578) (-667.667) [-668.014] -- 0:00:28
526500 -- [-667.558] (-668.028) (-667.344) (-672.157) * (-667.739) (-667.694) [-667.058] (-668.403) -- 0:00:28
527000 -- (-667.838) (-669.275) (-669.409) [-668.183] * (-667.123) (-669.483) [-667.393] (-668.681) -- 0:00:28
527500 -- (-668.476) [-669.315] (-667.851) (-668.685) * (-668.856) (-667.532) [-667.374] (-667.006) -- 0:00:28
528000 -- [-670.018] (-668.781) (-668.000) (-668.791) * [-667.713] (-668.575) (-669.486) (-666.678) -- 0:00:28
528500 -- (-671.756) [-667.749] (-668.474) (-667.036) * (-669.182) (-669.126) (-668.199) [-667.393] -- 0:00:28
529000 -- (-672.219) (-667.836) [-668.288] (-666.511) * (-668.253) [-670.542] (-668.227) (-667.579) -- 0:00:28
529500 -- [-667.710] (-667.675) (-667.783) (-669.792) * (-666.613) (-670.635) (-667.982) [-667.538] -- 0:00:28
530000 -- [-670.044] (-668.870) (-667.398) (-668.788) * (-667.009) (-670.459) (-670.274) [-670.136] -- 0:00:28
Average standard deviation of split frequencies: 0.012646
530500 -- (-669.198) (-670.389) (-669.517) [-669.713] * (-667.359) [-668.090] (-671.794) (-669.415) -- 0:00:28
531000 -- [-667.542] (-667.367) (-672.314) (-669.159) * (-669.545) (-669.760) (-671.216) [-670.275] -- 0:00:28
531500 -- (-667.878) (-669.315) (-669.927) [-668.065] * (-668.791) [-667.402] (-668.949) (-668.827) -- 0:00:28
532000 -- (-667.284) (-669.630) (-670.507) [-672.624] * (-668.561) (-670.789) [-668.020] (-670.280) -- 0:00:28
532500 -- [-668.619] (-669.862) (-676.346) (-670.485) * (-670.379) (-670.296) (-668.605) [-667.434] -- 0:00:28
533000 -- (-668.359) (-668.726) [-673.077] (-672.430) * (-674.842) [-670.353] (-667.579) (-674.187) -- 0:00:28
533500 -- (-671.401) (-670.580) [-667.372] (-668.734) * (-668.090) [-670.750] (-669.409) (-671.245) -- 0:00:27
534000 -- (-670.594) [-669.592] (-670.113) (-670.031) * (-667.931) (-668.874) [-669.309] (-669.236) -- 0:00:27
534500 -- (-668.283) [-667.064] (-667.199) (-671.317) * (-666.695) [-667.030] (-671.562) (-669.470) -- 0:00:27
535000 -- (-671.947) (-672.054) [-666.970] (-670.458) * (-667.212) [-670.517] (-669.792) (-666.911) -- 0:00:27
Average standard deviation of split frequencies: 0.012985
535500 -- (-670.545) (-671.546) (-670.411) [-670.534] * (-668.499) (-669.311) (-668.449) [-667.490] -- 0:00:27
536000 -- (-673.511) (-672.621) (-669.038) [-670.064] * (-668.049) (-668.027) [-669.033] (-669.417) -- 0:00:27
536500 -- [-667.828] (-669.589) (-667.088) (-670.560) * [-668.024] (-672.548) (-669.388) (-668.479) -- 0:00:27
537000 -- (-671.016) [-671.385] (-668.917) (-669.044) * [-671.046] (-668.481) (-671.774) (-669.022) -- 0:00:28
537500 -- (-671.590) (-668.682) [-669.411] (-668.967) * (-668.560) [-667.473] (-666.844) (-667.552) -- 0:00:28
538000 -- (-673.813) [-667.946] (-669.648) (-671.384) * [-666.558] (-669.838) (-667.662) (-668.560) -- 0:00:28
538500 -- (-670.533) (-666.606) (-671.147) [-673.256] * [-669.127] (-671.724) (-669.032) (-667.568) -- 0:00:28
539000 -- (-672.038) [-668.083] (-670.180) (-667.496) * (-670.041) (-669.391) [-669.152] (-670.959) -- 0:00:28
539500 -- (-669.963) [-667.588] (-668.713) (-668.277) * (-669.688) (-669.191) (-669.204) [-672.399] -- 0:00:28
540000 -- (-671.863) (-670.260) [-669.125] (-670.002) * (-673.855) (-666.839) [-668.448] (-667.762) -- 0:00:28
Average standard deviation of split frequencies: 0.013591
540500 -- (-672.277) [-667.183] (-669.112) (-674.797) * [-667.605] (-668.868) (-667.615) (-669.249) -- 0:00:28
541000 -- [-669.345] (-668.954) (-668.438) (-669.507) * (-669.597) (-668.046) (-674.858) [-670.962] -- 0:00:27
541500 -- (-668.469) [-668.367] (-667.175) (-670.214) * [-667.165] (-669.028) (-671.401) (-668.510) -- 0:00:27
542000 -- [-668.138] (-668.742) (-666.988) (-668.772) * (-669.193) (-669.945) [-669.658] (-667.761) -- 0:00:27
542500 -- (-671.817) [-669.146] (-667.695) (-670.636) * [-668.559] (-668.489) (-670.357) (-668.701) -- 0:00:27
543000 -- (-667.973) (-668.345) [-669.616] (-670.637) * (-667.782) (-670.051) (-668.517) [-668.671] -- 0:00:27
543500 -- (-667.444) [-669.111] (-668.821) (-669.990) * (-667.884) [-673.812] (-667.218) (-668.674) -- 0:00:27
544000 -- [-667.009] (-669.889) (-667.279) (-667.145) * (-671.410) (-667.647) (-668.828) [-667.158] -- 0:00:27
544500 -- [-667.794] (-670.800) (-667.383) (-668.535) * [-672.030] (-668.570) (-671.137) (-667.085) -- 0:00:27
545000 -- (-671.992) (-666.650) (-670.505) [-672.525] * [-667.953] (-672.499) (-671.006) (-668.124) -- 0:00:27
Average standard deviation of split frequencies: 0.013662
545500 -- [-670.266] (-671.077) (-673.145) (-668.721) * [-671.702] (-667.741) (-670.307) (-668.258) -- 0:00:27
546000 -- (-669.725) (-667.334) (-673.883) [-669.533] * (-669.348) (-669.376) (-669.026) [-669.522] -- 0:00:27
546500 -- (-672.792) [-670.072] (-670.944) (-667.424) * (-670.254) [-669.126] (-674.303) (-670.756) -- 0:00:27
547000 -- (-669.681) (-669.747) (-672.830) [-667.004] * [-669.736] (-667.351) (-676.378) (-668.321) -- 0:00:27
547500 -- (-668.992) (-670.043) [-672.004] (-673.749) * [-668.588] (-667.956) (-676.830) (-667.838) -- 0:00:27
548000 -- (-668.341) [-667.971] (-669.502) (-668.474) * (-668.631) (-667.208) (-671.397) [-666.680] -- 0:00:27
548500 -- [-669.628] (-666.828) (-668.246) (-673.239) * [-671.256] (-666.710) (-667.652) (-667.198) -- 0:00:27
549000 -- (-669.808) [-668.466] (-669.531) (-674.247) * (-669.241) (-670.284) [-668.905] (-667.766) -- 0:00:27
549500 -- (-667.358) (-667.713) [-671.154] (-673.362) * (-672.041) (-674.135) (-668.318) [-670.500] -- 0:00:27
550000 -- (-668.697) (-668.538) (-671.426) [-670.145] * (-667.219) [-669.525] (-668.279) (-667.593) -- 0:00:27
Average standard deviation of split frequencies: 0.013193
550500 -- (-671.325) (-668.461) [-671.037] (-667.304) * (-667.945) (-667.269) (-671.083) [-667.588] -- 0:00:26
551000 -- (-670.608) (-672.722) [-668.820] (-667.151) * [-667.986] (-668.887) (-667.609) (-669.045) -- 0:00:26
551500 -- [-669.040] (-672.187) (-668.602) (-669.921) * [-667.851] (-666.919) (-677.744) (-668.323) -- 0:00:26
552000 -- (-670.899) (-672.802) (-672.004) [-672.202] * (-667.251) [-670.113] (-667.723) (-667.602) -- 0:00:26
552500 -- (-668.579) [-670.269] (-672.162) (-670.048) * (-667.320) (-667.367) [-669.200] (-668.066) -- 0:00:26
553000 -- [-669.782] (-672.918) (-668.727) (-673.472) * (-668.488) (-670.653) (-670.311) [-670.094] -- 0:00:26
553500 -- (-669.416) (-667.620) [-667.993] (-670.275) * (-668.080) [-668.214] (-670.159) (-670.527) -- 0:00:27
