--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:58:19 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/bcp/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -668.17 -671.14
2 -668.18 -670.90
--------------------------------------
TOTAL -668.17 -671.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893921 0.088972 0.322268 1.459693 0.864591 1290.23 1325.50 1.000
r(A<->C){all} 0.160751 0.019036 0.000179 0.439043 0.123153 222.54 239.57 1.000
r(A<->G){all} 0.174784 0.020772 0.000037 0.464746 0.138812 208.87 257.17 1.001
r(A<->T){all} 0.159280 0.019376 0.000122 0.452633 0.121841 178.73 219.46 1.001
r(C<->G){all} 0.162248 0.019311 0.000031 0.443438 0.128908 259.43 299.70 1.000
r(C<->T){all} 0.172383 0.022011 0.000116 0.465211 0.130904 338.73 369.23 1.001
r(G<->T){all} 0.170554 0.021483 0.000009 0.469751 0.130808 150.73 230.85 1.001
pi(A){all} 0.221675 0.000356 0.187121 0.260398 0.221973 1313.31 1319.56 1.001
pi(C){all} 0.280740 0.000406 0.241271 0.319069 0.280491 1198.18 1349.59 1.000
pi(G){all} 0.275550 0.000402 0.240000 0.318679 0.274933 1126.95 1151.64 1.003
pi(T){all} 0.222035 0.000341 0.184966 0.256353 0.221148 1168.41 1202.56 1.000
alpha{1,2} 0.429733 0.234479 0.000248 1.400922 0.253700 1273.23 1287.18 1.001
alpha{3} 0.472316 0.242007 0.000195 1.481140 0.310018 1062.07 1146.16 1.000
pinvar{all} 0.996845 0.000014 0.989834 0.999998 0.998079 1295.44 1296.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -648.440542
Model 2: PositiveSelection -648.440428
Model 0: one-ratio -648.440551
Model 7: beta -648.440428
Model 8: beta&w>1 -648.440428
Model 0 vs 1 1.799999995455437E-5
Model 2 vs 1 2.2800000010647636E-4
Model 8 vs 7 0.0
>C1
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C2
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C3
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C4
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C5
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C6
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
C1 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C2 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C3 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C4 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C5 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C6 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
**************************************************
C1 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C2 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C3 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C4 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C5 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C6 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
**************************************************
C1 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C2 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C3 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C4 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C5 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C6 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
**************************************************
C1 LRRDLSLLECC
C2 LRRDLSLLECC
C3 LRRDLSLLECC
C4 LRRDLSLLECC
C5 LRRDLSLLECC
C6 LRRDLSLLECC
***********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 161 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 161 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4830]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4830]--->[4830]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.465 Mb, Max= 30.692 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C2 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C3 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C4 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C5 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
C6 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
**************************************************
C1 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C2 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C3 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C4 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C5 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
C6 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
**************************************************
C1 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C2 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C3 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C4 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C5 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
C6 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
**************************************************
C1 LRRDLSLLECC
C2 LRRDLSLLECC
C3 LRRDLSLLECC
C4 LRRDLSLLECC
C5 LRRDLSLLECC
C6 LRRDLSLLECC
***********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C2 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C3 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C4 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C5 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
C6 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
**************************************************
C1 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C2 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C3 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C4 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C5 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
C6 CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
**************************************************
C1 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C2 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C3 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C4 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C5 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
C6 AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
**************************************************
C1 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C2 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C3 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C4 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C5 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
C6 AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
**************************************************
C1 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C2 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C3 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C4 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C5 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
C6 GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
**************************************************
C1 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C2 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C3 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C4 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C5 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
C6 TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
**************************************************
C1 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C2 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C3 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C4 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C5 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
C6 AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
**************************************************
C1 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C2 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C3 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C4 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C5 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
C6 GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
**************************************************
C1 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C2 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C3 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C4 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C5 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
C6 AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
**************************************************
C1 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C2 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C3 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C4 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C5 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
C6 CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
*********************************
>C1
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C2
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C3
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C4
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C5
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C6
TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG
CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC
AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT
AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG
GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT
TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT
AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA
GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA
AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA
CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>C1
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C2
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C3
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C4
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C5
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
>C6
LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
LRRDLSLLECC
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 483 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773420
Setting output file names to "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 792386519
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8404762428
Seed = 1013778966
Swapseed = 1579773420
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1080.977156 -- -24.965149
Chain 2 -- -1080.977094 -- -24.965149
Chain 3 -- -1080.976991 -- -24.965149
Chain 4 -- -1080.977156 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1080.977156 -- -24.965149
Chain 2 -- -1080.977156 -- -24.965149
Chain 3 -- -1080.977156 -- -24.965149
Chain 4 -- -1080.977094 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1080.977] (-1080.977) (-1080.977) (-1080.977) * [-1080.977] (-1080.977) (-1080.977) (-1080.977)
500 -- (-674.128) (-679.437) [-669.971] (-678.387) * (-677.292) (-680.826) [-682.927] (-682.696) -- 0:00:00
1000 -- (-675.606) (-682.991) (-676.967) [-678.225] * (-677.486) (-680.378) [-670.960] (-679.268) -- 0:00:00
1500 -- [-674.846] (-671.950) (-673.921) (-677.473) * [-677.543] (-688.891) (-673.900) (-681.372) -- 0:00:00
2000 -- (-683.683) (-680.701) (-674.222) [-679.502] * (-674.444) (-683.597) [-676.260] (-672.348) -- 0:00:00
2500 -- (-679.015) [-678.340] (-682.508) (-679.207) * (-682.230) (-680.396) [-678.080] (-683.466) -- 0:00:00
3000 -- (-683.074) (-675.088) (-679.255) [-676.386] * (-680.557) [-674.656] (-682.795) (-680.419) -- 0:00:00
3500 -- [-675.496] (-678.048) (-679.352) (-675.394) * (-674.303) (-680.343) [-675.015] (-680.240) -- 0:00:00
4000 -- [-679.653] (-683.636) (-682.181) (-679.224) * (-686.099) (-679.019) [-674.952] (-681.758) -- 0:00:00
4500 -- (-677.810) [-674.545] (-681.492) (-672.757) * [-678.333] (-675.162) (-675.428) (-688.605) -- 0:00:00
5000 -- [-681.155] (-674.349) (-682.453) (-673.568) * [-680.018] (-676.972) (-679.387) (-679.581) -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- (-681.581) (-686.766) [-676.932] (-676.013) * (-674.904) [-672.302] (-678.446) (-685.023) -- 0:03:00
6000 -- [-671.188] (-677.755) (-685.769) (-675.335) * [-679.927] (-690.506) (-679.068) (-683.770) -- 0:02:45
6500 -- (-674.529) [-673.234] (-678.467) (-672.290) * (-676.392) (-680.748) (-677.257) [-685.991] -- 0:02:32
7000 -- (-688.575) (-674.361) (-692.238) [-672.528] * [-676.880] (-674.882) (-686.558) (-672.780) -- 0:02:21
7500 -- (-682.196) [-689.453] (-676.132) (-681.918) * [-677.558] (-674.827) (-681.925) (-666.666) -- 0:02:12
8000 -- [-672.018] (-667.626) (-679.971) (-681.867) * (-675.099) (-677.826) (-680.442) [-668.706] -- 0:02:04
8500 -- (-678.558) [-667.073] (-678.132) (-671.795) * (-686.291) [-678.717] (-675.340) (-668.314) -- 0:01:56
9000 -- (-674.580) (-668.026) [-682.057] (-677.400) * (-674.517) [-673.109] (-679.062) (-670.128) -- 0:01:50
9500 -- (-686.214) (-667.315) [-678.350] (-674.886) * (-667.729) [-681.637] (-674.767) (-667.445) -- 0:01:44
10000 -- (-683.568) [-668.419] (-677.703) (-670.243) * [-672.131] (-677.863) (-685.335) (-669.568) -- 0:01:39
Average standard deviation of split frequencies: 0.058150
10500 -- [-676.179] (-671.119) (-674.609) (-677.485) * (-669.466) [-676.881] (-676.944) (-671.071) -- 0:01:34
11000 -- (-673.440) (-674.335) [-680.052] (-684.210) * (-668.339) (-680.040) (-681.303) [-666.688] -- 0:01:29
11500 -- (-687.681) (-670.204) [-680.452] (-681.846) * (-667.923) [-680.952] (-681.071) (-668.415) -- 0:01:25
12000 -- (-674.015) (-670.612) [-673.150] (-685.734) * (-674.726) (-681.440) (-675.219) [-667.814] -- 0:01:22
12500 -- (-672.705) (-668.958) (-676.701) [-672.060] * [-669.080] (-681.792) (-674.791) (-667.476) -- 0:01:19
13000 -- (-674.669) (-670.004) (-682.454) [-674.820] * [-667.761] (-679.894) (-675.976) (-669.124) -- 0:01:15
13500 -- (-675.874) (-670.584) (-680.568) [-673.541] * (-669.854) [-679.903] (-674.270) (-669.316) -- 0:01:13
14000 -- (-673.473) (-670.051) [-678.559] (-677.264) * (-669.614) [-673.902] (-674.846) (-670.062) -- 0:01:10
14500 -- (-673.892) (-671.034) (-672.957) [-679.406] * (-671.053) (-688.961) [-675.515] (-668.222) -- 0:01:07
15000 -- (-674.897) (-671.426) (-686.129) [-675.844] * (-669.354) (-700.082) (-687.193) [-666.901] -- 0:01:05
Average standard deviation of split frequencies: 0.051172
15500 -- (-675.912) [-668.639] (-679.247) (-675.240) * (-673.532) (-684.109) [-675.852] (-667.521) -- 0:01:03
16000 -- (-674.114) (-666.878) [-677.363] (-675.064) * (-672.410) (-668.285) [-676.802] (-667.296) -- 0:01:01
16500 -- (-677.746) [-668.483] (-675.570) (-676.676) * (-673.152) (-667.632) [-678.883] (-668.385) -- 0:00:59
17000 -- (-673.415) (-667.653) (-677.374) [-677.706] * (-669.537) [-667.012] (-675.922) (-669.737) -- 0:00:57
17500 -- (-685.812) (-668.398) [-676.365] (-681.705) * [-666.771] (-669.083) (-682.829) (-672.060) -- 0:00:56
18000 -- (-675.847) [-669.707] (-679.261) (-675.408) * (-668.163) (-667.462) [-673.206] (-669.592) -- 0:00:54
18500 -- (-677.536) (-669.147) (-680.007) [-675.529] * (-670.614) (-668.344) (-679.218) [-667.673] -- 0:00:53
19000 -- [-679.077] (-668.230) (-679.348) (-675.766) * (-667.864) [-670.590] (-681.901) (-673.299) -- 0:00:51
19500 -- (-675.438) (-667.496) [-685.894] (-677.801) * (-668.300) (-669.468) (-679.900) [-667.750] -- 0:00:50
20000 -- (-678.843) (-667.357) [-682.061] (-681.137) * (-671.168) [-668.502] (-687.587) (-667.144) -- 0:00:49
Average standard deviation of split frequencies: 0.060026
20500 -- (-678.797) (-669.794) [-673.656] (-686.831) * (-670.408) (-674.568) (-685.661) [-668.780] -- 0:01:35
21000 -- [-678.587] (-667.058) (-677.000) (-690.808) * (-668.928) [-669.963] (-681.439) (-667.660) -- 0:01:33
21500 -- [-677.837] (-668.448) (-681.538) (-666.963) * (-671.253) [-666.868] (-668.852) (-667.787) -- 0:01:31
22000 -- (-689.110) (-667.564) (-672.473) [-670.385] * (-673.791) [-667.213] (-669.397) (-668.686) -- 0:01:28
22500 -- [-670.933] (-668.764) (-673.972) (-670.049) * [-670.715] (-670.525) (-668.232) (-670.891) -- 0:01:26
23000 -- (-678.506) (-668.261) [-674.813] (-668.864) * (-668.258) (-667.456) [-669.030] (-675.245) -- 0:01:24
23500 -- (-676.894) (-668.152) [-672.549] (-667.194) * (-671.272) (-668.001) [-667.120] (-672.529) -- 0:01:23
24000 -- (-676.920) (-671.009) [-685.465] (-666.742) * (-667.416) [-668.159] (-668.126) (-668.282) -- 0:01:21
24500 -- [-678.330] (-669.324) (-686.896) (-669.549) * (-667.886) (-672.105) (-669.590) [-668.233] -- 0:01:19
25000 -- (-688.845) (-667.463) [-682.919] (-669.671) * (-668.329) (-667.685) (-675.199) [-666.776] -- 0:01:18
Average standard deviation of split frequencies: 0.061300
25500 -- (-675.906) [-668.037] (-675.064) (-668.717) * (-669.917) (-670.155) (-667.039) [-668.866] -- 0:01:16
26000 -- (-674.608) (-670.067) [-670.904] (-669.469) * (-673.738) (-673.093) (-669.395) [-669.384] -- 0:01:14