554000 -- (-669.313) (-667.246) (-669.991) [-669.483] * (-671.703) (-669.781) [-669.072] (-669.278) -- 0:00:27
554500 -- [-673.491] (-669.913) (-671.911) (-666.758) * [-668.451] (-670.149) (-669.315) (-666.624) -- 0:00:27
555000 -- (-670.150) (-668.760) (-672.197) [-669.291] * (-666.977) (-668.907) (-668.360) [-669.892] -- 0:00:27
Average standard deviation of split frequencies: 0.012768
555500 -- (-669.998) [-668.944] (-669.712) (-672.257) * (-668.572) (-671.385) (-667.283) [-666.825] -- 0:00:27
556000 -- [-668.014] (-669.822) (-671.641) (-668.101) * (-668.871) (-669.274) [-667.491] (-666.985) -- 0:00:27
556500 -- (-668.121) (-672.363) [-669.179] (-673.984) * (-668.215) (-669.610) [-667.446] (-668.252) -- 0:00:27
557000 -- (-668.109) [-668.736] (-669.427) (-668.511) * (-666.920) (-669.538) [-667.508] (-668.791) -- 0:00:27
557500 -- (-667.829) (-668.785) (-670.049) [-668.902] * (-668.015) (-668.283) (-668.893) [-668.583] -- 0:00:26
558000 -- [-668.355] (-668.295) (-669.252) (-668.415) * (-667.917) (-667.553) [-668.532] (-668.913) -- 0:00:26
558500 -- [-668.491] (-668.478) (-673.415) (-668.287) * [-667.428] (-668.129) (-668.518) (-667.637) -- 0:00:26
559000 -- [-669.032] (-669.872) (-668.501) (-670.008) * (-669.114) [-666.530] (-671.181) (-669.527) -- 0:00:26
559500 -- (-668.034) (-667.197) [-670.663] (-667.648) * [-669.731] (-667.924) (-668.308) (-668.169) -- 0:00:26
560000 -- (-674.711) [-669.921] (-668.382) (-669.324) * (-667.686) [-667.392] (-668.533) (-668.477) -- 0:00:26
Average standard deviation of split frequencies: 0.011821
560500 -- [-668.838] (-669.003) (-669.304) (-668.760) * (-668.135) [-668.580] (-668.417) (-669.902) -- 0:00:26
561000 -- (-674.935) (-667.663) (-668.489) [-668.165] * (-670.263) (-669.295) [-669.681] (-670.097) -- 0:00:26
561500 -- (-673.895) (-670.040) (-667.590) [-667.514] * (-669.179) (-668.594) [-670.496] (-667.999) -- 0:00:26
562000 -- (-667.870) [-667.620] (-668.975) (-668.437) * (-668.115) [-668.324] (-669.988) (-669.049) -- 0:00:26
562500 -- (-672.106) [-668.272] (-668.933) (-668.711) * (-668.282) (-668.266) (-669.998) [-668.374] -- 0:00:26
563000 -- (-667.918) (-669.327) [-669.156] (-667.838) * [-666.943] (-670.779) (-671.590) (-670.206) -- 0:00:26
563500 -- (-672.339) (-670.885) (-669.652) [-667.590] * (-668.918) [-670.773] (-668.243) (-670.743) -- 0:00:26
564000 -- (-670.481) [-667.934] (-669.468) (-668.944) * (-667.347) (-667.397) [-672.134] (-669.006) -- 0:00:26
564500 -- (-676.630) (-668.544) (-666.845) [-668.600] * (-667.453) (-668.567) (-670.048) [-668.422] -- 0:00:26
565000 -- [-668.958] (-669.560) (-669.574) (-669.204) * (-666.923) [-668.932] (-667.890) (-671.439) -- 0:00:26
Average standard deviation of split frequencies: 0.011660
565500 -- [-673.950] (-668.225) (-667.852) (-667.304) * (-669.725) (-669.000) [-666.975] (-668.353) -- 0:00:26
566000 -- [-669.659] (-668.020) (-670.489) (-667.055) * [-670.908] (-666.843) (-667.117) (-668.824) -- 0:00:26
566500 -- (-668.202) [-667.927] (-670.474) (-667.289) * [-669.064] (-669.736) (-667.437) (-668.322) -- 0:00:26
567000 -- (-668.013) (-669.389) (-670.851) [-667.486] * (-674.869) [-668.023] (-669.403) (-668.534) -- 0:00:25
567500 -- (-669.773) [-667.865] (-667.601) (-668.401) * (-668.162) [-668.491] (-668.034) (-670.772) -- 0:00:25
568000 -- (-668.451) (-668.360) (-667.461) [-668.471] * (-672.793) (-669.182) (-669.512) [-669.841] -- 0:00:25
568500 -- (-669.531) (-668.989) (-669.704) [-668.440] * (-669.890) [-673.111] (-668.168) (-670.958) -- 0:00:25
569000 -- (-669.897) (-668.352) (-668.796) [-668.016] * (-668.140) [-671.882] (-666.929) (-672.998) -- 0:00:25
569500 -- [-669.948] (-669.415) (-667.445) (-666.927) * (-668.351) (-668.322) (-667.132) [-670.008] -- 0:00:25
570000 -- (-669.569) (-671.751) (-668.438) [-670.687] * (-669.858) [-666.929] (-669.248) (-669.734) -- 0:00:25
Average standard deviation of split frequencies: 0.011079
570500 -- (-669.448) [-668.197] (-668.399) (-668.420) * (-669.844) [-669.731] (-669.333) (-674.807) -- 0:00:26
571000 -- (-669.262) (-667.370) [-667.084] (-670.187) * (-669.074) (-675.472) (-668.567) [-667.243] -- 0:00:26
571500 -- (-667.575) [-668.968] (-667.638) (-667.737) * (-670.743) (-675.679) [-668.930] (-672.086) -- 0:00:26
572000 -- (-669.882) (-668.215) [-666.720] (-667.748) * (-670.503) (-672.202) (-668.871) [-673.246] -- 0:00:26
572500 -- (-668.577) (-667.920) (-667.616) [-667.585] * [-667.628] (-671.027) (-668.128) (-669.269) -- 0:00:26
573000 -- (-669.157) (-677.745) [-668.243] (-667.566) * (-669.122) [-670.513] (-671.655) (-668.208) -- 0:00:26
573500 -- (-669.450) [-668.707] (-667.337) (-669.649) * (-669.783) (-667.866) [-669.749] (-671.772) -- 0:00:26
574000 -- [-668.296] (-671.941) (-667.993) (-672.318) * (-671.238) [-667.583] (-672.170) (-669.995) -- 0:00:25
574500 -- [-668.768] (-667.617) (-669.769) (-667.778) * (-670.560) (-668.830) (-669.327) [-672.399] -- 0:00:25
575000 -- [-669.759] (-670.586) (-668.832) (-667.946) * (-668.449) [-668.244] (-668.450) (-672.255) -- 0:00:25
Average standard deviation of split frequencies: 0.011554
575500 -- (-667.817) [-668.438] (-672.391) (-667.026) * (-669.768) (-669.262) [-670.787] (-667.388) -- 0:00:25
576000 -- [-670.270] (-668.861) (-669.978) (-671.288) * (-668.125) (-668.161) [-669.603] (-672.397) -- 0:00:25
576500 -- (-666.958) [-668.241] (-668.337) (-672.260) * [-668.011] (-667.254) (-673.024) (-669.124) -- 0:00:25
577000 -- (-671.147) (-668.866) (-669.911) [-669.458] * [-667.797] (-667.909) (-670.568) (-672.957) -- 0:00:25
577500 -- [-668.954] (-672.607) (-670.677) (-671.937) * (-671.385) [-667.547] (-671.985) (-668.572) -- 0:00:25
578000 -- (-667.580) (-667.429) [-668.650] (-667.570) * (-668.362) (-671.165) (-668.757) [-670.317] -- 0:00:25
578500 -- [-668.359] (-667.582) (-671.049) (-667.416) * [-667.675] (-667.512) (-669.258) (-668.910) -- 0:00:25
579000 -- (-667.786) [-667.130] (-668.126) (-667.519) * (-668.653) (-667.899) (-667.980) [-668.939] -- 0:00:25
579500 -- (-675.764) (-674.297) (-667.163) [-670.610] * (-667.980) (-667.032) (-675.728) [-666.564] -- 0:00:25
580000 -- (-667.568) (-670.361) (-670.007) [-669.025] * (-666.971) (-667.286) [-669.529] (-672.900) -- 0:00:25
Average standard deviation of split frequencies: 0.011031
580500 -- [-670.080] (-668.696) (-669.574) (-670.516) * [-666.641] (-668.197) (-668.152) (-672.067) -- 0:00:25
581000 -- [-669.522] (-667.400) (-667.156) (-668.192) * (-666.916) (-668.797) [-669.950] (-675.629) -- 0:00:25
581500 -- [-668.663] (-670.273) (-668.650) (-670.503) * (-670.196) (-670.754) (-669.414) [-670.104] -- 0:00:25
582000 -- [-669.627] (-669.397) (-668.323) (-667.497) * [-669.798] (-668.505) (-668.792) (-671.514) -- 0:00:25
582500 -- (-667.666) (-669.057) [-667.984] (-669.088) * [-670.084] (-669.073) (-667.988) (-668.101) -- 0:00:25
583000 -- [-669.871] (-670.411) (-667.261) (-673.411) * [-668.241] (-668.590) (-670.318) (-669.828) -- 0:00:25
583500 -- (-670.354) [-666.895] (-668.180) (-671.443) * (-667.298) (-668.222) (-671.367) [-671.008] -- 0:00:24
584000 -- (-669.166) (-672.382) [-673.873] (-667.488) * (-671.484) (-667.455) (-669.838) [-667.955] -- 0:00:24
584500 -- (-673.053) (-669.700) (-671.103) [-670.012] * (-669.207) (-668.611) [-668.490] (-667.232) -- 0:00:24
585000 -- (-668.252) (-668.655) [-669.415] (-669.059) * (-667.679) [-669.386] (-668.150) (-668.333) -- 0:00:24
Average standard deviation of split frequencies: 0.011546
585500 -- (-669.266) [-668.474] (-668.798) (-668.542) * (-667.060) [-668.001] (-666.853) (-668.535) -- 0:00:24
586000 -- (-676.400) (-671.571) (-670.806) [-671.259] * (-670.963) (-669.374) [-667.522] (-672.150) -- 0:00:24
586500 -- (-669.679) (-670.371) [-670.636] (-670.823) * (-667.877) [-667.648] (-667.182) (-671.410) -- 0:00:24
587000 -- [-668.503] (-668.927) (-668.757) (-668.184) * [-669.291] (-669.685) (-669.874) (-667.129) -- 0:00:25
587500 -- (-668.302) (-667.537) [-669.313] (-668.746) * (-674.146) (-668.174) (-668.651) [-669.473] -- 0:00:25
588000 -- [-667.991] (-672.845) (-669.705) (-668.986) * (-670.095) (-670.913) [-670.104] (-671.200) -- 0:00:25
588500 -- (-668.317) [-667.642] (-668.301) (-669.059) * [-668.069] (-670.087) (-668.764) (-669.576) -- 0:00:25
589000 -- (-668.271) [-667.272] (-668.351) (-669.898) * (-669.939) (-670.947) [-669.223] (-669.669) -- 0:00:25
589500 -- [-668.872] (-671.757) (-668.194) (-667.349) * [-671.065] (-670.176) (-669.835) (-667.802) -- 0:00:25
590000 -- (-670.358) (-668.595) (-668.313) [-667.562] * [-666.864] (-667.332) (-667.383) (-667.480) -- 0:00:25
Average standard deviation of split frequencies: 0.012018
590500 -- (-671.645) (-668.842) (-667.572) [-669.516] * (-667.767) (-668.675) (-670.637) [-672.719] -- 0:00:24
591000 -- (-668.107) (-667.062) [-671.779] (-668.204) * [-671.129] (-666.929) (-671.460) (-667.176) -- 0:00:24
591500 -- (-669.356) (-667.523) [-668.456] (-668.578) * (-667.478) (-668.761) [-670.188] (-667.971) -- 0:00:24
592000 -- [-668.731] (-667.981) (-667.705) (-667.281) * (-667.426) (-666.752) (-672.453) [-667.599] -- 0:00:24
592500 -- (-667.099) (-669.934) (-669.851) [-669.437] * [-672.179] (-667.893) (-670.873) (-670.170) -- 0:00:24
593000 -- [-667.667] (-670.506) (-669.388) (-674.843) * [-667.018] (-668.468) (-667.924) (-671.654) -- 0:00:24
593500 -- (-669.033) [-669.934] (-671.473) (-668.425) * (-671.862) (-670.020) (-671.313) [-668.699] -- 0:00:24
594000 -- (-668.921) (-668.068) (-668.633) [-668.158] * (-667.988) (-669.406) [-668.883] (-668.503) -- 0:00:24
594500 -- (-671.184) (-668.225) [-668.512] (-668.555) * (-668.160) (-667.802) [-669.510] (-675.539) -- 0:00:24
595000 -- (-671.609) (-668.400) (-667.134) [-667.655] * (-669.485) [-668.721] (-672.532) (-671.286) -- 0:00:24
Average standard deviation of split frequencies: 0.011399
595500 -- (-669.943) (-670.530) (-667.316) [-667.800] * (-670.133) (-667.913) (-669.386) [-669.045] -- 0:00:24
596000 -- (-667.679) [-673.268] (-667.666) (-673.484) * (-668.028) (-670.324) (-668.576) [-669.026] -- 0:00:24
596500 -- (-669.874) (-668.763) (-670.749) [-668.372] * (-668.475) [-671.266] (-669.219) (-669.069) -- 0:00:24
597000 -- [-666.986] (-670.641) (-668.706) (-671.402) * [-667.161] (-668.334) (-669.350) (-669.789) -- 0:00:24
597500 -- (-666.767) (-669.522) [-669.221] (-668.718) * (-669.510) (-667.466) (-666.844) [-667.112] -- 0:00:24
598000 -- (-669.283) [-669.498] (-673.218) (-675.700) * (-669.342) (-668.701) [-667.616] (-667.367) -- 0:00:24
598500 -- (-670.509) (-669.723) (-669.294) [-668.259] * (-668.921) (-670.189) [-667.523] (-668.139) -- 0:00:24
599000 -- [-669.417] (-669.189) (-668.148) (-668.229) * [-666.899] (-667.287) (-669.606) (-669.704) -- 0:00:24
599500 -- [-667.943] (-667.011) (-669.162) (-667.140) * (-667.833) (-666.885) [-669.864] (-668.488) -- 0:00:24
600000 -- (-671.213) (-668.199) [-671.604] (-669.392) * [-667.079] (-667.912) (-667.077) (-668.480) -- 0:00:24
Average standard deviation of split frequencies: 0.011403
600500 -- (-669.255) [-667.995] (-670.092) (-668.990) * (-666.901) [-670.886] (-666.783) (-667.225) -- 0:00:23
601000 -- (-669.299) (-669.934) (-670.891) [-668.689] * (-673.258) (-668.290) (-671.942) [-669.119] -- 0:00:23
601500 -- (-670.688) [-671.795] (-668.337) (-670.696) * (-667.898) (-669.249) (-669.512) [-669.187] -- 0:00:23
602000 -- (-672.566) (-672.028) [-669.812] (-669.384) * (-668.796) [-667.434] (-670.514) (-670.779) -- 0:00:23
602500 -- (-668.416) (-669.568) (-670.090) [-669.244] * (-668.436) (-666.729) (-669.211) [-668.018] -- 0:00:23
603000 -- (-667.894) (-667.376) [-668.389] (-667.943) * [-669.493] (-668.522) (-669.140) (-667.329) -- 0:00:23
603500 -- (-668.936) (-671.201) (-668.001) [-666.936] * (-671.686) (-670.824) (-668.636) [-672.178] -- 0:00:23
604000 -- [-668.037] (-672.140) (-669.163) (-667.913) * (-669.255) (-668.717) [-667.568] (-672.453) -- 0:00:24
604500 -- (-668.321) (-667.970) (-670.217) [-667.364] * (-668.359) (-667.445) [-667.740] (-670.558) -- 0:00:24
605000 -- (-668.573) [-667.035] (-668.399) (-668.732) * [-668.740] (-668.733) (-667.414) (-670.733) -- 0:00:24
Average standard deviation of split frequencies: 0.011119
605500 -- (-669.159) (-669.592) (-667.499) [-669.898] * (-667.838) (-667.564) [-667.432] (-672.572) -- 0:00:24
606000 -- (-668.510) (-669.713) [-668.245] (-669.602) * (-671.327) [-670.925] (-667.707) (-668.578) -- 0:00:24
606500 -- (-668.272) [-667.810] (-668.939) (-669.554) * (-671.365) (-669.193) [-669.044] (-666.914) -- 0:00:24
607000 -- (-669.790) (-667.732) [-668.757] (-669.598) * (-669.433) (-668.506) (-667.909) [-666.911] -- 0:00:23
607500 -- (-668.956) [-668.989] (-667.951) (-669.188) * [-667.344] (-671.186) (-669.807) (-667.474) -- 0:00:23
608000 -- (-666.683) [-669.323] (-669.548) (-669.478) * (-667.242) (-670.254) (-673.265) [-667.905] -- 0:00:23
608500 -- (-668.358) (-667.255) (-668.490) [-668.395] * (-670.717) (-667.720) [-670.217] (-667.154) -- 0:00:23