26500 -- [-679.162] (-670.604) (-687.439) (-668.737) * [-667.906] (-667.872) (-670.071) (-670.901) -- 0:01:13
27000 -- (-684.852) (-667.168) [-676.687] (-668.512) * (-669.630) (-667.770) (-668.489) [-668.701] -- 0:01:12
27500 -- (-674.066) (-667.838) [-679.348] (-668.950) * (-668.027) [-666.650] (-669.354) (-673.557) -- 0:01:10
28000 -- [-677.299] (-673.590) (-674.044) (-668.903) * (-668.803) (-667.558) [-669.153] (-669.880) -- 0:01:09
28500 -- [-675.554] (-668.225) (-680.523) (-669.798) * (-670.892) [-667.792] (-668.914) (-668.224) -- 0:01:08
29000 -- (-680.994) (-668.755) [-675.969] (-670.497) * [-669.119] (-668.031) (-667.077) (-668.094) -- 0:01:06
29500 -- (-673.130) [-667.506] (-679.526) (-667.320) * [-671.594] (-667.473) (-669.040) (-668.400) -- 0:01:05
30000 -- (-675.342) (-668.573) [-676.582] (-673.304) * (-669.458) (-668.295) (-668.752) [-668.199] -- 0:01:04
Average standard deviation of split frequencies: 0.042456
30500 -- [-676.639] (-670.345) (-682.396) (-668.722) * [-669.487] (-667.826) (-669.516) (-668.287) -- 0:01:03
31000 -- (-671.433) (-668.074) (-677.971) [-669.014] * (-670.938) [-667.477] (-669.268) (-670.128) -- 0:01:02
31500 -- [-675.369] (-668.766) (-681.862) (-667.110) * (-670.287) (-670.146) (-667.825) [-670.402] -- 0:01:01
32000 -- (-680.185) (-673.616) (-675.567) [-669.072] * (-668.630) [-671.712] (-668.192) (-672.111) -- 0:01:00
32500 -- (-678.960) [-670.311] (-678.239) (-668.555) * [-668.331] (-669.174) (-668.198) (-673.251) -- 0:00:59
33000 -- (-677.151) (-670.678) (-680.662) [-667.522] * (-667.409) (-669.943) (-667.611) [-668.934] -- 0:00:58
33500 -- (-678.489) (-668.916) [-676.547] (-669.729) * (-669.488) (-668.904) [-668.961] (-669.369) -- 0:00:57
34000 -- (-678.897) (-669.385) [-678.261] (-667.070) * (-670.557) (-668.838) [-675.649] (-669.576) -- 0:00:56
34500 -- (-679.940) [-668.623] (-678.120) (-668.081) * [-668.579] (-669.127) (-672.148) (-668.844) -- 0:00:55
35000 -- [-675.262] (-671.467) (-675.148) (-668.356) * (-669.376) [-668.217] (-668.381) (-666.990) -- 0:00:55
Average standard deviation of split frequencies: 0.041903
35500 -- (-678.057) [-669.881] (-689.589) (-668.369) * (-669.923) (-668.614) [-668.128] (-669.670) -- 0:00:54
36000 -- [-680.707] (-670.633) (-676.612) (-673.141) * (-669.342) (-670.000) (-669.374) [-670.160] -- 0:00:53
36500 -- (-680.091) (-669.137) [-670.354] (-669.314) * (-668.152) [-667.979] (-667.636) (-670.959) -- 0:00:52
37000 -- (-680.262) (-668.626) (-688.973) [-668.227] * (-668.909) (-673.828) (-671.136) [-674.702] -- 0:01:18
37500 -- [-680.445] (-672.157) (-677.357) (-670.322) * [-668.909] (-669.846) (-668.433) (-670.991) -- 0:01:17
38000 -- (-688.230) (-671.738) (-673.512) [-670.199] * (-671.848) (-671.834) (-669.756) [-668.296] -- 0:01:15
38500 -- (-678.806) (-669.030) [-673.895] (-668.774) * (-667.972) [-667.869] (-674.109) (-667.580) -- 0:01:14
39000 -- [-675.360] (-671.326) (-675.834) (-669.356) * [-668.473] (-671.568) (-672.414) (-669.443) -- 0:01:13
39500 -- [-679.449] (-669.861) (-678.001) (-671.348) * (-666.767) (-670.108) [-667.532] (-669.593) -- 0:01:12
40000 -- (-683.840) [-670.285] (-680.862) (-668.931) * (-669.200) (-671.425) (-667.345) [-668.115] -- 0:01:12
Average standard deviation of split frequencies: 0.038833
40500 -- (-678.520) (-669.495) (-679.630) [-675.942] * (-670.331) (-669.063) [-667.775] (-668.835) -- 0:01:11
41000 -- [-674.770] (-671.130) (-674.946) (-667.333) * (-669.230) (-670.666) [-667.916] (-670.572) -- 0:01:10
41500 -- (-675.262) [-670.165] (-673.949) (-668.902) * [-673.208] (-671.482) (-668.264) (-669.499) -- 0:01:09
42000 -- (-677.390) (-669.053) [-675.742] (-668.350) * (-671.465) (-668.955) (-667.692) [-668.914] -- 0:01:08
42500 -- [-684.268] (-667.551) (-677.676) (-668.629) * (-668.067) (-666.801) [-667.363] (-669.315) -- 0:01:07
43000 -- (-680.139) (-672.397) (-682.263) [-669.281] * (-668.763) (-669.031) (-668.176) [-670.915] -- 0:01:06
43500 -- [-679.043] (-672.614) (-679.168) (-668.726) * (-669.374) (-672.513) (-671.148) [-670.514] -- 0:01:05
44000 -- (-683.282) (-668.099) (-677.623) [-669.836] * (-668.499) [-667.538] (-669.454) (-669.598) -- 0:01:05
44500 -- (-677.443) [-672.848] (-679.588) (-669.413) * (-669.239) [-667.868] (-668.734) (-672.100) -- 0:01:04
45000 -- (-674.281) (-669.276) [-675.946] (-669.008) * (-670.913) (-671.519) [-667.277] (-671.953) -- 0:01:03
Average standard deviation of split frequencies: 0.039284
45500 -- (-677.962) (-668.161) [-675.591] (-667.652) * (-671.487) (-667.804) (-668.452) [-669.297] -- 0:01:02
46000 -- (-675.918) (-668.879) (-676.203) [-668.821] * (-669.793) (-669.360) (-670.245) [-670.430] -- 0:01:02
46500 -- (-688.582) (-667.095) (-675.279) [-669.301] * (-669.895) (-671.481) [-668.322] (-674.182) -- 0:01:01
47000 -- (-677.901) (-667.391) [-687.357] (-669.615) * (-667.918) [-671.861] (-670.996) (-673.355) -- 0:01:00
47500 -- (-682.728) [-667.636] (-689.286) (-673.468) * (-667.550) [-672.353] (-672.194) (-667.634) -- 0:01:00
48000 -- (-678.410) (-669.564) (-676.667) [-668.716] * (-668.334) (-669.378) (-670.583) [-668.459] -- 0:00:59
48500 -- [-675.190] (-667.150) (-677.882) (-668.887) * (-668.013) [-667.130] (-667.174) (-672.789) -- 0:00:58
49000 -- (-675.832) [-668.491] (-678.644) (-668.270) * [-670.871] (-667.702) (-668.323) (-667.461) -- 0:00:58
49500 -- (-681.176) (-669.069) (-675.469) [-669.879] * (-668.943) (-669.787) (-670.059) [-668.594] -- 0:00:57
50000 -- (-680.759) (-668.388) (-685.365) [-670.970] * (-667.515) (-668.591) [-670.882] (-668.186) -- 0:00:57
Average standard deviation of split frequencies: 0.040048
50500 -- [-684.145] (-667.938) (-684.793) (-672.288) * (-669.955) (-668.722) [-669.934] (-668.698) -- 0:00:56
51000 -- [-678.104] (-669.713) (-674.388) (-669.257) * (-668.199) (-668.191) (-668.919) [-667.023] -- 0:00:55
51500 -- (-686.186) (-672.617) [-675.751] (-668.966) * (-669.044) (-669.030) (-668.492) [-667.576] -- 0:00:55
52000 -- [-680.471] (-671.187) (-688.521) (-668.625) * (-670.553) [-669.948] (-672.775) (-669.564) -- 0:00:54
52500 -- (-678.649) [-668.259] (-671.386) (-668.128) * [-670.401] (-669.656) (-669.914) (-673.432) -- 0:00:54
53000 -- (-676.489) (-669.883) [-670.135] (-668.213) * (-668.847) [-667.571] (-668.072) (-668.704) -- 0:00:53
53500 -- (-675.671) (-669.198) (-671.518) [-671.851] * (-667.006) (-670.149) [-666.784] (-668.014) -- 0:01:10
54000 -- (-681.936) [-669.083] (-670.396) (-670.094) * (-666.935) (-671.206) (-668.931) [-667.143] -- 0:01:10
54500 -- [-672.418] (-673.225) (-669.097) (-668.549) * [-668.469] (-674.786) (-667.880) (-667.061) -- 0:01:09
55000 -- [-674.228] (-671.658) (-669.967) (-667.866) * [-667.771] (-673.852) (-666.819) (-668.897) -- 0:01:08
Average standard deviation of split frequencies: 0.039528
55500 -- (-672.440) [-672.176] (-673.575) (-670.449) * (-668.736) [-668.623] (-666.868) (-671.349) -- 0:01:08
56000 -- (-672.728) [-667.423] (-672.116) (-669.076) * [-668.059] (-669.057) (-671.001) (-668.511) -- 0:01:07
56500 -- [-673.148] (-668.945) (-674.993) (-667.837) * (-668.416) (-670.992) (-669.087) [-669.033] -- 0:01:06
57000 -- (-679.901) (-671.893) (-670.919) [-667.747] * [-666.687] (-668.075) (-667.050) (-670.381) -- 0:01:06
57500 -- (-683.184) (-670.069) [-670.276] (-669.657) * [-667.903] (-670.700) (-672.259) (-670.449) -- 0:01:05
58000 -- (-683.242) [-668.677] (-670.064) (-670.750) * (-667.890) [-667.886] (-673.365) (-669.235) -- 0:01:04
58500 -- (-677.238) (-670.272) (-668.675) [-668.604] * [-667.539] (-668.392) (-669.019) (-672.117) -- 0:01:04
59000 -- (-678.249) (-668.262) (-667.962) [-668.008] * (-668.183) (-666.791) (-672.544) [-667.222] -- 0:01:03
59500 -- (-676.471) [-667.817] (-667.388) (-668.890) * (-676.287) (-666.863) (-677.436) [-666.608] -- 0:01:03
60000 -- (-676.498) (-669.859) (-668.128) [-668.897] * [-669.584] (-667.187) (-668.947) (-669.472) -- 0:01:02
Average standard deviation of split frequencies: 0.036380
60500 -- (-690.429) (-669.516) [-668.337] (-669.118) * (-668.830) [-672.053] (-667.892) (-668.826) -- 0:01:02
61000 -- [-680.163] (-669.816) (-667.141) (-668.956) * (-670.159) (-667.794) (-668.473) [-668.944] -- 0:01:01
61500 -- (-683.094) (-670.767) (-667.880) [-667.723] * [-668.273] (-669.258) (-669.141) (-668.619) -- 0:01:01
62000 -- [-680.024] (-668.645) (-667.406) (-670.855) * (-673.271) (-668.942) [-669.760] (-672.994) -- 0:01:00
62500 -- [-679.224] (-670.322) (-669.638) (-671.219) * [-667.715] (-667.862) (-673.770) (-671.914) -- 0:01:00
63000 -- [-674.302] (-670.498) (-667.597) (-671.387) * (-670.562) (-670.080) (-668.648) [-668.654] -- 0:00:59
63500 -- [-674.241] (-670.035) (-672.017) (-669.562) * (-670.858) (-668.948) (-671.771) [-669.029] -- 0:00:58
64000 -- (-675.780) (-668.294) (-667.778) [-667.296] * [-668.204] (-671.020) (-670.090) (-667.679) -- 0:00:58
64500 -- [-683.809] (-667.382) (-670.071) (-668.969) * (-668.286) (-671.313) (-667.467) [-666.879] -- 0:00:58
65000 -- (-680.573) [-668.581] (-667.693) (-671.332) * (-668.386) (-668.560) [-669.447] (-667.050) -- 0:00:57
Average standard deviation of split frequencies: 0.031492
65500 -- (-678.082) (-669.297) [-668.062] (-669.693) * [-669.492] (-666.825) (-672.298) (-668.342) -- 0:00:57
66000 -- (-680.383) [-669.930] (-668.089) (-672.953) * [-667.552] (-668.138) (-678.768) (-668.272) -- 0:00:56
66500 -- (-672.582) (-669.234) (-667.375) [-670.766] * (-668.183) (-671.798) (-670.262) [-668.985] -- 0:00:56
67000 -- (-669.279) (-669.755) [-667.693] (-669.250) * (-670.312) (-668.491) [-667.818] (-669.523) -- 0:00:55
67500 -- [-668.835] (-666.849) (-669.051) (-671.559) * (-667.456) (-673.645) [-669.674] (-669.682) -- 0:00:55
68000 -- (-668.203) (-667.010) (-667.632) [-668.845] * (-671.136) [-669.189] (-678.201) (-670.026) -- 0:00:54
68500 -- [-667.693] (-669.049) (-668.548) (-669.249) * (-669.076) (-669.779) [-668.972] (-667.018) -- 0:00:54
69000 -- (-672.574) (-667.957) [-671.583] (-668.172) * (-668.288) (-673.172) (-667.598) [-669.100] -- 0:00:53
69500 -- (-670.252) [-669.015] (-669.931) (-667.069) * (-668.831) [-669.737] (-669.983) (-669.314) -- 0:00:53
70000 -- (-667.354) (-670.771) [-669.273] (-667.937) * (-669.513) (-670.558) (-666.713) [-669.028] -- 0:00:53
Average standard deviation of split frequencies: 0.031838
70500 -- [-667.819] (-666.859) (-670.763) (-669.052) * (-670.225) [-673.650] (-668.385) (-667.311) -- 0:01:05
71000 -- (-668.124) (-668.241) (-675.084) [-668.681] * [-669.659] (-668.667) (-668.654) (-667.755) -- 0:01:05
71500 -- (-671.789) (-668.298) [-669.602] (-668.568) * (-670.575) (-668.953) [-673.420] (-668.466) -- 0:01:04
72000 -- (-671.030) (-669.205) [-671.452] (-667.369) * (-668.305) [-669.945] (-668.286) (-667.011) -- 0:01:04
72500 -- [-667.325] (-669.246) (-667.327) (-669.425) * (-667.652) [-668.337] (-668.055) (-669.576) -- 0:01:03
73000 -- [-670.633] (-667.308) (-668.244) (-670.941) * (-670.733) (-667.342) [-666.785] (-669.478) -- 0:01:03
73500 -- (-669.472) [-667.086] (-668.561) (-667.986) * [-670.460] (-668.833) (-666.749) (-668.965) -- 0:01:03
74000 -- (-669.539) (-667.331) (-667.357) [-668.954] * (-667.539) (-668.126) (-667.792) [-671.962] -- 0:01:02
74500 -- (-670.759) (-666.939) (-666.889) [-667.842] * [-671.334] (-668.618) (-669.330) (-667.937) -- 0:01:02
75000 -- (-671.425) [-667.240] (-667.873) (-669.950) * [-670.145] (-668.230) (-668.357) (-671.703) -- 0:01:01
Average standard deviation of split frequencies: 0.030393
75500 -- (-669.221) (-668.976) (-667.233) [-671.245] * [-667.975] (-669.053) (-669.577) (-668.168) -- 0:01:01
76000 -- [-670.634] (-671.962) (-669.945) (-670.755) * (-668.549) (-666.825) (-667.821) [-667.808] -- 0:01:00
76500 -- (-671.921) (-671.977) [-671.175] (-670.925) * [-669.352] (-668.416) (-671.348) (-667.880) -- 0:01:00
77000 -- [-670.973] (-669.257) (-669.674) (-668.728) * (-672.557) [-668.214] (-674.034) (-667.100) -- 0:00:59
77500 -- (-668.144) (-669.097) (-673.311) [-671.419] * (-669.928) (-667.920) [-668.936] (-669.235) -- 0:00:59
78000 -- (-666.899) (-668.627) [-668.235] (-672.757) * (-670.155) (-668.663) (-670.009) [-669.974] -- 0:00:59
78500 -- (-667.435) (-668.457) [-667.406] (-669.204) * [-672.220] (-668.330) (-670.987) (-670.309) -- 0:00:58
79000 -- (-668.513) (-669.007) (-670.662) [-668.156] * (-671.389) [-667.751] (-670.856) (-671.118) -- 0:00:58
79500 -- [-669.016] (-668.390) (-668.448) (-669.277) * [-668.631] (-669.350) (-671.367) (-668.156) -- 0:00:57
80000 -- (-671.010) (-672.099) (-668.593) [-671.838] * (-668.384) (-669.769) (-667.610) [-667.960] -- 0:00:57
Average standard deviation of split frequencies: 0.026144
80500 -- (-671.399) (-669.689) (-668.373) [-672.785] * [-667.543] (-668.595) (-668.901) (-671.714) -- 0:00:57
81000 -- [-669.422] (-667.493) (-668.453) (-671.812) * [-667.421] (-669.345) (-670.301) (-668.770) -- 0:00:56
81500 -- [-667.330] (-670.472) (-668.638) (-670.406) * [-667.308] (-671.270) (-669.357) (-670.433) -- 0:00:56
82000 -- (-674.258) [-667.730] (-671.106) (-671.740) * [-670.517] (-669.381) (-670.066) (-673.200) -- 0:00:55
82500 -- (-675.688) (-671.460) [-668.841] (-670.311) * (-669.356) (-670.406) [-668.284] (-667.522) -- 0:00:55
83000 -- (-675.052) (-669.784) [-668.735] (-676.083) * (-669.092) [-669.041] (-670.439) (-667.590) -- 0:00:55
83500 -- (-668.428) (-669.140) [-670.485] (-670.308) * [-667.351] (-670.887) (-667.392) (-668.547) -- 0:00:54
84000 -- (-670.236) (-667.179) (-670.457) [-669.205] * [-669.520] (-670.426) (-670.531) (-668.421) -- 0:00:54
84500 -- (-667.989) (-670.390) (-669.678) [-666.793] * [-668.062] (-670.294) (-670.523) (-667.443) -- 0:00:54
85000 -- (-668.455) (-667.466) (-669.022) [-666.740] * (-669.294) [-669.698] (-669.549) (-667.827) -- 0:00:53
Average standard deviation of split frequencies: 0.023570
85500 -- (-670.309) [-667.431] (-669.286) (-667.323) * (-668.574) (-668.133) [-668.054] (-668.970) -- 0:00:53
86000 -- (-669.074) [-669.735] (-669.167) (-671.410) * (-669.240) (-667.440) (-668.296) [-670.383] -- 0:00:53
86500 -- (-667.314) [-668.484] (-671.609) (-668.982) * (-669.106) [-667.924] (-667.482) (-670.292) -- 0:00:52
87000 -- (-669.653) (-671.147) [-669.707] (-666.928) * (-675.104) (-670.091) (-669.539) [-671.046] -- 0:01:02
87500 -- [-670.668] (-670.030) (-673.082) (-667.495) * (-671.845) [-671.143] (-673.748) (-668.437) -- 0:01:02
88000 -- (-670.521) [-668.817] (-667.152) (-668.828) * (-673.933) (-669.254) (-669.721) [-668.010] -- 0:01:02
88500 -- (-667.298) (-671.682) (-669.472) [-667.993] * (-671.038) (-668.563) (-668.278) [-668.043] -- 0:01:01
89000 -- (-668.198) (-673.356) [-667.639] (-666.693) * (-669.703) (-667.379) (-668.264) [-668.256] -- 0:01:01
89500 -- [-667.725] (-670.208) (-670.637) (-667.592) * (-670.098) (-667.957) [-670.477] (-667.109) -- 0:01:01
90000 -- (-669.358) [-667.425] (-674.270) (-666.719) * [-667.564] (-670.763) (-669.278) (-670.763) -- 0:01:00
Average standard deviation of split frequencies: 0.020277
90500 -- (-669.515) (-667.688) (-669.916) [-667.086] * (-666.680) (-668.688) (-668.955) [-669.929] -- 0:01:00
91000 -- [-667.630] (-668.996) (-668.722) (-670.124) * (-668.378) (-669.230) (-671.521) [-667.772] -- 0:00:59
91500 -- [-669.322] (-668.868) (-672.331) (-667.750) * (-670.269) [-667.725] (-669.738) (-668.782) -- 0:00:59
92000 -- (-673.861) (-672.663) [-671.063] (-668.350) * (-671.292) (-669.079) [-667.408] (-668.398) -- 0:00:59
92500 -- [-674.102] (-669.993) (-670.699) (-667.156) * (-667.444) [-671.283] (-668.657) (-667.633) -- 0:00:58
93000 -- (-679.668) (-667.794) [-671.419] (-667.642) * (-667.392) (-669.659) (-669.551) [-668.763] -- 0:00:58
93500 -- (-678.842) (-667.800) [-669.806] (-668.658) * (-668.596) [-667.945] (-669.097) (-669.384) -- 0:00:58
94000 -- (-673.729) (-669.125) (-668.574) [-666.550] * (-669.902) (-667.614) [-669.924] (-666.690) -- 0:00:57
94500 -- (-668.061) (-670.796) (-668.535) [-668.744] * (-666.917) (-668.230) (-669.439) [-667.451] -- 0:00:57
95000 -- (-667.546) [-667.817] (-667.894) (-669.127) * (-669.826) [-669.109] (-667.041) (-669.346) -- 0:00:57
Average standard deviation of split frequencies: 0.022214
95500 -- (-667.790) [-667.776] (-668.961) (-672.498) * [-666.921] (-668.710) (-668.187) (-668.820) -- 0:00:56
96000 -- (-668.319) (-669.980) [-667.437] (-667.185) * [-667.055] (-669.320) (-667.514) (-667.143) -- 0:00:56
96500 -- (-671.001) (-671.839) [-667.949] (-667.589) * [-667.696] (-673.279) (-667.050) (-669.023) -- 0:00:56
97000 -- [-668.749] (-670.028) (-667.797) (-670.481) * [-668.364] (-672.113) (-670.635) (-669.887) -- 0:00:55
97500 -- (-668.291) (-669.754) (-669.757) [-667.052] * (-669.609) [-671.388] (-671.548) (-669.648) -- 0:00:55
98000 -- (-669.897) [-669.288] (-667.943) (-667.547) * (-670.104) (-672.478) (-670.658) [-673.141] -- 0:00:55
98500 -- [-668.971] (-670.436) (-667.885) (-668.748) * [-668.638] (-673.140) (-671.787) (-668.112) -- 0:00:54