609000 -- (-669.836) (-668.319) (-669.318) [-667.964] * [-668.791] (-668.510) (-671.995) (-667.526) -- 0:00:23
609500 -- (-670.241) (-667.408) (-669.085) [-667.616] * (-670.757) (-668.341) [-669.321] (-674.535) -- 0:00:23
610000 -- [-669.494] (-669.343) (-667.703) (-672.109) * (-668.871) [-668.311] (-674.540) (-668.490) -- 0:00:23
Average standard deviation of split frequencies: 0.011443
610500 -- (-667.218) [-667.636] (-670.559) (-668.097) * (-668.466) [-669.447] (-674.718) (-666.582) -- 0:00:23
611000 -- (-668.318) (-668.891) (-668.995) [-668.760] * (-667.832) (-669.430) [-670.358] (-669.476) -- 0:00:23
611500 -- [-667.466] (-672.467) (-671.053) (-668.980) * (-668.809) (-669.024) [-666.635] (-672.071) -- 0:00:23
612000 -- [-668.425] (-667.237) (-667.278) (-667.731) * (-671.981) [-667.723] (-669.023) (-669.504) -- 0:00:23
612500 -- (-668.544) (-668.812) (-667.508) [-668.841] * (-669.653) (-668.184) [-667.583] (-670.756) -- 0:00:23
613000 -- (-667.259) (-671.353) (-668.233) [-668.974] * (-669.895) [-667.634] (-667.583) (-670.283) -- 0:00:23
613500 -- (-669.967) (-670.857) (-668.579) [-668.948] * [-670.967] (-669.300) (-667.683) (-673.838) -- 0:00:23
614000 -- (-670.449) (-669.702) [-668.788] (-667.109) * (-669.393) [-668.117] (-670.737) (-670.576) -- 0:00:23
614500 -- (-667.632) (-673.894) [-670.398] (-667.029) * (-669.479) [-670.850] (-670.405) (-672.342) -- 0:00:23
615000 -- [-670.013] (-669.064) (-669.616) (-667.655) * (-671.808) (-667.044) (-667.842) [-670.372] -- 0:00:23
Average standard deviation of split frequencies: 0.011389
615500 -- (-667.692) (-669.822) (-667.891) [-667.350] * (-669.080) (-670.866) (-668.412) [-668.883] -- 0:00:23
616000 -- (-667.582) (-669.861) [-667.196] (-668.235) * (-668.959) (-670.953) (-670.513) [-669.396] -- 0:00:23
616500 -- (-668.326) (-671.311) [-667.230] (-667.758) * [-672.767] (-669.890) (-672.297) (-672.057) -- 0:00:23
617000 -- [-668.404] (-668.289) (-668.217) (-676.069) * [-668.046] (-675.311) (-667.801) (-669.973) -- 0:00:22
617500 -- (-668.503) (-667.302) (-667.165) [-668.705] * [-669.112] (-670.817) (-666.610) (-668.247) -- 0:00:22
618000 -- [-669.250] (-670.250) (-671.315) (-669.648) * (-668.235) [-670.868] (-666.607) (-670.765) -- 0:00:22
618500 -- (-670.008) (-667.763) (-672.419) [-667.713] * (-671.052) (-671.695) [-667.169] (-668.613) -- 0:00:22
619000 -- (-670.547) (-667.899) (-667.035) [-667.525] * [-669.960] (-669.722) (-668.399) (-668.565) -- 0:00:22
619500 -- (-668.211) (-667.803) (-667.739) [-667.140] * (-669.546) [-669.134] (-667.431) (-670.727) -- 0:00:23
620000 -- (-669.870) (-667.738) (-666.641) [-667.660] * (-671.089) [-668.903] (-669.334) (-669.465) -- 0:00:23
Average standard deviation of split frequencies: 0.011169
620500 -- [-667.685] (-669.963) (-671.863) (-670.415) * [-670.492] (-671.116) (-668.951) (-669.061) -- 0:00:23
621000 -- (-667.303) [-670.150] (-670.049) (-670.976) * (-667.610) (-667.262) [-670.150] (-667.863) -- 0:00:23
621500 -- (-673.795) (-667.356) [-668.397] (-672.798) * (-666.806) [-666.738] (-668.909) (-669.512) -- 0:00:23
622000 -- [-667.966] (-667.440) (-670.378) (-667.895) * [-666.791] (-668.831) (-668.940) (-670.941) -- 0:00:23
622500 -- (-667.542) (-668.947) (-672.830) [-666.926] * (-668.757) (-668.275) (-672.089) [-668.022] -- 0:00:23
623000 -- (-668.777) (-669.011) (-670.541) [-666.936] * [-671.524] (-667.327) (-672.442) (-671.520) -- 0:00:22
623500 -- (-675.453) (-667.407) (-666.841) [-668.237] * (-667.642) [-669.554] (-667.412) (-671.255) -- 0:00:22
624000 -- (-668.862) (-669.585) [-669.169] (-671.010) * [-666.566] (-669.211) (-667.210) (-669.437) -- 0:00:22
624500 -- (-669.077) [-668.091] (-670.568) (-669.075) * (-670.629) (-668.632) [-666.900] (-668.990) -- 0:00:22
625000 -- [-667.351] (-668.695) (-674.929) (-668.167) * (-667.143) (-672.372) (-666.852) [-670.023] -- 0:00:22
Average standard deviation of split frequencies: 0.011030
625500 -- (-669.941) [-668.220] (-670.526) (-668.732) * (-667.010) [-671.761] (-666.832) (-669.272) -- 0:00:22
626000 -- (-670.718) [-667.866] (-667.210) (-669.034) * (-671.284) (-669.981) (-673.642) [-672.417] -- 0:00:22
626500 -- [-668.081] (-671.447) (-668.401) (-667.890) * (-668.104) (-669.439) (-669.601) [-667.443] -- 0:00:22
627000 -- (-669.270) (-668.324) [-667.032] (-673.583) * (-669.811) (-668.591) [-669.634] (-667.225) -- 0:00:22
627500 -- (-669.749) (-669.948) (-668.059) [-669.954] * (-667.956) (-670.735) (-669.460) [-667.597] -- 0:00:22
628000 -- (-668.530) (-671.338) (-671.368) [-669.575] * (-668.416) (-670.169) (-669.415) [-666.992] -- 0:00:22
628500 -- (-668.491) (-669.993) (-668.375) [-670.416] * (-674.901) [-669.147] (-669.483) (-666.822) -- 0:00:22
629000 -- (-668.667) (-667.959) (-668.602) [-669.555] * (-667.659) [-671.995] (-667.858) (-668.442) -- 0:00:22
629500 -- (-671.281) (-667.512) [-668.297] (-671.569) * (-669.142) [-668.170] (-669.100) (-669.250) -- 0:00:22
630000 -- (-675.703) (-666.862) [-669.689] (-670.727) * [-668.726] (-670.257) (-670.390) (-673.882) -- 0:00:22
Average standard deviation of split frequencies: 0.011124
630500 -- (-673.059) (-667.390) (-666.862) [-668.232] * (-669.630) (-669.440) [-668.515] (-669.856) -- 0:00:22
631000 -- (-667.751) (-667.573) [-670.489] (-668.668) * (-672.409) (-667.819) [-667.783] (-667.553) -- 0:00:22
631500 -- (-674.589) [-670.023] (-674.197) (-668.740) * (-668.926) (-669.803) [-669.329] (-669.397) -- 0:00:22
632000 -- (-671.153) (-669.283) [-668.710] (-668.439) * (-666.830) (-670.605) (-669.203) [-668.090] -- 0:00:22
632500 -- (-668.510) (-669.576) (-668.946) [-667.563] * [-670.143] (-669.714) (-668.974) (-668.438) -- 0:00:22
633000 -- (-671.282) (-668.449) [-667.640] (-669.473) * (-668.206) (-671.337) (-668.600) [-670.239] -- 0:00:22
633500 -- (-671.344) (-668.498) [-666.985] (-672.473) * [-668.499] (-667.532) (-669.901) (-668.491) -- 0:00:21
634000 -- [-667.088] (-668.777) (-666.724) (-668.142) * [-667.141] (-668.356) (-668.533) (-669.099) -- 0:00:21
634500 -- (-669.885) (-668.292) (-668.481) [-667.185] * (-667.979) [-667.152] (-668.990) (-670.529) -- 0:00:21
635000 -- [-669.413] (-667.025) (-670.372) (-667.864) * (-667.743) (-672.725) [-669.168] (-668.388) -- 0:00:21
Average standard deviation of split frequencies: 0.011074
635500 -- [-667.747] (-670.902) (-669.975) (-668.646) * (-668.545) (-675.510) [-667.572] (-671.720) -- 0:00:21
636000 -- (-670.330) (-668.393) [-667.680] (-669.916) * (-668.976) (-669.122) [-668.685] (-669.498) -- 0:00:22
636500 -- (-666.769) (-669.437) (-667.999) [-668.244] * (-667.617) (-667.955) (-669.910) [-670.310] -- 0:00:22
637000 -- (-667.108) (-668.635) (-669.700) [-667.650] * (-668.053) [-667.837] (-672.660) (-669.935) -- 0:00:22
637500 -- (-670.210) [-667.515] (-669.990) (-668.365) * (-667.967) (-667.056) [-666.587] (-672.248) -- 0:00:22
638000 -- (-668.362) [-668.719] (-676.824) (-668.410) * (-667.897) (-668.531) (-667.632) [-667.372] -- 0:00:22
638500 -- (-669.462) (-674.974) (-672.667) [-668.338] * (-669.213) [-670.344] (-668.291) (-669.137) -- 0:00:22
639000 -- [-669.719] (-671.655) (-671.264) (-669.583) * (-670.569) [-670.839] (-667.801) (-669.616) -- 0:00:22
639500 -- [-668.745] (-668.840) (-670.287) (-668.160) * [-667.589] (-670.480) (-667.915) (-667.365) -- 0:00:21
640000 -- [-669.503] (-669.791) (-671.572) (-669.566) * (-670.736) [-668.606] (-669.131) (-666.834) -- 0:00:21
Average standard deviation of split frequencies: 0.010950
640500 -- [-669.121] (-669.841) (-669.395) (-668.252) * (-669.519) [-668.332] (-669.820) (-668.432) -- 0:00:21
641000 -- (-669.056) [-669.739] (-670.728) (-669.040) * (-671.933) [-668.396] (-667.599) (-667.157) -- 0:00:21
641500 -- (-669.758) [-667.955] (-669.561) (-668.779) * (-670.162) [-668.788] (-666.754) (-668.603) -- 0:00:21
642000 -- (-668.726) (-667.471) (-671.295) [-669.204] * (-669.347) [-668.650] (-666.825) (-670.659) -- 0:00:21
642500 -- [-667.589] (-668.766) (-671.327) (-669.239) * [-669.665] (-670.112) (-667.386) (-668.113) -- 0:00:21
643000 -- (-669.070) (-669.598) (-669.942) [-667.206] * (-668.130) (-668.436) (-668.409) [-667.683] -- 0:00:21
643500 -- (-668.326) [-667.072] (-668.368) (-667.167) * (-669.475) (-671.994) [-668.607] (-667.135) -- 0:00:21
644000 -- [-667.416] (-670.031) (-670.273) (-668.509) * (-668.314) (-672.288) [-667.470] (-670.546) -- 0:00:21
644500 -- (-668.863) [-668.078] (-668.114) (-668.851) * [-668.508] (-672.371) (-667.942) (-669.260) -- 0:00:21
645000 -- [-669.969] (-667.604) (-667.712) (-668.648) * (-669.022) [-668.318] (-668.096) (-667.614) -- 0:00:21
Average standard deviation of split frequencies: 0.010731
645500 -- (-667.617) (-669.267) (-668.683) [-666.895] * [-669.374] (-669.165) (-673.568) (-667.908) -- 0:00:21
646000 -- (-667.318) (-667.870) (-669.278) [-666.984] * (-671.866) [-673.054] (-669.867) (-668.201) -- 0:00:21
646500 -- [-672.373] (-666.856) (-666.908) (-667.563) * (-667.229) (-668.729) (-669.884) [-668.948] -- 0:00:21
647000 -- (-670.078) [-666.992] (-667.888) (-669.978) * (-667.858) (-676.601) (-666.743) [-668.836] -- 0:00:21
647500 -- [-668.211] (-667.902) (-668.174) (-669.400) * (-669.612) [-669.703] (-669.500) (-667.471) -- 0:00:21
648000 -- (-669.111) (-668.651) [-668.228] (-669.704) * (-669.351) [-671.544] (-669.400) (-671.115) -- 0:00:21
648500 -- (-669.282) (-667.099) [-667.659] (-669.405) * (-669.066) (-668.417) [-667.547] (-674.155) -- 0:00:21
649000 -- (-668.660) (-670.403) (-667.375) [-669.823] * (-668.393) (-669.552) (-667.983) [-670.843] -- 0:00:21
649500 -- (-670.574) [-676.636] (-667.439) (-668.414) * (-668.430) [-669.071] (-668.893) (-667.822) -- 0:00:21
650000 -- [-667.944] (-668.783) (-671.606) (-666.786) * [-668.712] (-667.849) (-668.762) (-668.370) -- 0:00:21
Average standard deviation of split frequencies: 0.010526
650500 -- (-667.862) (-667.706) (-671.198) [-666.867] * (-667.266) (-668.107) (-670.428) [-670.789] -- 0:00:20
651000 -- (-668.633) [-668.554] (-668.996) (-668.160) * (-667.186) (-668.081) [-669.622] (-667.764) -- 0:00:20
651500 -- [-667.138] (-667.001) (-669.966) (-673.757) * (-669.173) (-668.578) [-670.462] (-667.181) -- 0:00:20
652000 -- [-667.980] (-668.968) (-672.954) (-671.965) * (-673.132) (-669.774) (-670.201) [-672.271] -- 0:00:20
652500 -- (-667.440) [-668.014] (-668.783) (-669.032) * (-668.038) (-672.351) [-668.719] (-671.246) -- 0:00:20
653000 -- [-669.860] (-668.068) (-668.866) (-668.735) * (-668.038) (-667.129) [-668.829] (-668.311) -- 0:00:21
653500 -- (-670.230) [-670.311] (-668.991) (-669.136) * (-667.589) (-667.471) [-668.866] (-667.040) -- 0:00:21
654000 -- (-669.912) (-667.836) (-670.817) [-671.165] * [-667.172] (-668.081) (-672.559) (-668.112) -- 0:00:21
654500 -- (-671.205) (-668.091) (-670.563) [-669.862] * (-669.675) (-676.495) (-669.762) [-669.213] -- 0:00:21
655000 -- (-667.788) (-667.372) (-669.668) [-672.021] * (-670.296) (-668.636) (-669.343) [-669.521] -- 0:00:21
Average standard deviation of split frequencies: 0.010610
655500 -- (-670.755) (-667.926) [-667.418] (-670.175) * (-668.596) [-667.266] (-668.539) (-669.358) -- 0:00:21
656000 -- (-670.868) (-667.828) (-667.290) [-667.726] * [-668.549] (-667.212) (-668.724) (-669.217) -- 0:00:20
656500 -- (-670.116) (-668.694) [-667.736] (-667.940) * (-669.567) [-666.765] (-672.148) (-666.945) -- 0:00:20
657000 -- (-668.032) (-667.449) (-670.097) [-667.576] * (-668.849) [-666.951] (-672.190) (-668.558) -- 0:00:20
657500 -- [-667.421] (-668.026) (-668.597) (-667.468) * [-667.830] (-667.037) (-668.271) (-668.204) -- 0:00:20
658000 -- (-668.048) (-667.725) (-669.378) [-669.416] * (-670.172) [-668.294] (-668.048) (-667.910) -- 0:00:20
658500 -- (-666.952) [-667.277] (-668.889) (-669.669) * (-669.719) (-673.268) (-674.356) [-670.620] -- 0:00:20
659000 -- (-667.636) (-669.381) [-667.883] (-667.074) * [-668.457] (-667.634) (-670.482) (-671.891) -- 0:00:20
659500 -- (-668.087) (-668.147) (-667.267) [-668.105] * (-667.299) (-670.257) [-669.508] (-669.185) -- 0:00:20
660000 -- (-667.322) (-668.404) [-667.139] (-668.153) * [-668.554] (-670.716) (-668.591) (-671.845) -- 0:00:20
Average standard deviation of split frequencies: 0.010493
660500 -- (-668.114) [-666.695] (-666.878) (-668.370) * (-668.573) (-672.144) [-675.316] (-669.874) -- 0:00:20
661000 -- (-668.056) [-670.893] (-670.478) (-667.668) * (-670.139) (-667.692) (-671.714) [-667.818] -- 0:00:20
661500 -- (-668.005) (-671.023) [-668.172] (-667.929) * (-667.133) (-667.251) [-673.297] (-668.628) -- 0:00:20
662000 -- (-668.227) (-667.963) [-667.675] (-669.278) * (-668.749) (-667.283) [-670.772] (-670.384) -- 0:00:20
662500 -- (-668.462) (-668.862) (-666.848) [-667.137] * (-667.994) (-667.607) [-666.698] (-675.483) -- 0:00:20
663000 -- (-670.025) (-667.824) [-673.284] (-667.263) * [-667.877] (-671.659) (-668.599) (-671.398) -- 0:00:20
663500 -- [-669.555] (-668.655) (-671.010) (-671.634) * (-671.824) (-669.105) [-667.862] (-670.939) -- 0:00:20