99000 -- (-669.272) (-667.688) [-670.086] (-671.115) * (-669.420) (-668.958) (-669.695) [-668.992] -- 0:00:54
99500 -- (-670.597) (-670.209) (-671.138) [-668.134] * [-669.655] (-671.384) (-672.499) (-669.859) -- 0:00:54
100000 -- (-667.212) [-667.133] (-667.652) (-668.980) * (-668.196) (-668.826) (-670.417) [-670.626] -- 0:00:54
Average standard deviation of split frequencies: 0.020292
100500 -- (-672.233) [-667.283] (-670.327) (-668.085) * [-668.578] (-671.230) (-667.497) (-671.811) -- 0:00:53
101000 -- (-667.559) [-667.629] (-667.746) (-670.286) * (-667.971) (-669.316) (-668.360) [-667.228] -- 0:00:53
101500 -- (-668.031) [-673.127] (-672.156) (-668.377) * (-668.048) [-669.134] (-667.532) (-669.311) -- 0:00:53
102000 -- (-669.521) (-679.610) (-671.499) [-668.648] * (-667.690) (-670.738) (-667.244) [-666.755] -- 0:00:52
102500 -- (-669.852) (-678.066) [-669.466] (-676.119) * (-669.354) [-670.448] (-671.063) (-667.380) -- 0:00:52
103000 -- (-670.832) (-675.649) (-672.216) [-670.053] * (-668.477) [-668.025] (-668.938) (-667.698) -- 0:00:52
103500 -- (-669.886) [-669.552] (-669.773) (-671.884) * [-669.123] (-668.008) (-672.950) (-668.251) -- 0:00:51
104000 -- [-668.861] (-668.712) (-669.892) (-668.187) * (-668.062) (-670.932) (-671.336) [-668.297] -- 0:01:00
104500 -- (-669.561) [-667.124] (-668.783) (-668.759) * (-666.844) (-668.238) (-672.991) [-669.364] -- 0:00:59
105000 -- (-670.145) (-667.918) (-669.374) [-669.394] * [-669.951] (-671.815) (-668.239) (-669.866) -- 0:00:59
Average standard deviation of split frequencies: 0.020012
105500 -- (-671.684) [-668.698] (-671.818) (-667.437) * (-670.334) (-668.613) [-669.317] (-669.131) -- 0:00:59
106000 -- (-668.628) (-668.399) (-672.880) [-667.695] * (-670.741) (-672.241) (-668.834) [-669.848] -- 0:00:59
106500 -- (-668.892) [-673.221] (-671.937) (-667.954) * [-670.245] (-671.214) (-670.359) (-668.532) -- 0:00:58
107000 -- (-668.018) [-670.704] (-667.809) (-667.239) * [-670.679] (-673.676) (-667.766) (-669.209) -- 0:00:58
107500 -- (-668.395) [-668.246] (-667.624) (-667.228) * (-669.941) (-671.728) [-667.110] (-668.522) -- 0:00:58
108000 -- [-667.466] (-667.634) (-666.887) (-668.330) * (-666.815) [-669.501] (-670.210) (-671.186) -- 0:00:57
108500 -- (-671.091) [-668.619] (-668.030) (-671.815) * (-668.486) (-667.739) [-668.770] (-669.203) -- 0:00:57
109000 -- (-668.836) (-674.988) (-670.495) [-668.597] * (-667.720) (-667.754) (-668.350) [-671.041] -- 0:00:57
109500 -- [-669.218] (-671.335) (-670.076) (-670.945) * [-668.047] (-670.379) (-673.775) (-671.065) -- 0:00:56
110000 -- (-668.061) (-668.013) (-670.488) [-671.592] * (-669.801) [-670.982] (-669.261) (-669.629) -- 0:00:56
Average standard deviation of split frequencies: 0.021062
110500 -- (-667.540) (-670.883) (-667.108) [-670.884] * (-669.837) [-668.595] (-668.039) (-667.499) -- 0:00:56
111000 -- (-674.458) (-669.084) (-667.177) [-668.945] * [-667.602] (-672.400) (-670.189) (-668.118) -- 0:00:56
111500 -- (-676.579) [-668.886] (-668.456) (-667.936) * (-666.725) (-668.450) (-669.541) [-668.482] -- 0:00:55
112000 -- [-667.989] (-670.060) (-672.369) (-669.131) * [-668.061] (-668.540) (-670.757) (-669.568) -- 0:00:55
112500 -- [-669.846] (-667.976) (-669.924) (-667.565) * (-668.830) (-668.661) (-670.503) [-670.379] -- 0:00:55
113000 -- (-668.361) [-671.401] (-670.681) (-668.215) * [-670.193] (-670.135) (-667.621) (-668.981) -- 0:00:54
113500 -- (-673.002) [-667.694] (-667.544) (-669.764) * (-670.389) (-668.027) (-667.807) [-669.071] -- 0:00:54
114000 -- (-667.950) (-670.302) [-669.386] (-667.226) * (-668.864) (-669.095) [-670.247] (-668.652) -- 0:00:54
114500 -- (-670.203) (-673.458) (-669.549) [-667.369] * (-669.551) (-670.150) (-667.681) [-674.652] -- 0:00:54
115000 -- (-670.133) [-670.498] (-670.974) (-667.679) * (-668.911) (-667.437) (-668.888) [-667.907] -- 0:00:53
Average standard deviation of split frequencies: 0.020093
115500 -- (-672.692) [-671.596] (-671.180) (-668.980) * [-667.422] (-666.566) (-668.174) (-670.142) -- 0:00:53
116000 -- (-667.248) (-669.758) [-668.903] (-669.259) * (-670.420) (-669.284) [-668.355] (-668.331) -- 0:00:53
116500 -- (-667.141) (-669.024) (-669.742) [-669.536] * (-667.850) (-671.160) (-668.882) [-669.156] -- 0:00:53
117000 -- (-667.539) (-668.728) [-670.263] (-669.191) * (-670.164) (-675.415) [-668.105] (-669.669) -- 0:00:52
117500 -- (-671.433) (-673.375) (-669.361) [-667.318] * (-668.190) (-671.299) [-668.250] (-672.509) -- 0:00:52
118000 -- (-669.852) (-669.009) [-669.100] (-667.357) * [-672.469] (-668.288) (-667.077) (-669.848) -- 0:00:52
118500 -- (-667.261) [-668.480] (-668.611) (-667.861) * (-669.190) (-668.008) (-668.177) [-667.416] -- 0:00:52
119000 -- [-667.769] (-667.494) (-668.571) (-668.109) * (-667.540) [-672.055] (-667.919) (-667.925) -- 0:00:51
119500 -- (-667.851) (-667.229) [-671.778] (-669.549) * (-671.987) (-667.333) (-669.931) [-667.710] -- 0:00:51
120000 -- (-671.226) (-667.988) [-670.819] (-668.720) * [-670.365] (-669.354) (-667.796) (-669.481) -- 0:00:51
Average standard deviation of split frequencies: 0.018155
120500 -- (-668.279) [-667.458] (-669.054) (-668.891) * (-671.480) (-672.370) (-672.158) [-668.850] -- 0:00:51
121000 -- [-671.029] (-671.014) (-669.109) (-671.890) * [-667.033] (-671.304) (-671.859) (-674.249) -- 0:00:58
121500 -- [-667.557] (-672.821) (-669.229) (-670.122) * (-667.201) [-668.200] (-668.105) (-670.684) -- 0:00:57
122000 -- [-667.935] (-670.704) (-668.016) (-667.227) * (-666.764) (-669.595) (-668.758) [-673.080] -- 0:00:57
122500 -- (-667.825) (-670.497) (-669.290) [-668.605] * (-667.313) (-670.688) (-668.754) [-671.911] -- 0:00:57
123000 -- (-670.320) [-671.098] (-669.440) (-672.569) * (-669.249) [-670.470] (-668.818) (-670.619) -- 0:00:57
123500 -- (-671.206) (-672.252) (-667.513) [-668.325] * (-670.396) (-667.837) (-670.718) [-668.608] -- 0:00:56
124000 -- (-669.679) (-668.450) (-667.199) [-668.271] * [-668.605] (-668.396) (-670.156) (-668.286) -- 0:00:56
124500 -- [-669.737] (-667.710) (-668.302) (-670.317) * (-670.032) (-670.532) (-670.229) [-672.277] -- 0:00:56
125000 -- (-667.936) [-668.948] (-668.488) (-670.550) * [-672.371] (-669.268) (-667.692) (-670.517) -- 0:00:56
Average standard deviation of split frequencies: 0.015185
125500 -- (-669.349) (-668.694) (-670.069) [-675.689] * (-679.008) (-668.827) [-668.453] (-667.815) -- 0:00:55
126000 -- (-667.974) [-669.128] (-667.489) (-671.012) * (-673.285) [-670.120] (-670.222) (-670.479) -- 0:00:55
126500 -- (-667.732) [-668.105] (-671.968) (-674.868) * (-671.597) (-676.297) (-670.050) [-671.166] -- 0:00:55
127000 -- [-670.389] (-669.117) (-671.155) (-669.083) * (-668.337) (-669.226) (-669.383) [-670.143] -- 0:00:54
127500 -- (-673.932) (-668.661) (-672.181) [-668.820] * (-669.135) (-669.292) (-673.098) [-668.957] -- 0:00:54
128000 -- (-667.793) [-668.982] (-669.853) (-668.946) * [-671.751] (-668.922) (-669.135) (-670.533) -- 0:00:54
128500 -- (-666.974) (-672.237) (-668.314) [-666.982] * [-669.748] (-669.574) (-668.854) (-672.074) -- 0:00:54
129000 -- (-668.352) (-669.914) [-667.200] (-667.972) * [-669.685] (-667.772) (-666.724) (-671.776) -- 0:00:54
129500 -- (-668.115) (-673.222) (-668.497) [-669.257] * (-669.351) (-669.526) (-668.959) [-671.379] -- 0:00:53
130000 -- (-669.057) (-668.265) (-670.025) [-671.168] * (-671.074) (-669.704) (-669.075) [-670.388] -- 0:00:53
Average standard deviation of split frequencies: 0.015633
130500 -- (-671.237) (-671.386) [-668.792] (-671.755) * (-670.922) (-672.925) (-670.513) [-668.035] -- 0:00:53
131000 -- [-667.671] (-668.948) (-667.347) (-671.887) * (-669.190) (-675.171) (-671.873) [-666.989] -- 0:00:53
131500 -- [-672.310] (-669.744) (-667.258) (-671.329) * (-670.838) [-670.501] (-670.245) (-666.910) -- 0:00:52
132000 -- (-668.345) (-669.481) [-667.652] (-668.542) * (-670.046) (-668.011) (-668.751) [-668.496] -- 0:00:52
132500 -- (-670.472) (-669.522) [-668.816] (-673.956) * (-668.005) (-670.233) [-668.543] (-669.544) -- 0:00:52
133000 -- (-667.660) (-669.761) (-667.294) [-667.715] * (-670.289) (-668.580) (-667.348) [-668.968] -- 0:00:52
133500 -- (-670.332) [-668.290] (-667.178) (-672.618) * (-669.672) [-667.363] (-669.777) (-668.134) -- 0:00:51
134000 -- (-670.023) [-667.650] (-670.496) (-675.652) * [-667.278] (-667.392) (-670.218) (-668.931) -- 0:00:51
134500 -- (-669.200) (-673.026) [-670.645] (-670.693) * (-668.787) (-667.806) [-668.933] (-666.754) -- 0:00:51
135000 -- (-668.873) [-669.724] (-667.458) (-670.787) * (-669.995) [-667.687] (-668.784) (-668.493) -- 0:00:51
Average standard deviation of split frequencies: 0.016312
135500 -- [-667.394] (-669.602) (-667.819) (-668.426) * (-671.640) [-668.604] (-667.472) (-668.352) -- 0:00:51
136000 -- [-668.213] (-668.869) (-668.230) (-671.130) * (-668.921) (-671.260) (-667.209) [-668.220] -- 0:00:50
136500 -- (-671.576) [-669.380] (-671.172) (-668.911) * (-669.134) [-672.285] (-667.771) (-667.787) -- 0:00:50
137000 -- (-669.770) (-669.375) [-670.797] (-673.100) * (-667.511) (-669.066) [-673.815] (-673.814) -- 0:00:50
137500 -- (-669.859) (-675.036) [-668.327] (-668.525) * (-666.872) [-669.684] (-670.016) (-669.255) -- 0:00:56
138000 -- (-668.207) (-669.859) (-668.642) [-669.520] * [-666.901] (-673.624) (-668.518) (-668.666) -- 0:00:56
138500 -- (-671.241) [-667.290] (-669.715) (-668.779) * (-670.958) [-668.382] (-668.379) (-668.756) -- 0:00:55
139000 -- (-673.263) [-666.605] (-667.838) (-669.040) * (-667.115) [-670.028] (-669.799) (-670.424) -- 0:00:55
139500 -- [-670.541] (-667.991) (-668.536) (-668.750) * (-666.864) [-669.122] (-668.773) (-668.849) -- 0:00:55
140000 -- (-668.379) [-675.981] (-669.917) (-667.865) * (-668.226) (-671.796) [-667.973] (-669.638) -- 0:00:55
Average standard deviation of split frequencies: 0.015376
140500 -- (-668.658) [-667.895] (-668.427) (-668.409) * [-668.480] (-671.148) (-672.773) (-668.444) -- 0:00:55
141000 -- (-669.253) (-670.464) [-668.956] (-667.599) * (-668.767) (-668.238) [-668.213] (-668.786) -- 0:00:54
141500 -- (-668.971) (-670.603) [-668.911] (-667.853) * (-668.810) [-669.017] (-669.350) (-670.141) -- 0:00:54
142000 -- [-667.317] (-670.594) (-668.094) (-668.140) * [-668.282] (-669.464) (-670.470) (-669.805) -- 0:00:54
142500 -- (-670.044) [-669.547] (-667.972) (-669.723) * [-668.537] (-668.669) (-669.921) (-667.892) -- 0:00:54
143000 -- (-671.296) (-668.290) [-667.319] (-674.480) * (-671.716) (-668.086) (-670.745) [-669.223] -- 0:00:53
143500 -- (-671.589) (-668.730) [-667.539] (-670.005) * (-668.010) [-668.820] (-669.863) (-671.314) -- 0:00:53
144000 -- (-670.074) (-669.394) (-668.080) [-667.082] * (-669.053) [-668.557] (-668.417) (-670.108) -- 0:00:53
144500 -- (-670.646) [-667.410] (-671.105) (-668.450) * (-671.887) (-670.716) [-669.361] (-670.079) -- 0:00:53
145000 -- (-667.545) (-668.306) (-673.257) [-667.484] * [-667.603] (-668.673) (-672.665) (-667.106) -- 0:00:53
Average standard deviation of split frequencies: 0.014368
145500 -- (-670.947) (-668.848) (-671.537) [-669.285] * (-669.718) (-672.028) [-668.184] (-668.679) -- 0:00:52
146000 -- [-671.235] (-670.694) (-671.048) (-669.405) * (-668.861) (-670.014) (-669.344) [-667.675] -- 0:00:52
146500 -- (-672.984) (-672.744) (-672.140) [-668.072] * (-669.576) [-669.193] (-669.707) (-668.683) -- 0:00:52
147000 -- (-675.236) (-668.136) (-671.499) [-669.449] * (-668.507) (-669.428) (-667.981) [-669.008] -- 0:00:52
147500 -- (-667.245) [-669.305] (-670.633) (-668.716) * (-668.501) (-669.733) [-669.529] (-668.873) -- 0:00:52
148000 -- (-669.285) (-666.836) [-672.389] (-667.509) * (-667.745) (-669.208) [-668.214] (-668.777) -- 0:00:51
148500 -- (-668.600) (-669.405) (-668.792) [-667.346] * (-667.550) (-670.276) [-668.128] (-673.364) -- 0:00:51
149000 -- (-671.259) [-669.692] (-668.834) (-669.930) * (-670.001) (-670.480) [-668.763] (-666.956) -- 0:00:51
149500 -- [-669.545] (-668.602) (-668.991) (-671.366) * (-671.772) (-668.140) (-669.072) [-669.505] -- 0:00:51
150000 -- [-669.072] (-669.743) (-673.147) (-671.041) * [-666.844] (-670.733) (-670.749) (-669.183) -- 0:00:51
Average standard deviation of split frequencies: 0.012672
150500 -- [-669.042] (-669.760) (-670.211) (-667.645) * (-673.163) (-672.813) (-668.029) [-668.713] -- 0:00:50
151000 -- [-667.674] (-670.562) (-669.273) (-670.112) * [-669.326] (-670.354) (-668.562) (-669.592) -- 0:00:50
151500 -- (-669.269) (-670.660) [-669.133] (-669.402) * [-669.077] (-668.443) (-668.108) (-668.615) -- 0:00:50
152000 -- (-667.873) [-668.079] (-669.786) (-670.430) * (-669.095) (-668.895) [-670.588] (-668.312) -- 0:00:50
152500 -- [-667.653] (-667.414) (-669.715) (-669.317) * [-669.371] (-668.539) (-669.537) (-669.179) -- 0:00:50
153000 -- (-667.856) (-668.755) [-667.863] (-668.755) * [-670.469] (-667.922) (-669.238) (-669.361) -- 0:00:49
153500 -- (-668.234) [-666.536] (-668.075) (-669.480) * (-668.693) (-667.598) (-668.454) [-668.744] -- 0:00:49
154000 -- (-668.477) (-668.347) [-667.346] (-670.016) * (-670.975) [-667.201] (-671.581) (-668.245) -- 0:00:49
154500 -- (-669.909) (-668.303) [-670.595] (-669.105) * (-668.504) (-666.740) [-673.578] (-672.674) -- 0:00:54
155000 -- (-668.376) (-668.133) (-670.541) [-668.126] * (-671.681) (-673.227) [-668.785] (-673.263) -- 0:00:54
Average standard deviation of split frequencies: 0.013095
155500 -- (-667.955) [-668.282] (-671.077) (-667.493) * (-674.413) [-667.574] (-669.436) (-671.817) -- 0:00:54
156000 -- (-670.580) [-667.201] (-668.385) (-667.356) * (-670.336) (-667.572) [-667.014] (-676.306) -- 0:00:54
156500 -- (-670.700) [-671.659] (-674.720) (-668.916) * (-669.895) (-670.073) (-667.748) [-668.745] -- 0:00:53
157000 -- (-670.049) [-667.946] (-671.210) (-667.883) * (-669.991) (-668.013) (-666.998) [-669.717] -- 0:00:53
157500 -- [-670.548] (-669.265) (-673.355) (-667.541) * [-670.052] (-668.665) (-668.143) (-670.897) -- 0:00:53
158000 -- (-668.395) (-668.257) (-667.870) [-668.929] * (-667.399) (-671.083) (-667.187) [-668.812] -- 0:00:53
158500 -- (-668.797) (-667.598) [-669.115] (-668.820) * (-670.984) [-670.637] (-668.647) (-668.074) -- 0:00:53
159000 -- (-669.629) [-668.563] (-667.550) (-667.482) * (-667.398) (-670.768) (-667.113) [-670.948] -- 0:00:52
159500 -- (-667.510) [-668.880] (-671.807) (-667.943) * (-667.988) (-673.974) [-669.589] (-670.110) -- 0:00:52
160000 -- (-667.192) [-667.035] (-672.283) (-667.074) * (-671.408) (-668.618) (-669.316) [-668.997] -- 0:00:52
Average standard deviation of split frequencies: 0.013744
160500 -- [-668.237] (-666.964) (-670.714) (-669.168) * (-668.072) (-669.946) (-666.945) [-668.276] -- 0:00:52
161000 -- (-668.616) (-667.224) (-667.251) [-670.425] * (-668.346) (-670.577) (-671.293) [-667.400] -- 0:00:52
161500 -- (-668.040) (-667.711) (-669.090) [-668.606] * (-668.065) (-670.227) (-670.297) [-670.799] -- 0:00:51
162000 -- (-668.794) (-667.759) (-668.727) [-668.204] * (-668.477) (-670.054) (-673.403) [-669.906] -- 0:00:51
162500 -- (-668.206) (-668.029) [-667.680] (-678.535) * (-667.046) (-667.083) [-669.179] (-673.160) -- 0:00:51
163000 -- [-668.154] (-667.721) (-673.226) (-669.047) * (-668.052) [-668.875] (-670.991) (-674.848) -- 0:00:51
163500 -- [-669.037] (-669.576) (-668.498) (-670.697) * (-668.844) (-668.911) (-670.798) [-672.957] -- 0:00:51
164000 -- [-668.032] (-667.873) (-668.592) (-670.497) * (-667.293) (-672.727) (-667.778) [-669.884] -- 0:00:50
164500 -- [-667.746] (-666.801) (-674.261) (-667.336) * (-670.979) (-670.743) (-670.851) [-667.974] -- 0:00:50
165000 -- (-670.544) [-667.290] (-668.418) (-676.866) * [-669.224] (-670.539) (-668.241) (-668.985) -- 0:00:50
Average standard deviation of split frequencies: 0.012921
165500 -- [-668.022] (-668.373) (-670.783) (-672.090) * (-668.109) (-667.605) (-666.982) [-669.904] -- 0:00:50
166000 -- [-668.575] (-669.713) (-666.986) (-672.066) * (-667.050) (-671.115) (-669.190) [-669.569] -- 0:00:50
166500 -- (-669.583) (-669.283) [-666.753] (-668.766) * [-668.433] (-669.033) (-669.077) (-668.239) -- 0:00:50
167000 -- (-668.406) [-667.970] (-667.148) (-669.633) * (-668.713) (-669.386) (-670.413) [-667.365] -- 0:00:49
167500 -- (-668.240) (-671.900) (-668.422) [-669.538] * [-667.879] (-671.762) (-668.825) (-669.451) -- 0:00:49
168000 -- (-667.598) (-672.049) (-667.979) [-668.653] * (-669.756) [-669.408] (-670.445) (-670.205) -- 0:00:49
168500 -- (-667.267) (-671.134) (-669.587) [-668.606] * (-667.023) (-668.905) [-669.291] (-670.622) -- 0:00:49
169000 -- (-667.397) (-672.138) [-668.311] (-670.436) * (-670.221) [-670.288] (-667.686) (-673.477) -- 0:00:49
169500 -- (-671.822) (-668.452) [-667.865] (-668.435) * (-667.768) (-669.697) [-671.766] (-669.752) -- 0:00:48
170000 -- (-671.055) [-668.941] (-669.014) (-669.993) * (-669.040) (-672.847) (-670.354) [-668.088] -- 0:00:48
Average standard deviation of split frequencies: 0.014731
170500 -- (-668.228) (-669.547) (-667.141) [-667.232] * (-669.734) [-668.639] (-667.677) (-667.330) -- 0:00:48