664000 -- (-670.407) (-666.614) [-667.077] (-671.916) * (-668.152) [-670.043] (-667.630) (-669.571) -- 0:00:20
664500 -- (-667.980) (-668.747) (-669.182) [-667.642] * (-668.210) (-669.465) [-674.576] (-669.550) -- 0:00:20
665000 -- (-670.965) [-669.688] (-669.362) (-667.651) * [-668.282] (-669.206) (-668.866) (-669.347) -- 0:00:20
Average standard deviation of split frequencies: 0.010659
665500 -- (-673.041) [-667.276] (-667.061) (-669.069) * (-669.332) [-668.316] (-670.857) (-668.705) -- 0:00:20
666000 -- (-667.169) [-667.792] (-670.367) (-668.809) * (-668.390) (-670.602) [-668.767] (-670.918) -- 0:00:20
666500 -- (-670.213) (-671.731) (-671.875) [-669.503] * (-670.098) (-667.033) (-667.865) [-669.363] -- 0:00:20
667000 -- (-668.536) [-667.627] (-669.077) (-667.680) * (-672.578) (-667.771) [-668.447] (-667.429) -- 0:00:19
667500 -- (-670.979) (-669.398) [-667.404] (-668.066) * (-671.508) [-668.585] (-668.234) (-670.014) -- 0:00:19
668000 -- [-669.826] (-669.516) (-669.666) (-670.832) * (-671.171) (-668.195) [-668.401] (-669.118) -- 0:00:19
668500 -- (-667.273) (-669.148) [-668.312] (-668.786) * (-670.952) (-669.044) (-667.863) [-668.711] -- 0:00:19
669000 -- [-668.592] (-675.308) (-667.157) (-671.279) * (-669.077) [-667.904] (-668.920) (-671.224) -- 0:00:19
669500 -- [-667.157] (-675.520) (-667.190) (-670.837) * (-670.087) (-669.503) [-670.590] (-670.635) -- 0:00:20
670000 -- (-667.005) [-671.908] (-668.606) (-669.692) * [-668.507] (-670.226) (-667.628) (-669.251) -- 0:00:20
Average standard deviation of split frequencies: 0.010915
670500 -- [-667.060] (-667.773) (-667.969) (-670.292) * (-670.213) (-670.159) (-667.173) [-668.228] -- 0:00:20
671000 -- (-666.746) [-668.103] (-670.228) (-669.369) * (-674.290) [-667.501] (-667.016) (-673.079) -- 0:00:20
671500 -- [-667.385] (-670.463) (-671.164) (-670.168) * (-668.228) (-669.555) [-668.894] (-668.341) -- 0:00:20
672000 -- [-667.725] (-667.744) (-668.633) (-669.737) * (-672.285) (-668.514) [-671.829] (-666.773) -- 0:00:20
672500 -- [-669.394] (-670.597) (-667.263) (-669.013) * (-670.627) [-669.521] (-672.920) (-671.363) -- 0:00:19
673000 -- (-667.368) (-671.939) [-667.332] (-675.151) * (-670.287) [-670.045] (-669.654) (-670.439) -- 0:00:19
673500 -- (-668.687) [-671.183] (-667.218) (-669.124) * (-670.373) (-672.148) (-670.397) [-668.202] -- 0:00:19
674000 -- [-667.755] (-671.392) (-668.280) (-667.612) * (-670.644) (-668.326) [-669.147] (-668.164) -- 0:00:19
674500 -- (-668.367) (-667.202) [-669.456] (-668.400) * [-672.207] (-667.486) (-669.414) (-670.767) -- 0:00:19
675000 -- [-667.734] (-667.216) (-671.074) (-668.212) * (-667.096) (-667.417) [-669.875] (-669.440) -- 0:00:19
Average standard deviation of split frequencies: 0.010911
675500 -- (-669.045) [-669.671] (-669.746) (-667.986) * [-670.883] (-670.089) (-671.194) (-671.378) -- 0:00:19
676000 -- (-671.555) (-671.204) (-675.654) [-667.089] * (-668.400) (-668.141) [-672.087] (-668.759) -- 0:00:19
676500 -- (-670.992) (-668.735) (-668.992) [-667.649] * [-671.551] (-669.572) (-668.819) (-667.594) -- 0:00:19
677000 -- [-667.815] (-667.591) (-670.274) (-667.403) * (-669.211) (-667.669) [-671.263] (-671.014) -- 0:00:19
677500 -- [-670.290] (-671.352) (-667.353) (-669.082) * (-668.840) (-670.268) (-669.525) [-668.508] -- 0:00:19
678000 -- (-668.021) (-668.973) (-668.877) [-668.162] * (-669.124) (-673.326) [-668.418] (-668.837) -- 0:00:19
678500 -- [-668.860] (-667.829) (-673.517) (-669.253) * (-668.859) [-668.644] (-667.249) (-669.235) -- 0:00:19
679000 -- (-669.789) [-669.063] (-670.275) (-670.070) * (-668.037) [-668.173] (-669.417) (-668.454) -- 0:00:19
679500 -- [-668.060] (-667.760) (-669.014) (-672.231) * (-668.270) [-667.256] (-671.891) (-670.164) -- 0:00:19
680000 -- (-668.033) (-668.227) [-669.208] (-670.827) * (-667.897) [-668.311] (-676.668) (-671.625) -- 0:00:19
Average standard deviation of split frequencies: 0.011040
680500 -- [-667.673] (-669.668) (-669.259) (-673.901) * (-667.630) [-668.001] (-670.318) (-670.754) -- 0:00:19
681000 -- [-668.408] (-669.983) (-669.819) (-672.057) * (-669.930) (-667.476) (-670.330) [-671.294] -- 0:00:19
681500 -- (-669.535) (-673.662) (-670.000) [-667.116] * (-670.568) (-669.331) [-669.461] (-669.137) -- 0:00:19
682000 -- [-668.314] (-666.932) (-668.779) (-668.823) * (-667.875) [-670.040] (-670.275) (-667.864) -- 0:00:19
682500 -- (-667.958) (-667.316) (-668.741) [-668.346] * (-668.856) (-670.264) (-666.936) [-669.559] -- 0:00:19
683000 -- (-669.592) [-667.164] (-668.466) (-667.197) * [-668.413] (-668.996) (-667.849) (-668.582) -- 0:00:19
683500 -- (-669.979) [-670.514] (-670.982) (-668.619) * (-670.567) [-670.036] (-670.556) (-668.380) -- 0:00:18
684000 -- (-668.980) (-671.086) [-669.670] (-668.822) * (-669.516) (-669.670) [-670.478] (-670.161) -- 0:00:18
684500 -- [-669.489] (-669.030) (-669.793) (-670.892) * (-670.846) [-668.066] (-670.558) (-670.174) -- 0:00:18
685000 -- [-668.901] (-668.513) (-673.752) (-667.309) * [-667.835] (-669.510) (-668.540) (-673.904) -- 0:00:18
Average standard deviation of split frequencies: 0.010227
685500 -- (-671.163) (-669.163) (-668.502) [-667.045] * (-671.129) (-671.073) (-667.698) [-667.274] -- 0:00:18
686000 -- (-673.249) (-667.947) [-667.216] (-667.045) * (-669.824) [-669.988] (-670.786) (-670.002) -- 0:00:19
686500 -- (-668.607) (-668.937) (-668.866) [-667.157] * (-667.998) (-671.526) [-668.109] (-669.464) -- 0:00:19
687000 -- (-670.340) (-667.783) [-668.945] (-673.253) * [-669.884] (-668.186) (-669.527) (-668.837) -- 0:00:19
687500 -- (-668.551) (-672.176) (-668.902) [-668.596] * (-669.520) [-670.928] (-669.742) (-668.488) -- 0:00:19
688000 -- (-669.186) [-670.339] (-668.323) (-669.803) * (-671.882) (-671.954) [-668.120] (-668.294) -- 0:00:19
688500 -- [-673.244] (-668.934) (-667.767) (-669.047) * (-674.858) (-669.567) (-667.172) [-667.887] -- 0:00:19
689000 -- [-669.408] (-668.767) (-668.416) (-669.467) * (-676.144) [-667.535] (-668.624) (-669.181) -- 0:00:18
689500 -- [-668.676] (-675.991) (-668.151) (-670.937) * (-668.445) [-670.160] (-670.579) (-672.600) -- 0:00:18
690000 -- (-667.463) (-670.954) (-667.841) [-668.842] * (-668.762) (-667.805) (-669.061) [-668.957] -- 0:00:18
Average standard deviation of split frequencies: 0.010281
690500 -- (-667.837) (-668.352) (-667.516) [-668.849] * (-668.046) (-668.505) [-666.927] (-667.204) -- 0:00:18
691000 -- (-671.325) (-669.967) (-669.886) [-667.282] * [-667.379] (-671.832) (-668.898) (-667.280) -- 0:00:18
691500 -- (-667.186) (-669.384) [-666.830] (-667.634) * (-667.869) (-672.444) [-667.337] (-672.911) -- 0:00:18
692000 -- (-671.619) (-671.770) (-668.095) [-668.512] * (-668.726) (-670.505) [-667.704] (-669.117) -- 0:00:18
692500 -- [-667.909] (-674.381) (-667.640) (-668.133) * (-668.188) [-670.991] (-667.971) (-666.926) -- 0:00:18
693000 -- (-667.585) (-672.886) (-668.642) [-668.276] * (-666.981) [-668.680] (-668.549) (-670.789) -- 0:00:18
693500 -- [-673.447] (-670.037) (-669.192) (-668.333) * (-668.562) [-667.103] (-667.967) (-670.296) -- 0:00:18
694000 -- (-672.267) (-669.751) [-673.609] (-668.362) * [-668.015] (-668.682) (-671.415) (-670.167) -- 0:00:18
694500 -- (-671.596) (-668.728) (-673.751) [-667.895] * (-674.591) [-667.978] (-667.928) (-669.638) -- 0:00:18
695000 -- [-667.935] (-668.979) (-668.285) (-669.079) * (-669.894) (-673.827) [-667.709] (-669.320) -- 0:00:18
Average standard deviation of split frequencies: 0.010033
695500 -- (-668.027) (-668.363) (-669.420) [-668.891] * (-668.192) (-671.464) [-669.133] (-671.832) -- 0:00:18
696000 -- (-670.375) [-668.365] (-670.812) (-671.484) * [-668.197] (-667.105) (-666.994) (-668.673) -- 0:00:18
696500 -- (-668.874) (-670.926) [-667.549] (-668.725) * (-668.846) (-667.431) [-668.842] (-667.314) -- 0:00:18
697000 -- (-670.003) (-672.025) [-667.944] (-670.732) * (-668.721) [-667.513] (-668.201) (-668.089) -- 0:00:18
697500 -- (-670.210) (-673.182) [-669.181] (-673.891) * (-668.365) (-667.429) (-669.706) [-667.220] -- 0:00:18
698000 -- (-672.498) (-672.820) [-668.041] (-669.743) * (-669.025) [-668.551] (-667.130) (-667.950) -- 0:00:18
698500 -- (-668.731) (-669.504) (-668.914) [-670.123] * (-670.469) (-669.879) [-667.677] (-668.693) -- 0:00:18
699000 -- [-667.481] (-668.643) (-668.590) (-667.840) * (-667.346) (-668.285) [-667.087] (-670.536) -- 0:00:18
699500 -- (-675.260) (-667.141) [-668.015] (-671.821) * (-669.459) [-671.116] (-668.842) (-672.160) -- 0:00:18
700000 -- (-668.646) (-668.507) [-670.784] (-667.975) * (-668.082) [-669.971] (-668.512) (-672.242) -- 0:00:18
Average standard deviation of split frequencies: 0.010344
700500 -- [-669.515] (-668.858) (-668.520) (-669.531) * (-668.264) [-668.798] (-670.079) (-669.147) -- 0:00:17
701000 -- (-669.411) (-668.594) (-667.239) [-669.822] * (-667.773) (-669.371) [-668.597] (-673.351) -- 0:00:17
701500 -- [-667.530] (-667.370) (-667.614) (-673.177) * (-668.004) (-669.781) (-668.383) [-668.593] -- 0:00:17
702000 -- (-668.898) (-667.749) (-668.757) [-668.405] * (-668.868) (-670.289) (-670.522) [-668.261] -- 0:00:17
702500 -- [-669.069] (-674.042) (-670.015) (-669.006) * [-671.135] (-668.114) (-668.634) (-670.225) -- 0:00:17
703000 -- (-667.064) (-669.643) (-667.317) [-666.730] * (-667.543) (-666.873) (-669.508) [-668.160] -- 0:00:18
703500 -- (-668.579) (-669.357) [-667.093] (-667.852) * (-669.682) (-668.410) (-668.016) [-667.641] -- 0:00:18
704000 -- (-669.165) (-667.909) [-667.176] (-670.365) * (-667.489) [-668.013] (-667.297) (-669.158) -- 0:00:18
704500 -- (-668.297) (-668.990) (-669.143) [-671.606] * (-673.943) (-669.903) (-668.852) [-667.338] -- 0:00:18
705000 -- (-668.710) (-668.675) [-669.856] (-669.580) * (-669.566) [-668.568] (-668.528) (-672.878) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
705500 -- (-667.586) (-668.997) [-667.243] (-668.052) * [-671.738] (-669.359) (-669.157) (-671.150) -- 0:00:17
706000 -- [-668.094] (-667.814) (-669.777) (-666.623) * (-667.700) (-669.390) [-669.603] (-671.974) -- 0:00:17
706500 -- [-669.330] (-668.095) (-670.931) (-669.948) * (-668.968) (-671.585) [-669.805] (-669.089) -- 0:00:17
707000 -- (-674.890) [-669.525] (-669.397) (-670.684) * (-672.650) (-668.491) (-670.089) [-669.073] -- 0:00:17
707500 -- (-668.946) [-668.108] (-670.516) (-668.457) * (-672.406) (-672.368) [-672.226] (-667.389) -- 0:00:17
708000 -- (-670.696) (-668.772) (-668.858) [-667.758] * [-670.163] (-668.563) (-667.961) (-667.411) -- 0:00:17
708500 -- [-670.543] (-673.815) (-667.630) (-669.765) * [-668.782] (-668.263) (-672.904) (-669.799) -- 0:00:17
709000 -- (-670.405) [-669.755] (-666.730) (-673.305) * (-668.430) (-671.583) (-670.454) [-671.361] -- 0:00:17
709500 -- [-668.008] (-673.014) (-671.633) (-669.563) * (-667.624) (-670.176) (-667.722) [-673.470] -- 0:00:17
710000 -- (-667.115) (-669.383) (-668.780) [-668.114] * (-669.321) [-669.324] (-666.787) (-668.813) -- 0:00:17
Average standard deviation of split frequencies: 0.009826
710500 -- [-667.513] (-669.719) (-670.121) (-668.042) * (-668.031) (-667.121) (-667.386) [-671.101] -- 0:00:17
711000 -- (-667.650) [-667.491] (-669.078) (-669.922) * (-669.906) [-669.267] (-672.719) (-669.862) -- 0:00:17
711500 -- [-668.708] (-667.645) (-670.469) (-670.769) * (-668.108) (-667.614) [-668.419] (-669.986) -- 0:00:17
712000 -- (-667.755) [-667.973] (-673.233) (-673.751) * [-668.154] (-671.291) (-667.670) (-667.724) -- 0:00:17
712500 -- (-668.677) (-672.235) (-667.610) [-668.569] * (-670.197) (-667.636) (-668.738) [-669.036] -- 0:00:17
713000 -- [-667.955] (-669.989) (-668.328) (-668.854) * [-669.733] (-669.202) (-672.874) (-669.760) -- 0:00:17
713500 -- (-672.288) [-669.475] (-670.229) (-669.906) * (-667.534) (-675.832) (-668.881) [-667.310] -- 0:00:17
714000 -- (-667.799) [-668.638] (-668.511) (-671.356) * [-669.639] (-673.278) (-667.940) (-669.632) -- 0:00:17
714500 -- (-667.349) (-668.048) [-671.038] (-669.153) * (-667.394) [-667.980] (-670.082) (-669.240) -- 0:00:17
715000 -- (-670.191) [-669.823] (-669.859) (-667.837) * (-668.784) [-668.890] (-668.800) (-667.508) -- 0:00:17
Average standard deviation of split frequencies: 0.010805
715500 -- [-673.722] (-668.903) (-670.799) (-667.195) * [-670.087] (-671.999) (-667.821) (-668.504) -- 0:00:17
716000 -- (-674.589) (-669.754) (-674.000) [-668.442] * (-668.680) (-671.620) (-667.547) [-668.004] -- 0:00:17
716500 -- (-669.851) [-666.817] (-672.123) (-668.370) * [-667.102] (-668.205) (-667.507) (-667.032) -- 0:00:17
717000 -- [-667.514] (-669.213) (-669.220) (-668.281) * (-667.446) [-668.603] (-670.029) (-667.360) -- 0:00:16
717500 -- (-668.034) (-672.542) [-668.554] (-669.350) * (-672.156) (-671.194) (-671.660) [-668.768] -- 0:00:16
718000 -- [-667.180] (-670.376) (-667.913) (-667.231) * (-669.349) (-669.040) [-670.080] (-672.168) -- 0:00:16
718500 -- (-671.446) [-669.566] (-667.611) (-667.387) * (-668.727) (-670.090) [-667.022] (-668.578) -- 0:00:16