171000 -- (-667.624) (-669.975) [-668.214] (-666.987) * (-671.442) (-670.949) [-668.227] (-668.085) -- 0:00:53
171500 -- (-669.146) (-669.659) (-671.504) [-668.568] * [-669.173] (-670.421) (-667.592) (-667.644) -- 0:00:53
172000 -- (-668.630) (-668.625) (-669.556) [-669.018] * (-671.920) (-667.709) [-668.410] (-673.490) -- 0:00:52
172500 -- (-668.954) (-667.733) (-668.617) [-670.639] * (-672.056) [-667.031] (-666.718) (-669.823) -- 0:00:52
173000 -- (-668.951) [-667.755] (-667.364) (-667.485) * (-668.484) (-669.271) (-671.598) [-668.819] -- 0:00:52
173500 -- [-670.878] (-668.987) (-669.645) (-667.851) * (-669.759) (-667.636) (-673.298) [-668.423] -- 0:00:52
174000 -- [-668.733] (-669.872) (-667.958) (-669.633) * [-669.872] (-670.209) (-672.250) (-668.236) -- 0:00:52
174500 -- (-667.941) (-668.409) [-667.633] (-668.797) * (-667.285) (-668.535) (-670.467) [-667.203] -- 0:00:52
175000 -- (-667.469) (-667.014) [-668.415] (-670.704) * (-672.272) (-667.619) (-667.570) [-668.243] -- 0:00:51
Average standard deviation of split frequencies: 0.016071
175500 -- (-669.806) [-666.683] (-671.078) (-670.976) * (-671.348) (-668.760) [-668.444] (-668.058) -- 0:00:51
176000 -- (-667.427) [-669.386] (-669.248) (-669.454) * (-667.966) (-668.168) (-667.260) [-668.132] -- 0:00:51
176500 -- (-668.218) [-670.947] (-667.620) (-670.208) * (-670.022) (-669.341) [-667.932] (-669.489) -- 0:00:51
177000 -- (-670.069) (-668.795) (-666.584) [-668.212] * (-671.566) [-671.721] (-667.403) (-667.586) -- 0:00:51
177500 -- [-667.539] (-670.048) (-667.614) (-667.568) * (-669.820) [-667.649] (-668.692) (-669.089) -- 0:00:50
178000 -- (-667.520) (-668.681) (-667.571) [-668.189] * (-666.766) (-668.472) (-667.625) [-669.096] -- 0:00:50
178500 -- [-670.834] (-667.569) (-670.991) (-667.193) * (-667.963) (-669.575) [-670.165] (-669.225) -- 0:00:50
179000 -- (-668.011) [-668.565] (-672.549) (-667.209) * (-668.217) [-668.757] (-667.857) (-670.437) -- 0:00:50
179500 -- (-667.489) (-668.487) [-667.750] (-666.864) * [-669.834] (-670.096) (-667.426) (-669.279) -- 0:00:50
180000 -- (-667.113) (-674.085) (-667.833) [-667.853] * (-669.564) [-667.101] (-672.044) (-668.918) -- 0:00:50
Average standard deviation of split frequencies: 0.015930
180500 -- (-667.846) [-668.836] (-670.654) (-668.734) * (-668.466) [-667.015] (-668.850) (-671.666) -- 0:00:49
181000 -- (-669.171) (-668.640) (-671.838) [-668.070] * (-667.602) [-668.312] (-670.885) (-667.821) -- 0:00:49
181500 -- [-668.182] (-669.520) (-672.439) (-667.798) * [-668.924] (-668.197) (-670.131) (-667.959) -- 0:00:49
182000 -- [-668.181] (-667.390) (-668.523) (-667.975) * (-667.880) [-667.498] (-669.043) (-669.717) -- 0:00:49
182500 -- (-670.604) (-669.011) (-667.308) [-668.888] * [-667.180] (-671.357) (-670.085) (-670.832) -- 0:00:49
183000 -- (-671.132) [-668.110] (-671.164) (-669.974) * (-667.813) (-667.068) [-670.171] (-672.677) -- 0:00:49
183500 -- (-670.068) [-667.749] (-668.869) (-670.842) * (-667.849) (-669.310) (-669.052) [-669.071] -- 0:00:48
184000 -- (-671.353) (-667.164) (-668.426) [-668.368] * [-671.131] (-667.638) (-667.640) (-668.345) -- 0:00:48
184500 -- (-669.366) (-669.216) [-668.999] (-669.989) * (-671.020) [-673.443] (-669.197) (-667.879) -- 0:00:48
185000 -- (-668.732) (-669.678) (-674.374) [-667.433] * (-672.650) (-667.397) (-671.166) [-667.969] -- 0:00:48
Average standard deviation of split frequencies: 0.015874
185500 -- (-667.252) [-666.476] (-668.699) (-667.984) * (-668.823) (-669.532) [-669.053] (-667.669) -- 0:00:48
186000 -- (-670.212) [-667.249] (-667.109) (-668.066) * (-667.504) (-669.509) (-666.890) [-668.258] -- 0:00:48
186500 -- (-668.199) [-667.068] (-667.122) (-673.861) * (-667.338) [-668.857] (-668.290) (-668.442) -- 0:00:47
187000 -- (-668.240) (-666.877) [-667.974] (-667.859) * (-673.158) (-667.797) [-670.521] (-669.309) -- 0:00:52
187500 -- (-670.490) (-669.275) (-667.605) [-667.803] * (-669.498) [-666.720] (-668.676) (-672.024) -- 0:00:52
188000 -- (-668.299) (-671.058) [-671.665] (-668.856) * (-669.967) (-668.530) (-667.385) [-669.186] -- 0:00:51
188500 -- (-668.092) (-669.434) [-669.600] (-670.209) * (-670.574) [-669.384] (-668.390) (-668.591) -- 0:00:51
189000 -- (-669.143) (-668.746) [-667.756] (-668.892) * (-668.204) (-668.627) (-667.844) [-667.334] -- 0:00:51
189500 -- [-667.692] (-669.402) (-668.365) (-669.934) * (-667.726) (-667.944) (-667.395) [-669.010] -- 0:00:51
190000 -- (-667.215) [-668.676] (-670.501) (-667.002) * (-668.475) (-669.402) (-669.847) [-669.449] -- 0:00:51
Average standard deviation of split frequencies: 0.017827
190500 -- [-666.996] (-670.854) (-671.286) (-667.239) * (-670.540) [-668.474] (-672.450) (-668.940) -- 0:00:50
191000 -- (-666.719) (-668.392) [-669.542] (-667.693) * (-668.948) (-670.062) [-668.036] (-669.313) -- 0:00:50
191500 -- (-668.344) (-670.165) [-669.990] (-670.491) * (-669.661) (-667.780) (-670.320) [-669.205] -- 0:00:50
192000 -- (-672.540) [-669.185] (-674.149) (-670.509) * (-670.683) (-667.874) (-671.015) [-669.788] -- 0:00:50
192500 -- [-668.136] (-669.370) (-667.877) (-668.517) * (-668.737) [-667.366] (-670.448) (-669.274) -- 0:00:50
193000 -- (-667.966) (-670.302) [-670.176] (-676.135) * (-667.221) (-667.478) (-670.125) [-668.855] -- 0:00:50
193500 -- (-667.306) (-670.611) (-672.207) [-669.550] * (-669.618) (-670.728) [-667.762] (-668.947) -- 0:00:50
194000 -- (-667.903) (-675.103) [-668.243] (-668.016) * [-670.980] (-668.361) (-670.500) (-667.699) -- 0:00:49
194500 -- (-667.467) (-669.913) [-668.353] (-667.567) * [-669.667] (-668.101) (-668.149) (-669.864) -- 0:00:49
195000 -- [-667.661] (-668.490) (-668.614) (-673.775) * [-672.029] (-670.994) (-667.037) (-670.284) -- 0:00:49
Average standard deviation of split frequencies: 0.015823
195500 -- (-669.223) (-669.456) (-672.103) [-668.595] * [-667.588] (-669.718) (-666.938) (-667.423) -- 0:00:49
196000 -- (-667.921) (-667.465) [-667.777] (-669.797) * (-670.762) (-667.845) (-667.464) [-671.891] -- 0:00:49
196500 -- (-667.039) [-672.187] (-668.303) (-674.879) * [-669.406] (-668.499) (-666.990) (-669.199) -- 0:00:49
197000 -- (-668.477) (-672.153) [-668.986] (-667.931) * (-668.511) [-670.193] (-667.590) (-670.116) -- 0:00:48
197500 -- (-670.615) (-668.111) [-669.760] (-668.394) * (-671.945) (-668.537) (-673.729) [-669.916] -- 0:00:48
198000 -- (-669.074) (-669.278) (-668.223) [-667.341] * (-667.164) (-667.427) [-672.807] (-667.982) -- 0:00:48
198500 -- [-669.763] (-666.983) (-668.448) (-668.800) * [-668.123] (-671.899) (-670.808) (-669.783) -- 0:00:48
199000 -- (-668.621) [-667.987] (-667.905) (-668.460) * (-668.264) [-668.716] (-667.211) (-668.413) -- 0:00:48
199500 -- [-668.547] (-673.117) (-669.632) (-668.007) * (-670.461) (-668.389) [-668.105] (-668.143) -- 0:00:48
200000 -- [-667.822] (-673.463) (-667.614) (-672.355) * (-667.218) (-667.200) [-671.470] (-670.905) -- 0:00:48
Average standard deviation of split frequencies: 0.016183
200500 -- [-671.052] (-669.161) (-670.024) (-669.930) * (-667.914) [-670.476] (-668.400) (-669.394) -- 0:00:47
201000 -- (-671.039) (-668.394) (-670.264) [-668.348] * (-669.141) (-670.672) (-667.029) [-670.160] -- 0:00:47
201500 -- (-668.901) [-667.668] (-669.524) (-668.940) * (-668.292) (-668.419) [-672.989] (-668.930) -- 0:00:47
202000 -- (-667.703) [-669.215] (-666.917) (-669.456) * (-667.184) [-667.181] (-671.573) (-669.519) -- 0:00:47
202500 -- (-667.472) (-667.492) (-668.514) [-668.568] * [-668.529] (-671.090) (-669.528) (-669.493) -- 0:00:47
203000 -- (-667.543) [-669.994] (-670.819) (-669.750) * (-671.297) (-668.169) [-668.449] (-668.359) -- 0:00:47
203500 -- (-668.957) (-668.255) [-670.193] (-668.432) * (-673.640) [-668.385] (-671.804) (-669.084) -- 0:00:46
204000 -- (-668.161) (-669.190) (-672.388) [-668.505] * [-672.832] (-667.304) (-668.983) (-666.566) -- 0:00:50
204500 -- [-670.540] (-670.475) (-673.342) (-667.165) * [-670.776] (-668.586) (-668.395) (-670.380) -- 0:00:50
205000 -- (-671.151) [-668.251] (-668.774) (-667.350) * (-667.625) [-666.899] (-668.649) (-671.007) -- 0:00:50
Average standard deviation of split frequencies: 0.014747
205500 -- (-667.705) [-670.344] (-669.941) (-667.416) * (-668.005) (-669.643) (-667.450) [-672.030] -- 0:00:50
206000 -- [-668.460] (-668.247) (-669.481) (-667.995) * (-667.638) (-672.530) (-666.979) [-667.751] -- 0:00:50
206500 -- [-667.055] (-670.060) (-669.014) (-672.807) * (-668.870) (-672.852) (-668.507) [-668.033] -- 0:00:49
207000 -- [-668.553] (-669.733) (-668.454) (-670.291) * (-668.361) [-670.734] (-667.848) (-669.152) -- 0:00:49
207500 -- [-667.594] (-669.222) (-666.930) (-674.221) * (-667.587) (-668.135) [-667.071] (-672.725) -- 0:00:49
208000 -- (-670.629) (-669.579) (-666.434) [-671.168] * (-667.066) (-669.671) [-667.146] (-675.101) -- 0:00:49
208500 -- (-668.769) [-670.954] (-669.379) (-668.522) * (-668.065) (-667.793) (-667.919) [-671.624] -- 0:00:49
209000 -- (-669.185) (-669.302) (-667.599) [-669.155] * [-668.688] (-670.496) (-668.759) (-668.009) -- 0:00:49
209500 -- (-671.065) (-668.186) (-669.476) [-668.316] * (-666.899) (-668.764) [-666.949] (-670.260) -- 0:00:49
210000 -- [-670.175] (-670.588) (-671.965) (-667.573) * (-670.155) (-669.154) (-668.870) [-668.254] -- 0:00:48
Average standard deviation of split frequencies: 0.015539
210500 -- (-667.610) [-667.979] (-668.588) (-667.518) * [-667.563] (-668.561) (-667.723) (-668.983) -- 0:00:48
211000 -- (-668.681) (-667.701) (-668.724) [-668.100] * (-669.192) [-668.245] (-669.239) (-668.850) -- 0:00:48
211500 -- (-669.246) (-668.218) (-668.796) [-672.526] * (-670.824) (-667.038) [-674.017] (-671.838) -- 0:00:48
212000 -- (-673.408) [-671.660] (-667.659) (-672.279) * (-667.966) (-667.722) (-667.988) [-668.269] -- 0:00:48
212500 -- (-670.288) [-667.180] (-667.985) (-669.737) * (-669.460) [-666.721] (-670.824) (-670.749) -- 0:00:48
213000 -- [-669.828] (-667.399) (-668.516) (-669.278) * [-671.559] (-667.296) (-667.641) (-668.617) -- 0:00:48
213500 -- (-668.186) (-670.518) [-668.307] (-668.768) * [-669.790] (-666.934) (-672.561) (-669.104) -- 0:00:47
214000 -- (-666.745) (-669.987) (-668.358) [-667.354] * [-667.885] (-667.631) (-668.842) (-668.807) -- 0:00:47
214500 -- [-666.866] (-673.560) (-668.972) (-669.643) * [-666.907] (-667.629) (-669.593) (-670.882) -- 0:00:47
215000 -- (-674.353) (-672.493) (-674.868) [-668.639] * [-667.099] (-669.528) (-668.002) (-667.584) -- 0:00:47
Average standard deviation of split frequencies: 0.015883
215500 -- (-667.809) (-667.617) (-674.620) [-668.779] * [-667.407] (-670.742) (-671.130) (-669.350) -- 0:00:47
216000 -- [-668.910] (-669.397) (-671.528) (-668.187) * (-670.055) (-668.053) [-667.114] (-669.302) -- 0:00:47
216500 -- (-668.199) (-669.071) (-674.319) [-673.508] * (-670.329) (-667.334) [-668.909] (-669.349) -- 0:00:47
217000 -- (-667.574) [-669.371] (-671.123) (-667.125) * (-670.611) (-670.995) [-667.747] (-668.137) -- 0:00:46
217500 -- (-668.226) (-669.330) [-670.346] (-670.382) * (-668.749) (-671.311) (-667.720) [-667.120] -- 0:00:46
218000 -- (-667.315) [-671.487] (-670.264) (-670.385) * (-668.701) (-668.126) [-667.596] (-669.317) -- 0:00:46
218500 -- [-670.267] (-668.143) (-668.903) (-667.096) * (-667.474) [-668.053] (-670.523) (-671.069) -- 0:00:46
219000 -- (-667.235) [-667.186] (-668.522) (-667.038) * (-667.617) [-667.653] (-669.978) (-668.211) -- 0:00:46
219500 -- [-668.475] (-669.365) (-666.832) (-668.069) * (-667.341) [-669.669] (-671.359) (-668.776) -- 0:00:46
220000 -- [-667.038] (-667.866) (-667.303) (-669.731) * [-667.186] (-670.594) (-672.418) (-670.270) -- 0:00:46
Average standard deviation of split frequencies: 0.016972
220500 -- (-668.196) (-667.489) [-668.866] (-667.682) * [-668.691] (-668.220) (-673.582) (-668.301) -- 0:00:49
221000 -- [-669.643] (-667.722) (-669.427) (-667.108) * (-671.301) [-669.543] (-674.512) (-668.616) -- 0:00:49
221500 -- (-667.877) (-667.323) (-669.862) [-667.914] * (-672.110) [-667.500] (-668.908) (-671.427) -- 0:00:49
222000 -- (-669.143) (-667.905) [-669.836] (-667.831) * (-667.157) [-666.824] (-675.012) (-669.188) -- 0:00:49
222500 -- [-667.779] (-667.669) (-668.923) (-668.317) * (-672.163) [-669.107] (-669.231) (-667.985) -- 0:00:48
223000 -- (-667.507) (-670.471) [-667.004] (-669.100) * (-669.538) (-669.873) [-667.724] (-668.074) -- 0:00:48
223500 -- (-668.921) (-667.916) [-667.689] (-668.868) * [-667.774] (-669.969) (-668.330) (-668.814) -- 0:00:48
224000 -- (-667.202) [-666.897] (-669.651) (-669.088) * [-669.526] (-671.564) (-669.121) (-668.670) -- 0:00:48
224500 -- [-669.118] (-669.454) (-669.415) (-668.915) * [-667.360] (-667.574) (-671.952) (-670.412) -- 0:00:48
225000 -- [-667.850] (-668.795) (-669.276) (-670.347) * (-666.779) (-667.510) [-671.999] (-674.341) -- 0:00:48
Average standard deviation of split frequencies: 0.015296
225500 -- (-667.997) (-668.302) [-668.868] (-669.946) * (-671.417) [-667.261] (-669.416) (-667.626) -- 0:00:48
226000 -- (-667.213) (-670.172) (-668.441) [-668.907] * (-669.288) [-667.842] (-669.333) (-673.904) -- 0:00:47
226500 -- (-668.162) (-667.867) (-668.656) [-667.578] * [-668.526] (-668.928) (-678.196) (-672.665) -- 0:00:47
227000 -- [-669.715] (-667.243) (-667.496) (-666.904) * (-667.511) (-668.157) (-674.612) [-672.642] -- 0:00:47
227500 -- (-668.115) (-673.623) [-668.128] (-668.353) * (-667.428) [-668.909] (-671.614) (-670.526) -- 0:00:47
228000 -- (-666.867) (-670.282) [-669.905] (-668.719) * (-668.881) [-667.137] (-669.952) (-670.066) -- 0:00:47
228500 -- (-666.871) [-667.785] (-666.966) (-668.677) * (-666.905) (-669.988) [-667.925] (-669.274) -- 0:00:47
229000 -- (-668.260) (-669.176) (-668.795) [-669.650] * [-673.701] (-668.446) (-669.125) (-669.827) -- 0:00:47
229500 -- [-668.441] (-667.833) (-667.132) (-669.107) * (-671.177) [-667.343] (-668.475) (-668.066) -- 0:00:47
230000 -- (-668.102) (-669.303) (-667.904) [-670.876] * (-670.758) [-668.339] (-668.377) (-674.219) -- 0:00:46
Average standard deviation of split frequencies: 0.014760
230500 -- (-669.502) (-668.286) (-668.156) [-668.276] * (-671.305) (-667.319) (-670.736) [-666.941] -- 0:00:46
231000 -- (-668.618) [-668.907] (-667.878) (-680.342) * [-667.990] (-668.551) (-668.124) (-667.590) -- 0:00:46
231500 -- (-667.553) (-670.806) [-668.001] (-671.429) * [-667.906] (-675.487) (-669.760) (-669.027) -- 0:00:46
232000 -- [-668.829] (-669.916) (-669.066) (-668.270) * [-667.546] (-670.472) (-670.352) (-670.163) -- 0:00:46
232500 -- (-668.963) (-670.206) [-669.404] (-668.038) * (-667.506) (-669.825) (-673.132) [-669.976] -- 0:00:46
233000 -- (-668.701) (-669.154) [-666.665] (-667.617) * (-670.023) (-675.097) (-668.863) [-667.247] -- 0:00:46
233500 -- [-673.658] (-669.367) (-666.554) (-667.846) * (-667.887) [-668.950] (-674.961) (-669.869) -- 0:00:45
234000 -- [-672.299] (-670.712) (-667.953) (-670.566) * [-667.736] (-669.617) (-671.131) (-667.271) -- 0:00:45
234500 -- [-668.720] (-668.233) (-668.222) (-671.426) * [-668.232] (-668.620) (-670.526) (-667.369) -- 0:00:45
235000 -- [-668.283] (-667.866) (-668.711) (-670.534) * (-670.214) [-666.997] (-668.484) (-668.660) -- 0:00:45
Average standard deviation of split frequencies: 0.014426
235500 -- [-667.829] (-667.761) (-667.833) (-668.906) * [-667.654] (-668.697) (-671.315) (-668.564) -- 0:00:45
236000 -- [-669.736] (-670.812) (-670.731) (-668.570) * (-671.241) (-668.540) [-667.830] (-669.060) -- 0:00:45
236500 -- (-667.619) (-669.457) (-671.056) [-670.012] * [-667.883] (-668.963) (-668.492) (-667.214) -- 0:00:45
237000 -- (-667.976) [-675.268] (-668.865) (-667.778) * (-666.769) [-670.055] (-667.529) (-667.583) -- 0:00:45
237500 -- (-667.639) (-668.816) (-669.417) [-669.196] * [-670.826] (-671.223) (-668.208) (-668.618) -- 0:00:48
238000 -- (-667.589) (-669.250) (-669.555) [-667.832] * [-667.608] (-668.146) (-668.115) (-668.805) -- 0:00:48
238500 -- (-667.432) [-669.125] (-673.841) (-667.122) * (-668.396) (-669.272) (-668.378) [-670.399] -- 0:00:47
239000 -- [-668.591] (-670.540) (-667.345) (-668.316) * (-672.729) [-668.701] (-667.289) (-677.192) -- 0:00:47
239500 -- [-666.966] (-669.347) (-669.211) (-668.315) * (-672.144) (-668.730) [-668.535] (-669.963) -- 0:00:47
240000 -- (-667.159) [-667.027] (-672.436) (-669.484) * [-671.668] (-669.058) (-666.934) (-668.391) -- 0:00:47
Average standard deviation of split frequencies: 0.014146
240500 -- (-668.946) (-670.716) [-668.996] (-669.907) * [-667.639] (-669.451) (-668.433) (-670.321) -- 0:00:47
241000 -- (-667.903) (-670.213) [-669.058] (-670.670) * [-670.088] (-670.386) (-672.623) (-669.630) -- 0:00:47
241500 -- [-669.157] (-668.154) (-667.824) (-672.509) * (-667.215) (-667.412) (-671.356) [-667.095] -- 0:00:47
242000 -- (-669.359) (-668.165) [-670.053] (-672.346) * (-670.131) (-669.928) (-669.885) [-667.411] -- 0:00:46