719000 -- (-669.750) [-668.532] (-668.854) (-667.594) * (-669.096) (-667.788) [-667.252] (-668.287) -- 0:00:16
719500 -- (-669.223) [-668.395] (-670.170) (-668.502) * [-669.165] (-668.536) (-668.302) (-670.935) -- 0:00:17
720000 -- (-668.762) (-669.192) [-670.193] (-671.513) * (-668.698) [-666.837] (-667.730) (-669.962) -- 0:00:17
Average standard deviation of split frequencies: 0.009853
720500 -- (-670.189) (-667.294) (-669.778) [-672.278] * (-668.880) (-667.795) (-669.663) [-667.118] -- 0:00:17
721000 -- (-667.944) [-667.739] (-672.570) (-667.170) * [-668.292] (-667.349) (-669.224) (-669.622) -- 0:00:17
721500 -- (-669.204) [-667.652] (-668.692) (-668.116) * (-666.576) [-668.944] (-667.822) (-669.539) -- 0:00:16
722000 -- (-668.180) (-669.185) [-669.192] (-668.780) * [-666.815] (-667.562) (-670.903) (-673.577) -- 0:00:16
722500 -- (-668.849) [-666.915] (-668.335) (-668.974) * (-668.420) (-669.254) (-673.791) [-667.096] -- 0:00:16
723000 -- [-670.640] (-667.090) (-667.439) (-669.958) * [-669.544] (-669.829) (-669.362) (-670.580) -- 0:00:16
723500 -- [-667.786] (-669.269) (-667.894) (-667.759) * (-670.309) [-668.704] (-669.540) (-669.490) -- 0:00:16
724000 -- (-668.787) (-668.530) (-667.212) [-668.148] * [-668.352] (-668.560) (-670.291) (-671.530) -- 0:00:16
724500 -- (-667.174) (-669.511) (-672.439) [-668.113] * (-669.913) (-668.417) [-669.421] (-670.873) -- 0:00:16
725000 -- (-669.813) (-667.069) [-668.421] (-667.623) * (-667.660) (-669.165) [-667.821] (-668.482) -- 0:00:16
Average standard deviation of split frequencies: 0.009983
725500 -- [-668.570] (-668.371) (-668.446) (-666.937) * [-667.229] (-669.338) (-669.714) (-668.365) -- 0:00:16
726000 -- (-669.509) [-667.951] (-673.210) (-667.187) * (-669.706) [-667.334] (-667.919) (-666.906) -- 0:00:16
726500 -- [-668.131] (-667.776) (-667.879) (-668.539) * (-673.332) [-666.839] (-667.885) (-668.971) -- 0:00:16
727000 -- (-668.793) [-672.115] (-669.293) (-669.490) * (-673.022) (-672.791) (-669.643) [-668.827] -- 0:00:16
727500 -- [-669.616] (-672.252) (-671.647) (-668.082) * (-669.408) [-670.967] (-670.764) (-667.999) -- 0:00:16
728000 -- [-669.155] (-670.972) (-669.440) (-668.230) * (-668.997) [-668.930] (-668.566) (-671.399) -- 0:00:16
728500 -- [-667.590] (-669.187) (-671.000) (-668.564) * (-668.960) [-673.578] (-667.298) (-672.402) -- 0:00:16
729000 -- (-669.132) (-667.589) (-670.393) [-668.739] * [-669.542] (-671.412) (-667.355) (-667.996) -- 0:00:16
729500 -- (-668.955) (-668.509) (-667.644) [-669.435] * (-670.076) (-667.020) [-667.926] (-668.573) -- 0:00:16
730000 -- (-671.096) (-672.393) [-666.791] (-669.381) * [-668.234] (-668.087) (-667.057) (-667.584) -- 0:00:16
Average standard deviation of split frequencies: 0.010161
730500 -- (-670.153) (-670.950) (-667.578) [-667.751] * (-668.250) [-669.794] (-668.897) (-667.685) -- 0:00:16
731000 -- (-671.413) (-671.804) (-667.445) [-672.906] * (-671.680) (-668.374) [-668.207] (-668.760) -- 0:00:16
731500 -- (-671.602) (-670.681) [-672.088] (-672.889) * (-669.918) [-666.661] (-670.579) (-669.688) -- 0:00:16
732000 -- [-671.034] (-668.213) (-667.138) (-669.774) * (-667.735) [-667.384] (-668.688) (-673.355) -- 0:00:16
732500 -- (-668.760) [-669.507] (-668.554) (-672.791) * (-670.352) [-666.654] (-670.110) (-667.470) -- 0:00:16
733000 -- (-667.264) (-669.542) (-668.047) [-671.713] * (-669.832) [-667.069] (-670.006) (-669.822) -- 0:00:16
733500 -- (-670.166) (-668.518) (-670.117) [-670.509] * (-672.795) (-669.635) (-674.537) [-669.182] -- 0:00:15
734000 -- (-669.440) (-672.432) (-667.687) [-669.560] * (-671.409) (-668.595) (-667.416) [-668.459] -- 0:00:15
734500 -- (-669.151) (-670.531) (-672.542) [-670.400] * (-667.836) [-667.221] (-673.417) (-672.086) -- 0:00:15
735000 -- (-668.483) (-668.734) [-668.263] (-670.466) * (-668.319) [-668.128] (-667.581) (-669.328) -- 0:00:15
Average standard deviation of split frequencies: 0.011604
735500 -- (-669.314) [-668.261] (-668.826) (-667.310) * (-670.661) (-667.428) [-671.098] (-669.526) -- 0:00:15
736000 -- (-668.436) (-674.219) (-667.877) [-669.489] * (-668.357) [-668.808] (-669.995) (-669.074) -- 0:00:15
736500 -- [-666.664] (-671.534) (-670.352) (-670.985) * (-671.324) (-671.819) [-668.880] (-667.327) -- 0:00:16
737000 -- (-667.000) [-670.226] (-674.109) (-669.105) * (-668.898) [-668.402] (-668.250) (-667.468) -- 0:00:16
737500 -- [-669.208] (-670.814) (-668.188) (-669.446) * [-668.135] (-668.228) (-671.450) (-670.805) -- 0:00:16
738000 -- (-667.809) (-667.591) [-673.755] (-672.841) * (-668.496) (-672.983) (-669.182) [-670.228] -- 0:00:15
738500 -- (-669.291) [-668.926] (-674.751) (-673.710) * [-670.127] (-673.932) (-669.364) (-668.021) -- 0:00:15
739000 -- [-669.835] (-670.368) (-668.928) (-673.391) * (-668.330) (-669.071) [-666.701] (-668.119) -- 0:00:15
739500 -- (-671.598) (-667.831) (-670.711) [-669.186] * (-668.554) (-670.702) [-671.417] (-668.279) -- 0:00:15
740000 -- (-671.510) (-671.354) [-669.757] (-667.464) * (-668.542) (-669.013) [-670.810] (-669.505) -- 0:00:15
Average standard deviation of split frequencies: 0.011606
740500 -- (-669.421) (-668.914) [-667.408] (-667.157) * (-667.378) (-671.405) (-669.279) [-670.005] -- 0:00:15
741000 -- (-669.353) [-669.658] (-669.299) (-666.829) * (-669.572) (-671.005) (-667.294) [-669.051] -- 0:00:15
741500 -- (-672.208) (-669.387) (-669.192) [-668.753] * (-668.493) (-673.017) (-669.455) [-669.051] -- 0:00:15
742000 -- (-671.624) (-668.385) [-669.052] (-671.351) * (-668.091) (-670.672) [-668.304] (-667.877) -- 0:00:15
742500 -- (-672.934) (-672.345) [-667.949] (-669.550) * (-667.640) (-671.391) [-667.996] (-667.865) -- 0:00:15
743000 -- [-667.321] (-669.971) (-668.631) (-670.274) * (-667.272) (-669.740) (-667.092) [-671.566] -- 0:00:15
743500 -- (-672.129) (-669.285) (-670.036) [-668.172] * (-667.000) (-667.033) [-667.639] (-671.111) -- 0:00:15
744000 -- (-672.230) (-667.335) [-667.657] (-671.204) * (-669.755) (-669.588) [-668.531] (-671.783) -- 0:00:15
744500 -- (-675.278) (-667.141) [-667.575] (-668.429) * (-670.500) [-670.900] (-668.865) (-669.933) -- 0:00:15
745000 -- (-669.213) (-667.998) [-668.260] (-668.501) * (-669.145) (-669.648) (-667.840) [-669.390] -- 0:00:15
Average standard deviation of split frequencies: 0.011412
745500 -- (-673.805) (-669.937) [-668.187] (-671.081) * (-668.980) (-667.241) [-669.709] (-667.264) -- 0:00:15
746000 -- (-670.946) (-671.909) [ 