242500 -- (-671.707) [-671.070] (-667.524) (-668.805) * (-669.580) (-668.497) [-670.646] (-668.968) -- 0:00:46
243000 -- [-671.044] (-668.151) (-667.821) (-671.459) * [-669.546] (-670.575) (-669.340) (-670.887) -- 0:00:46
243500 -- (-671.800) (-669.776) (-668.088) [-670.324] * [-669.261] (-672.078) (-670.825) (-666.942) -- 0:00:46
244000 -- (-668.547) (-667.940) (-669.004) [-667.532] * (-668.439) (-668.920) (-668.948) [-668.554] -- 0:00:46
244500 -- (-669.776) (-670.744) (-669.188) [-668.602] * (-668.471) (-673.500) [-666.924] (-667.896) -- 0:00:46
245000 -- [-666.846] (-670.622) (-669.740) (-668.140) * [-667.764] (-669.399) (-668.265) (-669.241) -- 0:00:46
Average standard deviation of split frequencies: 0.013414
245500 -- [-668.202] (-671.832) (-667.300) (-668.903) * (-668.270) (-668.130) [-668.130] (-670.709) -- 0:00:46
246000 -- (-668.876) (-667.268) [-667.582] (-669.909) * (-669.019) [-671.985] (-668.276) (-670.065) -- 0:00:45
246500 -- (-668.617) (-671.316) (-668.704) [-668.488] * (-671.749) (-671.638) [-667.444] (-667.732) -- 0:00:45
247000 -- (-668.140) (-669.077) [-667.211] (-667.123) * (-674.206) (-669.993) [-666.991] (-670.462) -- 0:00:45
247500 -- [-669.985] (-667.541) (-667.671) (-670.655) * (-669.703) (-668.676) [-668.876] (-671.731) -- 0:00:45
248000 -- (-671.482) (-669.723) (-668.545) [-669.105] * (-671.101) (-667.925) [-670.095] (-675.150) -- 0:00:45
248500 -- (-669.453) [-668.657] (-668.900) (-670.939) * (-667.705) (-667.446) (-670.567) [-670.781] -- 0:00:45
249000 -- (-667.935) (-668.245) (-667.536) [-667.067] * (-669.799) [-670.590] (-668.460) (-671.663) -- 0:00:45
249500 -- [-667.361] (-669.374) (-669.980) (-669.090) * (-666.888) (-669.384) (-667.690) [-667.077] -- 0:00:45
250000 -- [-668.548] (-673.377) (-668.800) (-676.754) * (-675.027) (-668.297) [-667.414] (-668.170) -- 0:00:45
Average standard deviation of split frequencies: 0.014105
250500 -- (-667.308) [-667.473] (-668.046) (-672.280) * (-672.599) (-668.293) [-667.863] (-670.904) -- 0:00:44
251000 -- (-668.960) (-667.264) [-669.794] (-667.898) * [-669.572] (-669.447) (-671.649) (-670.004) -- 0:00:44
251500 -- (-667.968) (-669.398) (-673.295) [-667.538] * [-670.256] (-669.137) (-666.931) (-669.004) -- 0:00:44
252000 -- (-668.413) [-670.638] (-670.144) (-670.011) * [-674.618] (-669.436) (-667.225) (-670.095) -- 0:00:44
252500 -- (-667.789) [-667.491] (-668.526) (-673.867) * (-669.617) (-667.431) [-668.794] (-668.484) -- 0:00:44
253000 -- [-667.493] (-668.836) (-668.225) (-668.077) * (-669.580) [-668.705] (-676.952) (-670.664) -- 0:00:44
253500 -- [-669.350] (-671.352) (-673.028) (-668.519) * (-668.311) [-667.548] (-672.064) (-669.218) -- 0:00:44
254000 -- (-668.559) [-667.751] (-667.291) (-668.194) * (-672.998) (-666.723) [-669.437] (-672.848) -- 0:00:46
254500 -- (-669.054) (-667.752) [-669.719] (-669.055) * [-668.246] (-669.716) (-671.565) (-669.982) -- 0:00:46
255000 -- (-668.670) (-669.684) (-667.630) [-668.773] * (-667.809) (-669.626) (-668.847) [-667.544] -- 0:00:46
Average standard deviation of split frequencies: 0.013606
255500 -- (-669.194) (-671.720) [-668.024] (-668.984) * [-667.363] (-668.014) (-672.825) (-669.275) -- 0:00:46
256000 -- [-667.965] (-667.844) (-672.397) (-669.026) * (-667.859) [-666.665] (-669.953) (-670.939) -- 0:00:46
256500 -- (-668.814) (-668.937) [-669.794] (-669.655) * (-668.812) (-668.744) (-669.576) [-671.733] -- 0:00:46
257000 -- (-673.683) (-671.321) (-667.854) [-669.150] * (-669.535) [-667.459] (-668.989) (-669.745) -- 0:00:46
257500 -- (-667.124) (-671.556) (-666.912) [-669.522] * (-668.491) (-669.652) (-673.214) [-668.389] -- 0:00:46
258000 -- (-668.553) (-668.202) [-667.211] (-671.829) * (-672.164) (-669.375) [-666.797] (-668.305) -- 0:00:46
258500 -- (-669.016) (-669.088) [-672.209] (-671.003) * [-668.316] (-668.506) (-671.423) (-668.449) -- 0:00:45
259000 -- (-669.766) (-670.658) [-669.837] (-668.651) * (-670.763) (-667.820) [-667.250] (-677.598) -- 0:00:45
259500 -- (-668.508) (-671.620) (-667.976) [-671.432] * (-667.059) [-666.920] (-668.230) (-673.084) -- 0:00:45
260000 -- (-671.110) (-669.098) [-667.155] (-670.634) * [-667.262] (-668.148) (-670.981) (-668.543) -- 0:00:45
Average standard deviation of split frequencies: 0.013362
260500 -- [-668.172] (-670.449) (-667.581) (-666.934) * (-669.601) (-668.164) [-669.471] (-672.569) -- 0:00:45
261000 -- [-669.762] (-670.203) (-668.507) (-666.806) * (-666.903) [-667.122] (-671.721) (-671.389) -- 0:00:45
261500 -- (-670.510) (-667.833) [-668.378] (-670.000) * (-670.175) (-666.699) [-667.539] (-667.040) -- 0:00:45
262000 -- (-666.893) [-668.415] (-667.300) (-668.016) * (-668.565) [-668.269] (-670.273) (-666.880) -- 0:00:45
262500 -- (-666.909) (-669.450) [-668.217] (-668.665) * (-670.481) (-669.128) (-669.644) [-669.500] -- 0:00:44
263000 -- (-670.107) (-668.986) [-669.590] (-670.795) * [-667.006] (-669.417) (-668.945) (-676.887) -- 0:00:44
263500 -- (-670.652) (-671.033) (-668.181) [-667.858] * (-666.821) (-677.731) [-670.043] (-675.783) -- 0:00:44
264000 -- [-669.102] (-672.089) (-670.742) (-673.798) * (-667.664) (-670.904) [-668.807] (-668.775) -- 0:00:44
264500 -- (-666.964) [-670.073] (-671.304) (-669.490) * (-668.366) (-669.833) [-667.837] (-667.806) -- 0:00:44
265000 -- (-668.055) (-668.390) (-667.069) [-666.830] * [-667.656] (-670.434) (-667.327) (-667.696) -- 0:00:44
Average standard deviation of split frequencies: 0.012799
265500 -- (-667.635) (-668.173) (-667.864) [-670.365] * (-667.439) (-670.410) [-668.349] (-669.186) -- 0:00:44
266000 -- (-667.651) (-668.670) (-670.675) [-671.927] * (-667.572) [-669.578] (-669.441) (-668.669) -- 0:00:44
266500 -- (-669.632) [-670.660] (-671.706) (-667.690) * [-668.176] (-668.445) (-669.543) (-668.649) -- 0:00:44
267000 -- (-671.742) (-672.137) (-671.683) [-670.510] * (-667.350) [-667.974] (-668.108) (-667.865) -- 0:00:43
267500 -- (-671.109) (-667.736) (-668.053) [-667.148] * (-671.942) (-668.664) (-672.269) [-668.717] -- 0:00:43
268000 -- (-667.758) (-668.075) [-671.875] (-667.183) * (-669.971) (-670.949) [-669.387] (-671.351) -- 0:00:43
268500 -- [-668.006] (-667.395) (-667.682) (-667.764) * (-671.519) (-670.098) (-669.131) [-668.778] -- 0:00:43
269000 -- (-670.468) [-666.847] (-668.790) (-669.377) * [-671.914] (-670.347) (-669.504) (-668.781) -- 0:00:43
269500 -- [-668.063] (-669.192) (-668.285) (-668.739) * (-668.384) [-667.943] (-667.217) (-669.163) -- 0:00:43
270000 -- (-668.662) (-667.180) (-667.996) [-668.992] * (-672.540) (-669.695) [-667.220] (-668.313) -- 0:00:43
Average standard deviation of split frequencies: 0.012288
270500 -- (-669.572) (-668.128) [-668.516] (-668.344) * (-668.012) (-671.849) (-668.844) [-667.091] -- 0:00:43
271000 -- (-667.675) (-669.502) [-672.718] (-668.010) * (-668.174) (-669.781) [-669.609] (-668.900) -- 0:00:45
271500 -- [-667.724] (-670.225) (-671.376) (-669.452) * (-669.696) (-668.095) [-668.293] (-667.791) -- 0:00:45
272000 -- [-668.027] (-669.006) (-667.783) (-668.026) * [-667.917] (-668.965) (-668.127) (-668.142) -- 0:00:45
272500 -- [-670.127] (-667.958) (-667.900) (-669.299) * (-667.213) (-667.749) (-668.690) [-670.358] -- 0:00:45
273000 -- (-673.488) [-667.625] (-668.553) (-668.502) * (-667.108) (-669.077) (-669.310) [-669.896] -- 0:00:45
273500 -- (-667.285) (-668.025) [-667.897] (-669.350) * (-670.791) [-668.026] (-669.674) (-669.154) -- 0:00:45
274000 -- [-667.370] (-669.344) (-669.117) (-666.910) * (-668.538) [-667.206] (-670.662) (-668.312) -- 0:00:45
274500 -- [-670.166] (-668.642) (-667.490) (-671.865) * [-671.801] (-667.826) (-670.900) (-666.957) -- 0:00:44
275000 -- (-669.675) [-667.657] (-669.449) (-669.545) * [-669.275] (-667.363) (-670.482) (-669.070) -- 0:00:44
Average standard deviation of split frequencies: 0.011956
275500 -- [-667.206] (-667.042) (-670.571) (-669.609) * (-670.025) (-669.320) [-667.998] (-667.627) -- 0:00:44
276000 -- (-668.581) (-671.039) [-667.118] (-668.882) * [-669.763] (-674.922) (-669.258) (-668.014) -- 0:00:44
276500 -- (-669.606) (-671.318) [-668.069] (-666.806) * (-674.749) [-672.053] (-669.923) (-671.853) -- 0:00:44
277000 -- (-668.120) (-671.616) [-667.922] (-667.921) * (-674.902) [-669.067] (-670.058) (-667.105) -- 0:00:44
277500 -- (-670.712) (-669.312) (-669.096) [-666.863] * [-669.178] (-668.580) (-668.380) (-670.405) -- 0:00:44
278000 -- (-669.582) (-669.170) [-667.535] (-667.496) * [-672.873] (-671.069) (-669.767) (-669.680) -- 0:00:44
278500 -- (-670.864) (-667.039) (-668.704) [-667.403] * (-671.033) (-668.063) [-670.441] (-669.109) -- 0:00:44
279000 -- [-669.927] (-667.308) (-671.117) (-667.475) * (-670.387) (-669.006) [-670.321] (-668.576) -- 0:00:43
279500 -- (-667.297) (-670.215) (-670.657) [-667.355] * (-669.221) (-669.226) [-667.830] (-668.120) -- 0:00:43
280000 -- (-668.564) (-668.248) [-670.300] (-668.065) * [-668.300] (-667.915) (-668.446) (-667.957) -- 0:00:43
Average standard deviation of split frequencies: 0.012037
280500 -- [-667.653] (-668.259) (-672.472) (-668.549) * (-667.432) (-669.802) (-669.040) [-667.709] -- 0:00:43
281000 -- (-668.473) (-668.055) (-669.960) [-671.537] * [-667.564] (-669.670) (-670.103) (-669.795) -- 0:00:43
281500 -- (-670.952) (-669.170) (-670.295) [-669.196] * [-667.627] (-669.638) (-667.437) (-668.908) -- 0:00:43
282000 -- (-669.064) [-668.422] (-676.367) (-667.937) * [-667.590] (-669.016) (-669.613) (-668.898) -- 0:00:43
282500 -- (-668.727) (-668.983) [-670.981] (-667.403) * (-670.141) (-669.016) [-670.275] (-668.898) -- 0:00:43
283000 -- (-673.472) [-667.420] (-672.763) (-666.535) * (-672.137) (-667.285) (-669.683) [-671.490] -- 0:00:43
283500 -- (-669.474) [-669.337] (-673.155) (-667.689) * (-671.569) [-669.065] (-670.712) (-670.778) -- 0:00:42
284000 -- (-667.258) [-669.722] (-668.556) (-666.738) * (-674.928) [-668.237] (-672.410) (-668.861) -- 0:00:42
284500 -- (-671.617) (-669.853) [-668.553] (-667.554) * (-669.626) (-668.903) [-668.720] (-669.751) -- 0:00:42
285000 -- (-667.047) (-668.068) (-669.161) [-668.684] * (-669.702) (-669.821) [-668.819] (-670.091) -- 0:00:42
Average standard deviation of split frequencies: 0.010931
285500 -- [-670.111] (-672.211) (-667.670) (-668.219) * (-667.419) [-668.111] (-667.731) (-669.190) -- 0:00:42
286000 -- (-671.148) (-668.695) (-667.305) [-667.487] * [-668.681] (-671.157) (-672.332) (-668.537) -- 0:00:42
286500 -- [-668.224] (-669.113) (-666.724) (-671.895) * (-669.280) (-667.193) [-668.858] (-669.417) -- 0:00:42
287000 -- (-669.975) (-668.913) (-668.636) [-668.323] * (-670.286) (-666.877) (-670.076) [-668.928] -- 0:00:42
287500 -- [-667.788] (-668.461) (-669.817) (-670.482) * (-669.491) (-669.532) [-672.634] (-671.503) -- 0:00:42
288000 -- (-668.473) (-667.411) [-674.087] (-669.831) * (-668.899) [-670.269] (-672.181) (-672.863) -- 0:00:44
288500 -- (-667.669) (-667.867) (-668.584) [-668.030] * (-669.003) [-669.086] (-668.838) (-669.727) -- 0:00:44
289000 -- (-667.073) (-667.788) [-669.699] (-668.496) * (-669.301) (-668.128) (-667.557) [-666.989] -- 0:00:44
289500 -- [-668.523] (-669.875) (-667.886) (-669.619) * (-668.349) [-668.047] (-667.032) (-666.968) -- 0:00:44
290000 -- (-669.317) [-667.473] (-673.580) (-669.591) * [-671.574] (-670.139) (-668.668) (-671.652) -- 0:00:44
Average standard deviation of split frequencies: 0.011097
290500 -- (-666.795) (-668.342) [-670.033] (-668.906) * [-668.990] (-669.986) (-668.249) (-670.768) -- 0:00:43
291000 -- [-668.633] (-667.067) (-667.662) (-667.156) * (-668.360) (-667.495) (-666.889) [-667.103] -- 0:00:43
291500 -- (-667.900) [-666.947] (-668.860) (-669.175) * [-669.712] (-668.385) (-666.966) (-668.949) -- 0:00:43
292000 -- (-667.940) [-666.997] (-668.364) (-672.671) * (-672.184) [-668.446] (-667.580) (-671.476) -- 0:00:43
292500 -- [-669.320] (-667.772) (-666.906) (-668.696) * [-667.233] (-668.934) (-668.189) (-669.028) -- 0:00:43
293000 -- (-669.240) (-669.857) [-671.314] (-669.355) * [-668.024] (-669.483) (-670.933) (-669.979) -- 0:00:43
293500 -- (-668.390) (-669.052) (-675.092) [-669.544] * (-667.286) [-671.000] (-670.172) (-671.190) -- 0:00:43
294000 -- [-668.812] (-669.355) (-671.772) (-669.085) * (-671.856) (-671.661) [-668.354] (-667.784) -- 0:00:43
294500 -- (-670.130) (-675.059) [-667.454] (-666.884) * (-675.807) (-669.574) [-669.073] (-671.330) -- 0:00:43
295000 -- (-670.788) (-667.079) [-668.587] (-672.251) * (-669.802) (-668.708) [-668.971] (-669.487) -- 0:00:43
Average standard deviation of split frequencies: 0.010883
295500 -- (-667.754) (-667.641) (-668.079) [-670.490] * (-670.141) [-670.635] (-668.505) (-671.189) -- 0:00:42
296000 -- (-669.882) [-668.249] (-670.715) (-673.632) * (-669.333) [-670.312] (-667.771) (-671.074) -- 0:00:42
296500 -- (-668.815) [-667.410] (-668.872) (-671.931) * [-670.669] (-669.506) (-666.871) (-673.075) -- 0:00:42
297000 -- (-667.371) [-671.376] (-669.330) (-667.541) * [-668.819] (-673.304) (-666.903) (-670.628) -- 0:00:42
297500 -- [-668.488] (-672.107) (-667.508) (-670.156) * (-672.570) (-669.602) [-667.549] (-669.518) -- 0:00:42
298000 -- (-667.480) (-669.721) (-668.532) [-670.664] * [-671.507] (-668.145) (-671.982) (-670.775) -- 0:00:42
298500 -- (-669.194) [-667.584] (-671.030) (-668.603) * [-670.566] (-667.384) (-669.819) (-666.896) -- 0:00:42
299000 -- (-669.507) (-671.996) [-668.362] (-667.513) * (-667.439) (-668.494) (-669.939) [-667.593] -- 0:00:42
299500 -- (-672.327) (-669.271) (-670.062) [-668.376] * [-667.916] (-667.752) (-669.519) (-670.640) -- 0:00:42
300000 -- (-671.175) (-669.825) (-671.316) [-671.951] * [-667.215] (-669.546) (-666.917) (-670.802) -- 0:00:42
Average standard deviation of split frequencies: 0.010975
300500 -- [-670.109] (-670.516) (-667.488) (-670.212) * (-669.421) [-670.186] (-671.358) (-667.790) -- 0:00:41
301000 -- (-668.502) (-668.504) [-668.380] (-672.082) * (-668.040) [-668.343] (-671.930) (-669.985) -- 0:00:41
301500 -- (-672.002) (-669.938) (-668.983) [-668.996] * (-669.376) [-672.375] (-668.555) (-671.310) -- 0:00:41
302000 -- (-670.958) (-668.137) [-667.806] (-667.353) * (-668.406) [-667.892] (-669.366) (-668.341) -- 0:00:41
302500 -- (-671.664) (-668.484) (-668.842) [-667.909] * (-673.441) (-669.800) (-670.522) [-669.188] -- 0:00:41
303000 -- [-669.019] (-668.356) (-668.314) (-670.088) * (-667.430) (-671.795) (-672.341) [-668.123] -- 0:00:41
303500 -- [-668.085] (-667.886) (-672.268) (-670.023) * (-669.896) (-668.589) (-668.877) [-668.803] -- 0:00:41
304000 -- (-668.730) (-671.007) (-669.010) [-674.503] * (-669.429) (-668.109) (-668.270) [-668.526] -- 0:00:41
304500 -- (-671.080) (-671.100) [-669.092] (-667.579) * (-672.681) (-669.867) (-668.128) [-668.626] -- 0:00:43
305000 -- (-669.306) [-667.513] (-668.871) (-669.218) * (-667.735) (-669.516) (-666.827) [-668.975] -- 0:00:43
Average standard deviation of split frequencies: 0.010622
305500 -- [-668.822] (-673.845) (-667.126) (-671.221) * (-667.616) (-668.264) [-667.002] (-672.718) -- 0:00:43
306000 -- (-670.506) (-670.360) (-667.340) [-671.426] * [-667.168] (-667.791) (-666.782) (-670.360) -- 0:00:43
306500 -- [-670.281] (-670.559) (-667.925) (-668.740) * (-668.163) [-669.280] (-666.937) (-667.738) -- 0:00:42
307000 -- (-670.138) (-667.595) [-668.717] (-676.411) * (-672.500) (-669.043) (-668.663) [-667.776] -- 0:00:42
307500 -- (-668.225) (-668.148) [-671.756] (-670.488) * (-668.713) (-667.500) (-670.492) [-670.077] -- 0:00:42
308000 -- (-667.863) (-668.286) [-668.407] (-670.513) * [-668.291] (-668.516) (-668.145) (-673.129) -- 0:00:42
308500 -- (-669.567) (-668.644) [-667.733] (-668.516) * [-669.934] (-668.818) (-669.595) (-669.265) -- 0:00:42
309000 -- [-668.801] (-670.643) (-668.611) (-672.304) * (-671.033) [-669.188] (-670.441) (-668.951) -- 0:00:42
309500 -- (-667.698) [-668.320] (-671.051) (-670.852) * [-672.017] (-669.795) (-667.927) (-668.174) -- 0:00:42
310000 -- (-668.692) [-669.357] (-671.867) (-667.870) * [-667.072] (-671.693) (-669.319) (-666.914) -- 0:00:42
Average standard deviation of split frequencies: 0.011021
310500 -- (-672.076) (-667.505) (-669.858) [-667.409] * [-668.642] (-668.191) (-669.777) (-670.499) -- 0:00:42
311000 -- (-669.152) [-667.380] (-670.428) (-667.472) * (-667.901) [-667.425] (-668.824) (-667.362) -- 0:00:42
311500 -- (-668.375) (-669.530) (-667.096) [-667.547] * (-667.431) [-667.425] (-668.056) (-669.641) -- 0:00:41
312000 -- (-667.266) [-669.378] (-669.441) (-668.215) * (-669.723) (-669.477) [-668.040] (-668.568) -- 0:00:41
312500 -- (-667.409) (-672.623) [-673.415] (-668.016) * (-668.966) (-671.103) (-668.802) [-668.185] -- 0:00:41
313000 -- [-669.796] (-672.298) (-672.455) (-671.423) * [-669.706] (-678.238) (-668.544) (-669.621) -- 0:00:41
313500 -- (-668.961) (-672.199) [-668.159] (-672.705) * (-669.158) (-668.025) (-669.694) [-670.650] -- 0:00:41
314000 -- (-669.685) (-668.162) (-667.470) [-669.155] * (-669.879) [-669.212] (-668.662) (-672.259) -- 0:00:41
314500 -- (-668.243) [-670.603] (-673.294) (-666.977) * (-670.711) (-670.638) (-669.776) [-670.309] -- 0:00:41
315000 -- (-668.695) [-669.782] (-670.535) (-667.957) * (-668.664) (-669.677) (-669.280) [-669.900] -- 0:00:41
Average standard deviation of split frequencies: 0.010521
315500 -- [-670.601] (-667.789) (-671.057) (-667.430) * (-668.856) [-670.064] (-669.326) (-668.045) -- 0:00:41
316000 -- (-672.728) [-669.646] (-669.419) (-668.292) * [-668.973] (-666.732) (-667.595) (-669.796) -- 0:00:41
316500 -- (-667.794) (-669.884) [-668.091] (-668.052) * (-670.373) (-669.133) (-668.853) [-670.182] -- 0:00:41
317000 -- [-668.675] (-669.281) (-667.538) (-668.833) * (-668.905) [-667.790] (-670.216) (-670.698) -- 0:00:40
317500 -- [-667.128] (-668.022) (-668.079) (-670.981) * (-668.996) (-674.849) [-668.191] (-669.719) -- 0:00:40
318000 -- (-668.875) (-667.963) [-667.651] (-674.542) * (-668.384) (-668.093) [-667.363] (-669.226) -- 0:00:40
318500 -- (-669.644) (-669.052) [-669.534] (-668.345) * [-668.569] (-670.739) (-669.158) (-668.721) -- 0:00:40
319000 -- [-671.114] (-670.436) (-669.450) (-669.856) * [-670.990] (-670.706) (-672.882) (-668.699) -- 0:00:40
319500 -- (-672.093) (-668.265) [-668.258] (-668.328) * (-670.861) (-669.301) (-669.328) [-671.517] -- 0:00:40
320000 -- (-668.886) [-667.729] (-667.128) (-668.407) * (-667.067) (-670.234) (-671.219) [-670.404] -- 0:00:40
Average standard deviation of split frequencies: 0.011242
320500 -- (-675.328) [-669.318] (-667.159) (-669.084) * [-667.523] (-668.801) (-670.730) (-671.616) -- 0:00:40
321000 -- (-668.193) (-668.304) (-666.711) [-667.348] * (-671.132) (-672.851) (-669.198) [-668.065] -- 0:00:42
321500 -- (-669.210) (-667.656) (-667.684) [-673.478] * [-668.523] (-667.271) (-669.000) (-670.506) -- 0:00:42
322000 -- (-667.939) (-671.507) [-667.613] (-668.834) * (-669.883) [-668.603] (-669.023) (-667.920) -- 0:00:42
322500 -- (-668.313) [-675.856] (-669.284) (-669.122) * (-670.643) (-668.331) (-669.776) [-670.179] -- 0:00:42
323000 -- (-668.566) (-671.151) (-669.007) [-668.186] * (-668.722) (-667.931) [-668.234] (-667.630) -- 0:00:41
323500 -- [-670.943] (-670.453) (-669.850) (-671.983) * (-668.170) (-668.248) [-670.225] (-667.865) -- 0:00:41
324000 -- (-668.436) (-667.605) (-670.184) [-669.119] * (-673.858) (-668.437) (-668.543) [-668.953] -- 0:00:41
324500 -- (-666.974) (-673.635) (-670.085) [-668.607] * (-672.774) (-668.139) (-668.847) [-669.204] -- 0:00:41
325000 -- [-669.774] (-668.389) (-669.462) (-668.347) * [-667.217] (-668.663) (-671.735) (-667.612) -- 0:00:41
Average standard deviation of split frequencies: 0.010351
325500 -- [-666.895] (-666.934) (-669.341) (-668.199) * (-670.563) [-671.196] (-669.193) (-667.435) -- 0:00:41
326000 -- (-668.910) (-666.792) [-669.837] (-667.824) * (-668.110) (-669.298) [-667.129] (-670.119) -- 0:00:41
326500 -- (-668.654) [-667.098] (-667.158) (-668.524) * (-670.153) [-669.316] (-667.460) (-667.673) -- 0:00:41
327000 -- (-667.376) (-670.829) [-668.153] (-667.333) * (-670.053) (-670.756) [-667.103] (-668.929) -- 0:00:41
327500 -- (-672.204) [-668.931] (-673.151) (-667.858) * (-668.118) (-668.903) [-667.163] (-667.931) -- 0:00:41
328000 -- [-666.586] (-667.733) (-670.067) (-669.265) * [-667.937] (-666.991) (-667.686) (-668.420) -- 0:00:40
328500 -- (-667.769) [-667.949] (-667.734) (-668.885) * (-668.693) (-667.652) [-668.079] (-667.802) -- 0:00:40
329000 -- [-666.556] (-669.600) (-672.652) (-667.908) * (-668.763) [-669.320] (-667.259) (-670.474) -- 0:00:40
329500 -- [-668.229] (-668.284) (-668.414) (-671.558) * (-667.477) [-667.027] (-668.747) (-667.554) -- 0:00:40
330000 -- (-669.779) (-668.227) [-669.093] (-669.432) * (-668.144) [-667.168] (-667.317) (-669.521) -- 0:00:40
Average standard deviation of split frequencies: 0.011070
330500 -- (-667.473) [-671.035] (-667.507) (-668.214) * (-668.724) (-673.089) (-669.046) [-668.010] -- 0:00:40
331000 -- (-672.413) (-668.232) [-668.739] (-670.550) * (-670.763) (-672.559) (-672.575) [-669.118] -- 0:00:40
331500 -- (-668.521) [-671.326] (-669.523) (-669.427) * (-668.714) [-669.035] (-667.667) (-668.491) -- 0:00:40
332000 -- (-667.694) (-671.529) (-668.587) [-666.902] * (-671.443) (-668.960) [-669.150] (-673.373) -- 0:00:40
332500 -- [-669.421] (-670.677) (-667.757) (-668.691) * (-668.603) [-667.988] (-670.394) (-671.551) -- 0:00:40
333000 -- (-669.095) (-669.122) [-673.394] (-669.799) * [-668.752] (-670.533) (-667.200) (-668.725) -- 0:00:40
333500 -- (-668.974) (-668.227) [-667.466] (-670.640) * [-670.016] (-670.674) (-669.753) (-668.885) -- 0:00:39
334000 -- [-668.761] (-667.801) (-668.280) (-670.819) * [-672.790] (-670.069) (-671.182) (-670.525) -- 0:00:39
334500 -- [-668.306] (-667.584) (-668.657) (-669.710) * (-668.418) (-668.704) [-667.518] (-669.556) -- 0:00:39
335000 -- (-674.383) [-672.309] (-668.137) (-668.057) * (-669.209) (-667.071) (-666.826) [-666.544] -- 0:00:39
Average standard deviation of split frequencies: 0.009599
335500 -- (-671.239) (-669.354) [-669.092] (-672.248) * [-666.959] (-668.184) (-669.375) (-672.515) -- 0:00:39
336000 -- (-673.153) (-668.638) [-670.430] (-671.212) * [-668.099] (-672.823) (-672.369) (-671.101) -- 0:00:39
336500 -- (-669.286) (-668.955) (-666.856) [-669.870] * [-667.850] (-668.811) (-672.966) (-671.390) -- 0:00:39
337000 -- (-668.292) [-669.253] (-666.783) (-667.757) * (-667.938) [-669.542] (-666.969) (-669.930) -- 0:00:39
337500 -- (-668.251) (-670.994) (-669.258) [-671.870] * (-667.555) (-669.759) [-666.901] (-668.865) -- 0:00:41
338000 -- (-677.347) (-670.514) [-667.759] (-670.186) * [-667.932] (-670.513) (-666.772) (-667.984) -- 0:00:41
338500 -- [-669.932] (-668.868) (-670.765) (-668.190) * [-668.282] (-669.412) (-667.869) (-668.200) -- 0:00:41
339000 -- [-670.465] (-671.210) (-667.401) (-668.527) * [-669.240] (-673.120) (-668.101) (-667.369) -- 0:00:40
339500 -- [-669.185] (-669.838) (-668.163) (-668.264) * (-670.000) (-672.434) [-668.620] (-667.432) -- 0:00:40
340000 -- (-669.071) (-668.546) [-668.057] (-668.434) * [-669.950] (-667.360) (-669.564) (-667.151) -- 0:00:40
Average standard deviation of split frequencies: 0.010532
340500 -- (-668.651) (-673.560) [-667.517] (-668.314) * (-672.221) [-667.818] (-669.357) (-670.420) -- 0:00:40
341000 -- (-668.357) (-668.016) (-670.410) [-669.300] * (-672.532) (-667.673) [-668.992] (-669.710) -- 0:00:40
341500 -- (-672.529) (-668.663) [-667.411] (-668.570) * (-667.987) (-669.298) [-668.406] (-666.766) -- 0:00:40
342000 -- (-669.213) (-668.397) [-668.274] (-669.345) * (-671.301) (-667.066) [-666.903] (-668.787) -- 0:00:40
342500 -- (-670.194) (-670.341) [-672.624] (-668.627) * (-668.904) (-668.029) (-667.580) [-666.938] -- 0:00:40
343000 -- (-672.590) (-670.930) [-667.662] (-669.849) * (-670.441) [-670.336] (-669.854) (-667.635) -- 0:00:40
343500 -- (-669.015) (-667.959) (-669.333) [-668.639] * (-668.038) [-668.971] (-670.342) (-670.632) -- 0:00:40
344000 -- (-669.760) (-669.773) (-672.429) [-669.081] * [-669.209] (-670.076) (-670.322) (-668.866) -- 0:00:40
344500 -- (-675.088) [-669.391] (-670.310) (-668.606) * (-667.388) (-668.869) (-669.889) [-666.810] -- 0:00:39
345000 -- (-669.878) (-671.819) [-669.707] (-670.565) * [-667.388] (-667.718) (-669.440) (-668.345) -- 0:00:39
Average standard deviation of split frequencies: 0.009967
345500 -- (-667.621) (-667.399) (-669.261) [-668.469] * (-669.344) (-671.139) [-670.421] (-669.912) -- 0:00:39
346000 -- (-669.977) (-668.113) (-670.833) [-668.622] * (-669.361) (-668.829) [-670.962] (-672.497) -- 0:00:39
346500 -- (-668.549) [-670.365] (-669.384) (-669.865) * (-674.266) [-666.844] (-666.693) (-669.141) -- 0:00:39
347000 -- (-668.155) (-669.737) [-669.858] (-667.027) * (-671.853) (-669.889) (-666.857) [-670.669] -- 0:00:39
347500 -- (-670.966) [-667.430] (-672.253) (-668.029) * (-667.876) [-667.225] (-668.084) (-669.192) -- 0:00:39
348000 -- [-669.687] (-667.318) (-667.395) (-671.671) * (-668.939) [-666.906] (-668.058) (-667.491) -- 0:00:39
348500 -- (-669.652) [-668.027] (-668.848) (-668.952) * (-667.702) (-668.981) [-671.825] (-668.354) -- 0:00:39
349000 -- (-669.240) [-667.513] (-668.531) (-671.259) * (-669.475) (-670.735) (-668.696) [-668.576] -- 0:00:39
349500 -- (-669.130) (-669.423) (-670.321) [-669.972] * (-671.715) (-670.928) [-669.043] (-667.444) -- 0:00:39
350000 -- (-668.419) [-668.270] (-669.346) (-669.792) * (-668.076) [-669.417] (-669.076) (-667.681) -- 0:00:39
Average standard deviation of split frequencies: 0.009933
350500 -- (-670.232) (-668.297) [-667.855] (-668.007) * (-670.533) (-670.489) [-669.047] (-667.338) -- 0:00:38
351000 -- (-668.074) [-671.454] (-667.632) (-668.193) * (-670.625) [-669.221] (-667.147) (-667.404) -- 0:00:38
351500 -- [-668.758] (-667.955) (-667.699) (-670.124) * (-669.951) (-669.208) [-669.887] (-668.392) -- 0:00:38
352000 -- (-675.494) (-674.579) [-667.540] (-670.498) * (-672.978) [-671.176] (-669.533) (-669.805) -- 0:00:38
352500 -- [-669.401] (-668.500) (-671.370) (-670.119) * (-673.070) (-671.373) (-668.274) [-667.697] -- 0:00:38
353000 -- (-670.061) [-667.904] (-670.957) (-668.426) * (-667.670) (-670.418) (-669.468) [-668.959] -- 0:00:38
353500 -- (-669.139) (-669.030) (-670.664) [-668.930] * [-670.207] (-673.276) (-669.278) (-670.603) -- 0:00:38
354000 -- (-670.072) (-671.908) (-668.184) [-668.624] * (-667.695) (-667.288) (-668.030) [-669.682] -- 0:00:40
354500 -- (-671.307) (-671.844) (-669.190) [-668.811] * (-667.899) [-666.992] (-667.837) (-669.762) -- 0:00:40
355000 -- (-670.719) [-667.267] (-669.152) (-671.861) * [-670.026] (-668.634) (-670.957) (-668.858) -- 0:00:39
Average standard deviation of split frequencies: 0.009711
355500 -- (-670.653) (-669.799) [-668.940] (-670.003) * (-672.028) (-671.195) [-669.118] (-669.132) -- 0:00:39
356000 -- (-668.665) [-671.263] (-669.214) (-669.292) * (-668.531) [-671.752] (-670.619) (-668.884) -- 0:00:39
356500 -- (-669.764) (-669.090) [-668.559] (-669.858) * (-668.623) [-673.182] (-668.110) (-667.262) -- 0:00:39
357000 -- (-667.693) (-668.852) (-667.747) [-669.168] * (-668.166) (-670.850) [-668.296] (-667.445) -- 0:00:39
357500 -- (-667.997) (-667.897) (-667.773) [-669.656] * [-667.519] (-667.878) (-667.103) (-667.503) -- 0:00:39
358000 -- (-671.991) [-667.881] (-667.870) (-672.563) * (-669.442) (-667.336) (-668.424) [-667.874] -- 0:00:39
358500 -- (-667.488) [-672.345] (-668.250) (-674.738) * (-669.306) (-668.624) [-668.762] (-675.758) -- 0:00:39
359000 -- [-667.519] (-669.902) (-668.944) (-670.695) * [-667.800] (-670.706) (-672.184) (-672.308) -- 0:00:39
359500 -- (-668.983) [-671.169] (-667.572) (-671.219) * (-667.812) (-668.189) (-668.489) [-672.328] -- 0:00:39
360000 -- (-668.789) (-668.539) [-668.802] (-667.131) * (-668.559) (-668.214) [-668.689] (-670.036) -- 0:00:39
Average standard deviation of split frequencies: 0.011400
360500 -- (-668.248) [-667.850] (-671.011) (-670.094) * [-672.814] (-668.952) (-668.040) (-667.816) -- 0:00:39
361000 -- [-668.916] (-669.188) (-669.612) (-670.864) * (-670.745) (-671.539) [-671.011] (-669.546) -- 0:00:38
361500 -- (-671.069) [-667.979] (-667.974) (-669.472) * (-666.715) (-671.229) (-668.422) [-668.285] -- 0:00:38
362000 -- [-667.212] (-667.678) (-669.336) (-667.517) * [-667.159] (-671.398) (-669.703) (-670.751) -- 0:00:38
362500 -- (-668.244) (-671.612) [-668.892] (-667.892) * [-672.634] (-672.574) (-669.364) (-669.241) -- 0:00:38
363000 -- (-669.115) (-668.048) (-671.597) [-667.296] * [-668.542] (-673.221) (-670.888) (-668.004) -- 0:00:38
363500 -- (-669.441) (-667.617) [-668.345] (-670.779) * [-669.407] (-669.251) (-668.603) (-668.242) -- 0:00:38
364000 -- (-669.014) [-666.941] (-668.109) (-669.871) * (-668.335) [-673.301] (-671.357) (-670.318) -- 0:00:38
364500 -- (-668.991) (-666.961) (-669.429) [-671.541] * [-669.934] (-667.968) (-670.263) (-670.319) -- 0:00:38
365000 -- (-671.980) [-667.636] (-667.009) (-668.508) * [-669.209] (-668.435) (-670.654) (-668.023) -- 0:00:38
Average standard deviation of split frequencies: 0.011449
365500 -- (-670.418) (-671.053) (-668.716) [-668.907] * (-670.044) (-668.282) (-671.667) [-668.091] -- 0:00:38
366000 -- [-668.615] (-670.496) (-669.347) (-674.631) * [-669.227] (-667.602) (-668.303) (-668.339) -- 0:00:38
366500 -- [-668.684] (-671.503) (-667.287) (-675.063) * [-667.536] (-668.234) (-668.595) (-672.572) -- 0:00:38
367000 -- (-673.375) [-666.862] (-667.864) (-672.578) * (-669.615) [-669.160] (-667.223) (-667.102) -- 0:00:37
367500 -- (-669.757) [-667.876] (-670.479) (-668.927) * (-668.236) [-670.795] (-669.346) (-670.465) -- 0:00:37
368000 -- (-670.371) (-668.467) (-672.872) [-672.153] * (-666.988) (-671.323) [-667.734] (-669.757) -- 0:00:37
368500 -- [-669.096] (-670.055) (-671.871) (-669.232) * (-667.819) (-675.309) [-667.701] (-671.992) -- 0:00:37
369000 -- (-671.535) (-667.328) [-668.474] (-669.162) * (-668.207) (-669.572) [-667.141] (-671.259) -- 0:00:37
369500 -- (-667.452) (-670.861) (-672.626) [-669.150] * (-668.468) (-669.845) [-670.873] (-667.948) -- 0:00:37
370000 -- (-670.250) (-675.008) [-669.476] (-671.758) * (-666.984) [-670.230] (-667.068) (-667.704) -- 0:00:39
Average standard deviation of split frequencies: 0.011305
370500 -- (-666.920) (-674.706) (-671.567) [-668.355] * [-667.993] (-668.021) (-667.533) (-668.181) -- 0:00:39
371000 -- (-668.758) [-667.756] (-670.744) (-669.600) * (-670.747) (-667.765) [-668.567] (-670.592) -- 0:00:38
371500 -- (-669.554) (-667.788) (-669.236) [-669.036] * (-671.052) (-668.854) [-667.124] (-667.713) -- 0:00:38
372000 -- (-668.446) (-672.405) [-668.126] (-667.915) * [-668.298] (-667.392) (-666.874) (-669.002) -- 0:00:38
372500 -- (-667.773) (-669.172) [-669.960] (-670.747) * (-670.324) (-670.061) [-667.229] (-668.703) -- 0:00:38
373000 -- (-669.331) (-668.168) (-670.764) [-668.816] * [-674.539] (-670.010) (-669.083) (-669.552) -- 0:00:38
373500 -- (-667.613) (-669.172) (-669.992) [-669.323] * (-671.163) (-670.983) (-671.266) [-671.350] -- 0:00:38
374000 -- (-666.866) [-669.495] (-671.764) (-672.837) * (-671.017) [-674.507] (-667.287) (-667.553) -- 0:00:38
374500 -- [-666.973] (-668.131) (-670.682) (-668.390) * (-668.859) (-670.035) (-671.324) [-667.783] -- 0:00:38
375000 -- [-667.626] (-668.738) (-668.140) (-667.441) * [-668.624] (-668.548) (-669.468) (-670.004) -- 0:00:38
Average standard deviation of split frequencies: 0.012169
375500 -- (-669.699) [-670.319] (-668.009) (-669.903) * [-669.519] (-668.423) (-668.633) (-673.375) -- 0:00:38
376000 -- (-668.151) (-669.904) [-672.457] (-672.058) * (-667.194) [-667.907] (-668.111) (-668.739) -- 0:00:38
376500 -- (-668.512) (-668.318) (-673.132) [-672.672] * [-667.677] (-670.466) (-667.760) (-676.759) -- 0:00:38
377000 -- [-668.127] (-667.505) (-667.874) (-674.078) * (-667.479) [-676.089] (-669.533) (-669.433) -- 0:00:38
377500 -- (-668.755) (-670.172) [-669.068] (-668.651) * (-668.162) [-672.246] (-669.508) (-666.996) -- 0:00:37
378000 -- (-670.213) [-668.230] (-668.420) (-671.469) * [-669.252] (-673.691) (-670.238) (-669.168) -- 0:00:37
378500 -- (-668.619) (-668.667) [-670.490] (-671.034) * (-667.881) (-669.184) (-670.057) [-668.905] -- 0:00:37
379000 -- (-668.632) (-670.106) (-669.319) [-668.515] * (-670.053) (-671.423) [-667.706] (-668.665) -- 0:00:37
379500 -- (-668.782) (-670.439) (-674.054) [-672.320] * (-670.059) [-670.439] (-668.108) (-671.145) -- 0:00:37
380000 -- (-669.520) [-666.825] (-669.545) (-670.220) * (-667.962) [-668.363] (-669.705) (-668.554) -- 0:00:37
Average standard deviation of split frequencies: 0.013158
380500 -- (-670.175) (-666.827) [-673.283] (-671.062) * (-668.432) [-668.808] (-667.949) (-666.895) -- 0:00:37
381000 -- (-670.426) (-667.774) (-669.978) [-670.399] * (-669.605) [-666.909] (-672.583) (-668.905) -- 0:00:37
381500 -- [-669.296] (-671.116) (-669.662) (-671.222) * (-669.253) (-668.031) (-670.323) [-669.637] -- 0:00:37
382000 -- (-667.339) (-668.010) (-668.282) [-671.270] * (-670.898) [-669.927] (-668.940) (-669.372) -- 0:00:37
382500 -- [-668.316] (-668.404) (-670.386) (-669.554) * (-669.198) (-670.101) [-667.472] (-668.566) -- 0:00:37
383000 -- (-670.787) [-666.869] (-668.610) (-668.907) * (-669.673) (-668.058) [-667.094] (-670.119) -- 0:00:37
383500 -- (-669.636) [-667.735] (-668.637) (-670.984) * (-669.290) (-669.473) [-667.274] (-670.410) -- 0:00:36
384000 -- [-668.594] (-667.145) (-667.773) (-670.577) * (-669.500) (-668.928) [-674.714] (-672.612) -- 0:00:36
384500 -- (-672.494) [-671.477] (-670.128) (-666.716) * (-668.035) [-669.889] (-675.668) (-668.847) -- 0:00:36
385000 -- (-668.331) (-676.572) (-670.899) [-667.610] * [-668.970] (-669.906) (-671.537) (-670.869) -- 0:00:36
Average standard deviation of split frequencies: 0.012959
385500 -- (-668.220) (-671.200) (-667.915) [-668.787] * (-668.115) (-668.318) (-668.975) [-668.874] -- 0:00:36
386000 -- (-667.555) (-674.820) [-668.490] (-667.104) * (-669.025) (-667.797) [-668.615] (-670.046) -- 0:00:36
386500 -- (-668.924) (-668.830) [-672.164] (-668.028) * (-672.351) (-668.122) [-671.948] (-670.188) -- 0:00:38
387000 -- (-669.127) [-670.268] (-672.704) (-671.890) * (-670.430) (-667.414) [-673.907] (-668.859) -- 0:00:38
387500 -- (-671.986) (-670.166) [-667.984] (-670.915) * (-669.886) [-669.786] (-670.592) (-671.701) -- 0:00:37
388000 -- (-668.089) (-668.595) [-669.486] (-670.494) * (-673.398) [-669.475] (-667.775) (-673.127) -- 0:00:37
388500 -- (-667.082) (-666.743) [-669.586] (-669.213) * [-668.124] (-667.826) (-667.542) (-671.858) -- 0:00:37
389000 -- (-668.132) (-668.314) [-668.965] (-671.239) * (-667.299) (-668.459) (-667.289) [-668.702] -- 0:00:37
389500 -- (-671.140) (-668.210) [-668.745] (-667.988) * (-670.247) (-669.918) (-669.462) [-668.254] -- 0:00:37
390000 -- (-668.540) [-669.274] (-668.300) (-670.007) * (-671.805) (-670.242) [-668.422] (-667.705) -- 0:00:37
Average standard deviation of split frequencies: 0.012536
390500 -- (-667.373) (-670.651) [-667.454] (-672.663) * (-668.018) (-669.471) (-666.899) [-671.312] -- 0:00:37
391000 -- (-670.348) [-671.685] (-668.288) (-672.312) * [-667.336] (-667.579) (-667.140) (-670.342) -- 0:00:37
391500 -- [-667.761] (-670.439) (-668.077) (-670.101) * (-667.522) (-668.387) (-667.117) [-669.942] -- 0:00:37
392000 -- [-668.526] (-668.239) (-668.721) (-669.414) * (-670.321) [-669.700] (-668.024) (-670.085) -- 0:00:37
392500 -- [-667.920] (-670.054) (-669.825) (-669.965) * (-672.023) [-666.844] (-667.338) (-668.265) -- 0:00:37
393000 -- (-668.082) (-667.142) (-668.201) [-672.579] * (-667.121) (-667.899) [-669.192] (-668.610) -- 0:00:37
393500 -- (-667.293) [-667.938] (-670.978) (-668.718) * (-669.286) (-668.040) [-669.028] (-669.431) -- 0:00:36
394000 -- (-668.372) [-668.131] (-667.051) (-670.207) * (-669.520) (-668.389) (-668.157) [-668.515] -- 0:00:36
394500 -- (-667.312) (-669.386) (-672.698) [-668.132] * (-667.866) [-667.606] (-668.139) (-670.158) -- 0:00:36
395000 -- (-668.285) (-669.559) (-667.481) [-667.451] * [-667.448] (-668.615) (-670.474) (-672.780) -- 0:00:36
Average standard deviation of split frequencies: 0.012394
395500 -- (-668.737) (-670.689) (-668.851) [-667.858] * (-674.573) (-667.006) (-669.267) [-671.065] -- 0:00:36
396000 -- (-667.226) (-669.988) [-670.007] (-667.877) * (-673.969) (-666.506) [-667.578] (-673.284) -- 0:00:36
396500 -- (-667.505) (-669.155) (-672.348) [-668.433] * [-673.206] (-670.837) (-669.796) (-669.005) -- 0:00:36
397000 -- (-668.179) (-667.778) (-671.429) [-669.848] * (-669.894) (-667.633) [-671.643] (-667.871) -- 0:00:36
397500 -- [-666.766] (-669.383) (-670.134) (-671.727) * (-668.790) (-668.147) (-669.064) [-668.006] -- 0:00:36
398000 -- (-666.678) [-667.914] (-671.313) (-669.990) * (-671.247) (-674.978) (-670.898) [-667.564] -- 0:00:36
398500 -- [-667.237] (-668.785) (-668.089) (-666.669) * (-667.668) [-672.905] (-667.953) (-667.545) -- 0:00:36
399000 -- (-668.569) (-668.427) (-671.258) [-667.451] * [-669.034] (-668.952) (-667.057) (-667.622) -- 0:00:36
399500 -- (-668.080) (-667.380) (-667.265) [-668.069] * (-667.318) (-668.117) [-668.299] (-667.421) -- 0:00:36
400000 -- [-676.657] (-671.244) (-667.431) (-668.968) * (-667.753) [-666.869] (-669.221) (-666.966) -- 0:00:36
Average standard deviation of split frequencies: 0.012681
400500 -- (-668.635) (-670.347) [-667.766] (-670.608) * (-667.936) (-667.972) [-668.168] (-667.602) -- 0:00:35
401000 -- (-669.128) (-672.141) (-667.380) [-669.316] * (-673.593) [-668.258] (-667.168) (-669.092) -- 0:00:35
401500 -- (-669.290) (-670.257) [-669.233] (-667.176) * (-667.447) [-669.037] (-671.876) (-668.779) -- 0:00:35
402000 -- (-671.416) (-670.993) (-672.743) [-670.463] * (-669.043) (-667.939) [-667.552] (-670.623) -- 0:00:35
402500 -- (-668.810) (-668.120) [-668.476] (-672.309) * [-669.192] (-673.066) (-668.094) (-668.942) -- 0:00:35
403000 -- [-669.550] (-670.341) (-669.361) (-672.481) * [-669.422] (-673.407) (-667.161) (-668.609) -- 0:00:37
403500 -- (-669.131) (-669.752) [-668.596] (-670.021) * (-668.334) [-667.253] (-675.006) (-668.003) -- 0:00:36
404000 -- (-667.816) (-668.966) (-669.875) [-668.612] * [-668.382] (-668.416) (-667.678) (-668.019) -- 0:00:36
404500 -- (-666.757) (-670.664) (-668.736) [-669.561] * (-667.582) [-667.706] (-671.006) (-668.028) -- 0:00:36
405000 -- (-668.106) [-667.827] (-667.893) (-670.298) * (-668.050) [-668.007] (-669.971) (-668.783) -- 0:00:36
Average standard deviation of split frequencies: 0.012222
405500 -- (-667.424) (-669.796) (-671.612) [-669.105] * [-674.792] (-667.752) (-671.605) (-669.048) -- 0:00:36
406000 -- (-668.571) (-667.634) [-669.511] (-669.658) * (-672.205) [-669.207] (-668.617) (-668.595) -- 0:00:36
406500 -- (-670.243) (-671.101) (-667.567) [-672.163] * (-672.240) [-667.517] (-669.293) (-672.582) -- 0:00:36
407000 -- (-669.478) (-671.996) (-667.550) [-670.297] * [-671.858] (-670.472) (-667.959) (-673.366) -- 0:00:36
407500 -- (-670.179) (-670.498) [-668.422] (-667.820) * (-668.817) [-669.845] (-666.946) (-672.453) -- 0:00:36
408000 -- (-670.234) (-671.816) (-667.931) [-668.668] * [-667.927] (-667.898) (-672.516) (-670.365) -- 0:00:36
408500 -- (-667.789) [-669.418] (-670.345) (-667.572) * (-668.339) (-668.181) (-667.930) [-666.923] -- 0:00:36
409000 -- (-669.828) [-669.319] (-668.057) (-668.931) * (-668.287) (-668.758) [-668.039] (-668.280) -- 0:00:36
409500 -- (-669.672) (-667.503) [-671.971] (-667.862) * (-669.613) (-668.247) (-668.086) [-669.537] -- 0:00:36
410000 -- (-670.726) (-669.064) [-669.181] (-669.109) * (-667.714) [-667.738] (-668.035) (-668.025) -- 0:00:35
Average standard deviation of split frequencies: 0.012446
410500 -- [-670.499] (-669.274) (-668.641) (-674.915) * (-671.626) (-667.256) (-668.462) [-670.181] -- 0:00:35
411000 -- (-673.870) (-668.403) (-670.029) [-669.676] * (-676.396) (-668.012) [-669.470] (-669.368) -- 0:00:35
411500 -- (-669.505) (-671.251) (-668.915) [-669.522] * (-669.249) (-668.080) (-669.049) [-669.639] -- 0:00:35
412000 -- (-669.593) (-667.916) [-668.511] (-670.671) * (-676.959) (-669.017) [-668.530] (-669.602) -- 0:00:35
412500 -- (-670.790) [-669.519] (-670.970) (-670.247) * (-674.062) [-670.692] (-672.482) (-669.774) -- 0:00:35
413000 -- (-671.710) [-668.046] (-669.027) (-669.204) * (-669.895) (-670.823) (-670.418) [-670.249] -- 0:00:35
413500 -- [-670.443] (-670.716) (-670.344) (-671.822) * (-670.675) (-670.533) [-668.285] (-669.442) -- 0:00:35
414000 -- (-669.944) (-671.961) [-669.132] (-667.013) * (-667.916) (-669.956) (-672.116) [-669.955] -- 0:00:35
414500 -- (-667.564) (-668.767) (-667.946) [-667.180] * [-671.125] (-668.235) (-669.482) (-667.818) -- 0:00:35
415000 -- (-668.323) (-671.298) (-668.590) [-668.556] * (-669.274) (-669.547) [-669.554] (-668.210) -- 0:00:35
Average standard deviation of split frequencies: 0.012865
415500 -- (-667.699) (-671.376) (-669.565) [-671.289] * (-668.577) (-671.739) [-668.736] (-668.711) -- 0:00:35
416000 -- (-669.911) (-669.893) [-670.400] (-671.733) * (-669.729) (-670.581) [-666.975] (-669.569) -- 0:00:35
416500 -- (-670.651) (-668.289) (-668.226) [-667.425] * (-670.804) (-671.671) [-668.049] (-672.374) -- 0:00:35
417000 -- (-672.197) (-668.368) [-668.313] (-667.198) * (-667.237) (-672.055) (-668.736) [-668.896] -- 0:00:34
417500 -- (-673.756) (-669.506) [-669.437] (-668.194) * (-668.136) [-669.237] (-668.678) (-668.223) -- 0:00:34
418000 -- (-670.089) (-667.932) (-669.467) [-668.663] * (-669.036) (-667.349) [-669.127] (-667.950) -- 0:00:34
418500 -- (-669.041) (-669.369) [-667.169] (-668.536) * [-666.863] (-670.272) (-670.004) (-669.990) -- 0:00:34
419000 -- (-667.728) (-667.475) [-668.456] (-671.084) * [-667.916] (-667.073) (-669.042) (-670.926) -- 0:00:34
419500 -- [-670.267] (-672.171) (-667.571) (-669.575) * [-667.524] (-667.662) (-670.221) (-669.800) -- 0:00:34
420000 -- (-668.948) (-672.132) [-669.442] (-670.023) * (-668.166) (-668.076) [-672.723] (-670.068) -- 0:00:35
Average standard deviation of split frequencies: 0.012788
420500 -- (-667.309) [-671.749] (-671.303) (-670.757) * (-669.405) [-667.789] (-666.904) (-669.426) -- 0:00:35
421000 -- (-666.920) (-670.672) (-669.829) [-668.241] * [-667.891] (-667.454) (-667.487) (-668.296) -- 0:00:35
421500 -- (-672.479) (-676.747) [-667.958] (-668.795) * [-667.832] (-668.687) (-667.357) (-671.617) -- 0:00:35
422000 -- (-667.297) (-674.629) [-667.400] (-668.588) * [-667.805] (-669.823) (-668.132) (-667.891) -- 0:00:35
422500 -- [-669.108] (-669.851) (-668.373) (-670.127) * (-667.237) (-668.636) (-669.712) [-671.338] -- 0:00:35
423000 -- (-669.359) [-669.582] (-668.367) (-671.717) * (-670.547) (-669.892) [-668.913] (-670.273) -- 0:00:35
423500 -- (-670.888) (-669.630) [-669.477] (-674.054) * (-667.487) [-669.710] (-671.218) (-669.007) -- 0:00:35
424000 -- [-668.210] (-671.121) (-668.192) (-670.403) * (-667.677) [-668.413] (-670.346) (-666.795) -- 0:00:35
424500 -- [-667.528] (-667.906) (-669.051) (-669.494) * (-667.297) (-669.406) [-668.438] (-667.693) -- 0:00:35
425000 -- (-669.535) [-666.888] (-667.481) (-668.263) * (-673.807) (-668.683) [-669.809] (-668.943) -- 0:00:35
Average standard deviation of split frequencies: 0.013279
425500 -- [-668.108] (-668.414) (-667.010) (-667.555) * (-667.089) (-669.763) (-672.314) [-669.661] -- 0:00:35
426000 -- (-668.338) (-671.339) (-669.256) [-669.396] * (-668.515) [-671.020] (-669.154) (-667.451) -- 0:00:35
426500 -- (-667.255) (-668.285) (-670.003) [-667.722] * [-667.018] (-668.017) (-669.295) (-667.885) -- 0:00:34
427000 -- (-669.130) [-670.333] (-676.518) (-667.905) * (-672.477) [-668.579] (-669.739) (-666.934) -- 0:00:34
427500 -- (-670.931) (-671.056) (-669.618) [-670.133] * (-669.309) (-668.625) (-668.583) [-667.176] -- 0:00:34
428000 -- (-668.902) (-667.939) (-668.530) [-668.943] * (-670.387) [-666.757] (-668.849) (-667.362) -- 0:00:34
428500 -- [-668.114] (-669.176) (-670.313) (-668.287) * (-667.232) (-671.005) (-669.260) [-666.793] -- 0:00:34
429000 -- (-667.503) (-669.415) (-669.340) [-667.185] * (-667.560) (-668.028) (-667.658) [-667.248] -- 0:00:34
429500 -- (-667.937) (-671.609) (-669.191) [-667.829] * (-668.004) (-668.211) [-667.206] (-668.835) -- 0:00:34
430000 -- (-670.106) (-667.765) [-671.545] (-668.450) * (-667.696) (-670.548) (-668.801) [-669.272] -- 0:00:34
Average standard deviation of split frequencies: 0.013071
430500 -- (-669.198) (-669.341) [-667.937] (-671.013) * (-668.164) (-668.876) [-671.886] (-668.256) -- 0:00:34
431000 -- (-671.106) (-667.477) (-669.138) [-671.653] * (-667.010) [-668.350] (-671.813) (-667.446) -- 0:00:34
431500 -- [-669.706] (-667.603) (-674.417) (-672.464) * [-666.596] (-667.661) (-667.527) (-669.977) -- 0:00:34
432000 -- [-671.016] (-673.977) (-673.976) (-674.322) * (-667.150) (-666.837) (-669.192) [-669.554] -- 0:00:34
432500 -- [-668.714] (-671.820) (-669.368) (-667.457) * [-667.548] (-668.215) (-667.815) (-667.304) -- 0:00:34
433000 -- (-670.314) (-668.439) (-670.094) [-667.828] * (-669.401) (-668.668) (-669.108) [-667.416] -- 0:00:34
433500 -- [-668.495] (-674.339) (-668.729) (-668.013) * (-667.646) (-671.522) [-667.274] (-671.330) -- 0:00:33
434000 -- (-668.434) (-670.135) [-668.110] (-669.419) * [-669.891] (-668.142) (-670.813) (-670.323) -- 0:00:33
434500 -- [-666.899] (-667.659) (-670.013) (-666.483) * [-669.062] (-669.596) (-668.468) (-669.249) -- 0:00:33
435000 -- (-667.154) (-667.269) (-670.576) [-667.835] * (-669.758) [-670.141] (-670.812) (-667.904) -- 0:00:33
Average standard deviation of split frequencies: 0.013229
435500 -- (-667.163) [-669.004] (-668.514) (-671.449) * [-669.473] (-671.265) (-668.564) (-667.077) -- 0:00:33
436000 -- (-666.858) [-667.553] (-669.041) (-667.085) * [-669.115] (-669.649) (-670.411) (-667.969) -- 0:00:33
436500 -- [-668.910] (-668.672) (-671.500) (-668.430) * [-667.075] (-672.021) (-667.582) (-668.457) -- 0:00:34
437000 -- (-668.592) (-671.659) [-671.992] (-667.372) * (-671.169) (-668.666) (-672.481) [-668.166] -- 0:00:34
437500 -- (-667.022) [-669.475] (-669.678) (-669.929) * (-675.086) (-671.335) [-668.707] (-669.468) -- 0:00:34
438000 -- [-668.374] (-667.736) (-668.794) (-667.641) * (-669.778) (-667.729) (-668.215) [-667.836] -- 0:00:34
438500 -- (-667.895) (-668.790) (-668.213) [-669.074] * (-672.120) (-668.754) (-668.474) [-669.043] -- 0:00:34
439000 -- (-669.125) [-667.827] (-670.855) (-668.418) * (-668.615) (-668.214) (-671.191) [-666.993] -- 0:00:34
439500 -- (-669.932) [-668.038] (-668.167) (-667.922) * (-670.997) (-677.233) [-671.456] (-668.220) -- 0:00:34
440000 -- (-674.006) (-670.657) [-669.055] (-667.045) * [-666.940] (-673.065) (-671.387) (-669.656) -- 0:00:34
Average standard deviation of split frequencies: 0.012837
440500 -- [-671.689] (-669.655) (-669.697) (-672.366) * (-668.204) (-668.514) (-670.918) [-669.625] -- 0:00:34
441000 -- (-668.602) (-670.958) [-668.486] (-671.142) * (-667.962) [-667.689] (-670.854) (-669.564) -- 0:00:34
441500 -- (-669.051) [-669.538] (-669.941) (-670.504) * (-667.555) (-667.399) [-673.655] (-669.356) -- 0:00:34
442000 -- (-666.556) (-667.709) (-668.196) [-668.918] * (-672.276) (-672.984) (-669.681) [-666.989] -- 0:00:34
442500 -- (-669.160) (-669.131) (-671.144) [-672.905] * [-668.744] (-671.018) (-667.379) (-667.276) -- 0:00:34
443000 -- [-667.463] (-670.109) (-670.644) (-672.944) * (-672.562) (-669.089) (-673.082) [-668.481] -- 0:00:33
443500 -- (-667.819) (-668.833) [-670.856] (-670.076) * (-671.814) (-670.537) (-668.185) [-672.239] -- 0:00:33
444000 -- (-668.101) (-668.249) [-670.092] (-671.124) * (-669.887) (-670.949) [-669.060] (-668.869) -- 0:00:33
444500 -- (-673.033) (-669.240) (-670.209) [-668.100] * (-671.919) (-670.545) [-668.058] (-667.837) -- 0:00:33
445000 -- (-674.922) [-669.232] (-670.021) (-668.284) * (-670.522) (-668.612) [-669.061] (-667.405) -- 0:00:33
Average standard deviation of split frequencies: 0.012559
445500 -- (-670.119) (-669.899) [-667.409] (-670.225) * (-673.068) [-674.083] (-668.140) (-668.874) -- 0:00:33
446000 -- (-671.857) (-673.167) [-668.880] (-668.335) * (-668.402) (-668.562) [-669.057] (-668.753) -- 0:00:33
446500 -- (-674.014) (-667.262) (-669.673) [-668.345] * (-669.493) [-672.636] (-669.058) (-667.640) -- 0:00:33
447000 -- (-668.246) [-669.276] (-668.675) (-670.593) * (-669.011) (-668.924) [-668.865] (-670.433) -- 0:00:33
447500 -- [-668.207] (-670.711) (-671.569) (-671.361) * (-668.840) (-666.675) [-668.326] (-671.235) -- 0:00:33
448000 -- (-668.712) (-669.591) (-673.326) [-669.345] * (-669.671) (-669.832) [-669.695] (-671.839) -- 0:00:33
448500 -- [-668.270] (-669.727) (-668.217) (-668.998) * [-670.235] (-667.871) (-671.283) (-669.941) -- 0:00:33
449000 -- (-668.410) (-671.309) [-667.468] (-670.460) * (-667.134) (-667.976) [-667.021] (-675.636) -- 0:00:33
449500 -- (-668.102) (-669.015) [-667.474] (-668.357) * (-668.730) (-667.931) [-669.345] (-670.238) -- 0:00:33
450000 -- (-668.111) (-676.001) (-667.396) [-667.667] * [-669.724] (-673.525) (-671.335) (-668.351) -- 0:00:33
Average standard deviation of split frequencies: 0.012614
450500 -- (-670.066) (-668.870) [-666.659] (-667.679) * [-668.269] (-671.794) (-667.564) (-667.509) -- 0:00:32
451000 -- (-672.078) (-667.585) [-670.918] (-669.516) * (-668.100) (-668.433) [-669.888] (-667.611) -- 0:00:32
451500 -- (-670.640) (-671.560) [-670.175] (-672.364) * (-668.774) (-671.003) [-670.914] (-668.399) -- 0:00:32
452000 -- (-668.334) (-669.299) [-669.568] (-671.297) * (-667.087) [-667.226] (-673.206) (-668.582) -- 0:00:32
452500 -- (-670.250) (-669.947) (-673.038) [-670.435] * (-670.012) [-670.487] (-668.239) (-667.852) -- 0:00:32
453000 -- (-669.557) [-668.571] (-669.739) (-668.865) * (-668.698) [-669.920] (-670.337) (-668.616) -- 0:00:33
453500 -- (-669.181) (-669.896) (-667.675) [-667.691] * (-669.485) [-670.516] (-668.703) (-668.906) -- 0:00:33
454000 -- [-670.107] (-668.712) (-670.938) (-667.254) * (-670.439) [-671.472] (-668.162) (-667.294) -- 0:00:33
454500 -- [-670.049] (-668.177) (-668.077) (-668.691) * (-670.718) [-672.188] (-668.165) (-668.678) -- 0:00:33
455000 -- (-670.420) (-668.311) (-668.906) [-667.190] * [-670.099] (-674.559) (-666.941) (-668.699) -- 0:00:33
Average standard deviation of split frequencies: 0.013375
455500 -- (-668.521) [-670.212] (-669.211) (-666.978) * (-667.794) (-668.036) (-670.386) [-667.941] -- 0:00:33
456000 -- (-671.274) [-669.050] (-667.048) (-670.181) * (-669.759) [-668.360] (-668.783) (-668.841) -- 0:00:33
456500 -- [-668.122] (-668.809) (-667.491) (-669.323) * [-668.059] (-668.557) (-668.147) (-668.614) -- 0:00:33
457000 -- [-666.975] (-668.870) (-670.210) (-668.343) * (-669.358) (-668.750) [-668.719] (-670.880) -- 0:00:33
457500 -- (-667.918) [-668.327] (-668.814) (-669.121) * (-673.358) (-672.519) (-668.274) [-668.712] -- 0:00:33
458000 -- (-668.649) [-669.125] (-668.427) (-668.525) * (-673.421) [-670.892] (-666.888) (-669.035) -- 0:00:33
458500 -- (-669.978) (-669.173) [-669.168] (-669.045) * (-670.309) (-672.919) (-669.592) [-669.974] -- 0:00:33
459000 -- (-669.222) (-667.271) [-669.427] (-667.779) * (-668.529) (-669.268) (-669.475) [-669.165] -- 0:00:33
459500 -- (-669.295) (-667.522) [-668.166] (-667.759) * (-668.197) (-669.018) (-670.699) [-672.444] -- 0:00:32
460000 -- (-667.329) [-668.442] (-669.716) (-670.380) * (-667.060) [-669.282] (-668.119) (-669.762) -- 0:00:32
Average standard deviation of split frequencies: 0.013367
460500 -- (-667.918) [-668.513] (-670.764) (-668.149) * (-667.606) (-669.187) [-667.347] (-667.021) -- 0:00:32
461000 -- [-669.182] (-668.969) (-669.790) (-668.017) * (-667.775) (-670.267) (-669.711) [-668.118] -- 0:00:32
461500 -- (-668.867) (-668.044) [-668.509] (-668.632) * [-668.467] (-668.796) (-667.063) (-670.753) -- 0:00:32
462000 -- (-671.365) [-669.470] (-668.581) (-672.285) * [-667.311] (-667.909) (-670.801) (-669.056) -- 0:00:32
462500 -- [-671.158] (-671.486) (-669.134) (-669.055) * (-667.012) (-670.783) [-670.750] (-668.144) -- 0:00:32
463000 -- (-672.721) (-667.692) [-667.467] (-671.208) * [-669.012] (-667.784) (-668.035) (-667.216) -- 0:00:32
463500 -- [-668.930] (-667.191) (-667.944) (-667.387) * (-669.097) [-669.777] (-672.850) (-667.850) -- 0:00:32
464000 -- (-668.926) (-667.830) (-671.571) [-668.317] * (-671.825) [-669.156] (-671.206) (-669.441) -- 0:00:32
464500 -- [-668.885] (-668.295) (-670.047) (-667.961) * (-670.875) (-670.322) (-671.468) [-668.548] -- 0:00:32
465000 -- (-673.363) [-669.925] (-666.575) (-668.055) * (-670.057) (-668.049) (-671.314) [-669.856] -- 0:00:32
Average standard deviation of split frequencies: 0.014099
465500 -- (-669.346) (-670.033) (-670.400) [-668.312] * (-671.376) (-672.804) (-669.049) [-669.956] -- 0:00:32
466000 -- [-667.023] (-669.711) (-669.360) (-667.581) * (-672.975) (-668.579) (-668.719) [-669.417] -- 0:00:32
466500 -- (-668.772) (-672.557) (-668.720) [-668.279] * [-667.465] (-666.899) (-668.705) (-667.787) -- 0:00:32
467000 -- (-668.033) (-670.367) (-669.299) [-669.205] * (-671.901) (-667.713) [-666.970] (-669.185) -- 0:00:31
467500 -- [-668.332] (-669.858) (-669.242) (-668.771) * (-669.663) (-670.720) (-668.593) [-668.140] -- 0:00:31
468000 -- (-668.504) (-667.786) (-667.701) [-669.705] * (-669.574) (-667.629) [-668.493] (-670.151) -- 0:00:31
468500 -- (-668.601) (-669.633) [-666.829] (-667.754) * (-668.046) (-672.052) (-667.824) [-669.588] -- 0:00:31
469000 -- (-669.474) (-670.668) (-667.189) [-668.443] * [-667.532] (-671.124) (-670.161) (-670.057) -- 0:00:31
469500 -- (-667.706) (-667.403) [-668.178] (-670.098) * [-669.464] (-669.680) (-671.644) (-667.532) -- 0:00:31
470000 -- (-671.292) (-669.872) (-670.508) [-667.369] * [-668.278] (-668.760) (-670.065) (-668.372) -- 0:00:32
Average standard deviation of split frequencies: 0.013897
470500 -- (-670.375) (-668.325) [-669.153] (-669.114) * (-668.893) (-670.292) (-667.667) [-667.393] -- 0:00:32
471000 -- (-669.925) (-674.810) (-672.353) [-667.134] * (-667.529) [-667.215] (-667.699) (-668.132) -- 0:00:32
471500 -- (-669.799) (-673.399) [-673.984] (-668.579) * (-667.382) [-669.167] (-667.165) (-667.553) -- 0:00:32
472000 -- (-669.694) [-669.855] (-669.829) (-668.778) * (-671.559) (-668.192) (-668.504) [-666.988] -- 0:00:32
472500 -- [-667.069] (-668.635) (-667.703) (-668.704) * (-672.768) (-668.839) (-669.707) [-669.180] -- 0:00:32
473000 -- (-667.771) [-668.677] (-667.452) (-669.775) * [-671.741] (-669.555) (-672.610) (-668.184) -- 0:00:32
473500 -- (-669.253) (-667.155) (-668.326) [-668.989] * [-672.062] (-670.567) (-670.463) (-669.345) -- 0:00:32
474000 -- (-666.757) (-671.207) [-668.500] (-667.540) * (-670.226) (-667.788) [-673.861] (-668.057) -- 0:00:32
474500 -- (-670.222) [-666.987] (-675.020) (-668.249) * (-670.681) (-668.518) [-670.723] (-667.967) -- 0:00:32
475000 -- (-670.181) (-670.552) (-673.046) [-667.220] * (-668.779) (-669.771) (-671.939) [-668.995] -- 0:00:32
Average standard deviation of split frequencies: 0.014484
475500 -- (-668.246) (-668.113) (-670.913) [-667.220] * [-667.239] (-668.912) (-669.218) (-669.126) -- 0:00:31
476000 -- (-668.680) (-667.584) [-668.105] (-669.276) * (-669.719) [-669.296] (-669.135) (-668.507) -- 0:00:31
476500 -- (-669.874) (-667.233) [-669.598] (-667.872) * (-671.031) [-670.567] (-671.734) (-667.969) -- 0:00:31
477000 -- [-668.505] (-667.269) (-671.633) (-668.095) * [-675.071] (-668.022) (-669.903) (-669.472) -- 0:00:31
477500 -- (-670.471) (-668.500) (-668.875) [-669.587] * (-671.612) (-668.245) [-668.480] (-671.061) -- 0:00:31
478000 -- (-671.102) (-674.633) (-668.091) [-667.840] * (-669.075) (-670.255) (-667.597) [-667.138] -- 0:00:31
478500 -- (-668.245) (-670.292) [-668.362] (-668.728) * [-671.713] (-669.866) (-668.144) (-669.380) -- 0:00:31
479000 -- (-669.116) [-669.528] (-668.562) (-668.243) * [-668.412] (-671.598) (-667.157) (-670.144) -- 0:00:31
479500 -- (-668.613) (-672.240) (-667.258) [-667.875] * (-668.640) (-671.531) (-667.798) [-667.346] -- 0:00:31
480000 -- (-667.514) (-666.711) [-668.240] (-670.088) * [-668.337] (-668.446) (-668.239) (-668.489) -- 0:00:31
Average standard deviation of split frequencies: 0.013615
480500 -- (-670.442) (-668.048) [-666.743] (-667.667) * (-666.756) [-668.564] (-667.847) (-670.312) -- 0:00:31
481000 -- [-667.070] (-668.269) (-671.192) (-667.877) * [-667.577] (-673.156) (-667.813) (-667.471) -- 0:00:31
481500 -- (-669.625) [-669.023] (-670.223) (-669.426) * (-669.790) (-671.423) [-670.192] (-669.708) -- 0:00:31
482000 -- (-667.927) (-673.231) [-668.169] (-673.129) * (-669.781) (-673.480) (-671.265) [-668.204] -- 0:00:31
482500 -- (-668.562) (-668.760) [-670.724] (-669.213) * [-673.754] (-671.405) (-668.183) (-675.014) -- 0:00:31
483000 -- (-669.871) [-671.316] (-671.071) (-672.631) * (-669.264) [-666.787] (-669.122) (-670.300) -- 0:00:31
483500 -- [-669.717] (-668.379) (-670.593) (-669.899) * (-670.218) [-666.777] (-669.225) (-672.993) -- 0:00:30
484000 -- (-671.845) (-668.910) (-674.034) [-667.768] * [-669.407] (-667.943) (-674.266) (-672.534) -- 0:00:30
484500 -- (-667.597) [-669.463] (-671.307) (-667.102) * (-668.569) [-667.545] (-668.771) (-670.451) -- 0:00:30
485000 -- (-666.673) (-669.258) [-668.956] (-672.241) * (-669.146) (-667.923) (-668.984) [-671.217] -- 0:00:30
Average standard deviation of split frequencies: 0.013180
485500 -- (-667.364) [-673.688] (-669.626) (-670.342) * [-667.818] (-670.796) (-669.688) (-671.353) -- 0:00:30
486000 -- (-668.794) (-669.108) [-667.233] (-668.745) * [-666.786] (-667.636) (-670.001) (-668.908) -- 0:00:30
486500 -- [-669.490] (-669.499) (-667.845) (-671.169) * (-666.867) [-667.179] (-673.291) (-671.168) -- 0:00:31
487000 -- (-667.484) (-668.606) [-667.966] (-671.344) * (-667.586) (-666.955) [-668.242] (-669.220) -- 0:00:31
487500 -- (-668.783) [-669.428] (-668.324) (-670.008) * [-668.302] (-667.813) (-667.863) (-668.574) -- 0:00:31
488000 -- (-667.900) [-667.365] (-668.969) (-672.980) * (-667.013) (-670.000) [-667.905] (-668.084) -- 0:00:31
488500 -- (-675.678) (-667.863) (-668.920) [-671.916] * (-666.899) (-667.697) [-672.650] (-669.433) -- 0:00:31
489000 -- (-668.691) (-667.234) [-670.607] (-671.847) * (-668.609) (-674.786) [-667.575] (-669.017) -- 0:00:31
489500 -- [-666.641] (-667.064) (-667.923) (-670.210) * [-669.037] (-669.762) (-667.022) (-669.168) -- 0:00:31
490000 -- [-669.485] (-669.302) (-667.932) (-669.606) * (-668.735) (-667.449) (-667.721) [-669.864] -- 0:00:31
Average standard deviation of split frequencies: 0.012757
490500 -- [-668.291] (-668.953) (-668.122) (-669.530) * (-669.604) [-667.545] (-669.553) (-669.609) -- 0:00:31
491000 -- (-671.129) (-668.443) (-667.838) [-669.176] * (-668.262) (-670.304) [-668.178] (-671.279) -- 0:00:31
491500 -- (-668.824) [-667.735] (-669.552) (-667.768) * (-668.706) (-668.822) (-672.920) [-668.433] -- 0:00:31
492000 -- (-670.722) (-670.500) [-669.625] (-673.991) * (-669.218) [-670.715] (-671.364) (-667.403) -- 0:00:30
492500 -- [-667.955] (-668.599) (-670.432) (-673.680) * (-670.227) (-670.311) (-669.450) [-669.207] -- 0:00:30
493000 -- (-669.680) [-670.991] (-670.487) (-667.416) * (-668.049) (-667.523) (-667.093) [-669.047] -- 0:00:30
493500 -- (-668.689) (-672.272) (-667.974) [-668.323] * (-669.054) [-668.223] (-666.783) (-668.448) -- 0:00:30
494000 -- [-667.029] (-668.979) (-668.145) (-667.530) * (-668.492) (-669.647) [-669.362] (-667.546) -- 0:00:30
494500 -- (-669.430) [-669.117] (-667.762) (-668.683) * (-670.219) [-668.062] (-672.216) (-671.696) -- 0:00:30
495000 -- (-667.541) [-668.041] (-668.432) (-671.671) * (-667.610) (-668.271) [-670.416] (-672.478) -- 0:00:30
Average standard deviation of split frequencies: 0.012883
495500 -- (-672.428) [-668.096] (-668.864) (-670.869) * (-669.055) [-671.381] (-669.596) (-671.457) -- 0:00:30
496000 -- (-667.742) (-667.013) (-670.572) [-670.704] * [-668.820] (-668.314) (-671.526) (-666.858) -- 0:00:30
496500 -- (-671.852) [-667.796] (-672.156) (-673.788) * [-669.524] (-668.203) (-672.598) (-669.514) -- 0:00:30
497000 -- [-667.754] (-668.571) (-668.126) (-670.372) * (-669.772) [-669.298] (-667.953) (-669.619) -- 0:00:30
497500 -- (-676.832) (-669.592) [-670.079] (-669.445) * [-667.468] (-668.535) (-669.771) (-669.378) -- 0:00:30
498000 -- (-667.451) (-669.410) (-668.105) [-668.322] * (-669.148) (-669.228) [-670.790] (-666.934) -- 0:00:30
498500 -- (-668.966) (-670.045) (-670.002) [-669.945] * (-669.420) (-671.777) (-671.963) [-666.895] -- 0:00:30
499000 -- [-674.238] (-671.336) (-669.380) (-668.975) * [-669.173] (-671.623) (-668.558) (-668.407) -- 0:00:30
499500 -- [-670.589] (-669.355) (-670.981) (-673.593) * (-667.811) [-667.290] (-674.002) (-668.240) -- 0:00:30
500000 -- (-667.584) (-668.113) [-669.451] (-669.668) * (-669.486) (-666.997) [-672.904] (-667.965) -- 0:00:30
Average standard deviation of split frequencies: 0.013403
500500 -- [-669.225] (-670.216) (-669.568) (-668.782) * (-667.468) [-668.667] (-669.200) (-669.727) -- 0:00:29
501000 -- [-670.379] (-669.320) (-668.675) (-676.057) * [-669.614] (-672.849) (-667.626) (-668.105) -- 0:00:29
501500 -- (-669.517) (-667.678) [-674.401] (-672.732) * (-667.232) (-671.994) (-668.430) [-668.401] -- 0:00:29
502000 -- [-668.070] (-670.693) (-669.100) (-675.090) * (-667.761) (-671.494) (-670.159) [-667.734] -- 0:00:29
502500 -- (-672.304) (-670.332) [-669.134] (-670.042) * [-667.951] (-669.909) (-668.070) (-670.152) -- 0:00:29
503000 -- (-671.513) (-670.235) (-669.893) [-668.798] * (-667.547) (-671.687) [-672.158] (-669.335) -- 0:00:29
503500 -- (-668.920) (-668.019) (-668.408) [-669.016] * [-667.751] (-668.151) (-670.022) (-668.360) -- 0:00:30
504000 -- (-669.918) (-669.804) (-671.296) [-666.960] * (-667.594) (-668.155) (-669.203) [-667.255] -- 0:00:30
504500 -- (-669.380) (-671.381) [-667.405] (-669.137) * [-667.599] (-668.554) (-669.282) (-670.166) -- 0:00:30
505000 -- (-669.094) [-668.637] (-669.941) (-669.553) * [-668.526] (-667.085) (-666.926) (-670.648) -- 0:00:30
Average standard deviation of split frequencies: 0.012714
505500 -- (-669.519) (-668.303) (-669.057) [-668.621] * (-668.855) (-670.854) [-669.519] (-667.273) -- 0:00:30
506000 -- [-669.564] (-669.478) (-669.406) (-671.356) * (-667.585) (-667.581) (-668.835) [-670.677] -- 0:00:30
506500 -- (-667.475) [-669.135] (-669.680) (-679.272) * (-668.851) (-668.299) [-669.738] (-666.937) -- 0:00:30
507000 -- (-666.768) [-667.605] (-672.495) (-669.759) * [-669.766] (-672.265) (-668.257) (-667.762) -- 0:00:30
507500 -- (-669.452) (-668.161) (-669.998) [-667.210] * (-671.306) (-673.204) [-668.038] (-667.135) -- 0:00:30
508000 -- (-670.005) (-667.562) [-670.281] (-670.310) * [-668.211] (-667.550) (-671.676) (-667.610) -- 0:00:30
508500 -- (-667.725) (-667.180) (-668.093) [-667.818] * (-668.793) (-668.577) [-668.975] (-670.786) -- 0:00:29
509000 -- (-669.087) (-669.857) [-670.643] (-670.230) * [-667.463] (-669.710) (-667.371) (-671.004) -- 0:00:29
509500 -- (-668.228) [-667.101] (-671.619) (-671.426) * (-669.011) (-667.795) [-667.756] (-673.768) -- 0:00:29
510000 -- [-666.804] (-667.679) (-670.754) (-669.747) * [-671.836] (-667.890) (-669.179) (-672.896) -- 0:00:29
Average standard deviation of split frequencies: 0.012272
510500 -- (-668.445) (-675.150) [-668.132] (-673.512) * [-670.082] (-666.929) (-668.574) (-669.550) -- 0:00:29
511000 -- (-669.484) (-668.926) (-669.027) [-667.166] * (-670.376) [-667.512] (-667.222) (-668.192) -- 0:00:29
511500 -- (-668.115) (-668.399) (-668.189) [-667.844] * [-667.376] (-667.303) (-667.601) (-669.271) -- 0:00:29
512000 -- (-668.542) [-669.154] (-671.121) (-668.902) * [-666.807] (-670.058) (-670.007) (-672.275) -- 0:00:29
512500 -- [-667.760] (-670.870) (-672.656) (-668.125) * (-668.720) (-669.568) (-667.968) [-672.028] -- 0:00:29
513000 -- [-668.063] (-668.229) (-669.814) (-668.896) * (-668.123) [-667.715] (-669.407) (-668.284) -- 0:00:29
513500 -- (-668.598) [-669.460] (-667.885) (-667.243) * (-666.781) (-669.191) [-668.558] (-667.261) -- 0:00:29
514000 -- (-668.363) [-670.952] (-672.290) (-668.103) * (-666.519) [-667.140] (-671.980) (-667.516) -- 0:00:29
514500 -- [-668.582] (-668.188) (-674.665) (-667.468) * [-667.648] (-669.734) (-671.125) (-668.198) -- 0:00:29
515000 -- (-667.583) (-668.821) (-670.573) [-668.553] * (-669.834) (-667.896) [-668.699] (-668.734) -- 0:00:29
Average standard deviation of split frequencies: 0.011769
515500 -- [-671.687] (-669.269) (-669.646) (-668.513) * (-668.537) (-669.520) (-667.422) [-668.447] -- 0:00:29
516000 -- [-668.751] (-668.085) (-670.283) (-675.928) * [-667.957] (-668.972) (-669.033) (-668.822) -- 0:00:29
516500 -- (-669.149) [-667.017] (-669.472) (-668.760) * (-667.644) (-668.998) (-667.252) [-668.044] -- 0:00:29
517000 -- (-668.127) (-666.781) (-667.209) [-668.955] * (-668.363) (-670.034) [-667.888] (-670.797) -- 0:00:28
517500 -- [-668.143] (-666.781) (-667.238) (-678.525) * (-667.342) [-670.506] (-667.422) (-668.410) -- 0:00:28
518000 -- (-667.427) (-671.194) (-667.413) [-669.960] * (-667.583) (-669.525) (-672.752) [-667.931] -- 0:00:28
518500 -- (-669.451) [-668.781] (-667.551) (-669.091) * [-667.125] (-673.656) (-669.727) (-667.682) -- 0:00:28
519000 -- (-669.998) (-670.620) [-668.222] (-678.247) * (-670.555) [-668.471] (-667.950) (-667.719) -- 0:00:28
519500 -- (-667.065) (-670.040) (-670.186) [-672.674] * [-667.799] (-673.685) (-669.415) (-666.755) -- 0:00:28
520000 -- [-667.065] (-670.802) (-667.019) (-668.090) * (-668.726) (-670.054) [-667.618] (-669.487) -- 0:00:29
Average standard deviation of split frequencies: 0.012090
520500 -- (-667.309) (-667.349) [-666.881] (-668.593) * [-668.667] (-668.913) (-671.146) (-676.219) -- 0:00:29
521000 -- [-668.489] (-668.895) (-667.603) (-670.810) * [-667.288] (-670.032) (-670.018) (-669.125) -- 0:00:29
521500 -- (-668.271) (-666.793) (-670.268) [-671.488] * (-670.278) (-672.151) (-671.640) [-668.577] -- 0:00:29
522000 -- (-668.359) (-668.507) (-666.736) [-673.205] * (-670.345) [-667.347] (-671.858) (-669.203) -- 0:00:29
522500 -- [-669.492] (-667.270) (-667.076) (-668.165) * (-670.178) [-669.176] (-673.085) (-667.979) -- 0:00:29
523000 -- (-673.749) (-668.062) [-669.129] (-668.644) * (-669.020) (-666.842) (-669.589) [-667.324] -- 0:00:29
523500 -- (-668.822) [-667.757] (-673.168) (-668.854) * (-669.349) (-668.111) [-666.807] (-668.779) -- 0:00:29
524000 -- (-666.832) [-669.400] (-669.591) (-669.329) * (-667.701) [-669.409] (-669.237) (-667.825) -- 0:00:29
524500 -- [-668.887] (-667.555) (-668.770) (-667.407) * (-667.091) (-670.133) (-668.435) [-667.954] -- 0:00:29
525000 -- (-672.341) (-667.253) [-667.193] (-667.733) * (-668.211) (-669.680) (-671.159) [-668.794] -- 0:00:28
Average standard deviation of split frequencies: 0.012494
525500 -- [-667.383] (-667.176) (-676.487) (-667.522) * [-669.508] (-670.383) (-669.733) (-668.233) -- 0:00:28
526000 -- (-667.669) (-669.287) (-667.454) [-670.649] * (-668.612) (-671.578) (-667.667) [-668.014] -- 0:00:28
526500 -- [-667.558] (-668.028) (-667.344) (-672.157) * (-667.739) (-667.694) [-667.058] (-668.403) -- 0:00:28
527000 -- (-667.838) (-669.275) (-669.409) [-668.183] * (-667.123) (-669.483) [-667.393] (-668.681) -- 0:00:28
527500 -- (-668.476) [-669.315] (-667.851) (-668.685) * (-668.856) (-667.532) [-667.374] (-667.006) -- 0:00:28
528000 -- [-670.018] (-668.781) (-668.000) (-668.791) * [-667.713] (-668.575) (-669.486) (-666.678) -- 0:00:28
528500 -- (-671.756) [-667.749] (-668.474) (-667.036) * (-669.182) (-669.126) (-668.199) [-667.393] -- 0:00:28
529000 -- (-672.219) (-667.836) [-668.288] (-666.511) * (-668.253) [-670.542] (-668.227) (-667.579) -- 0:00:28
529500 -- [-667.710] (-667.675) (-667.783) (-669.792) * (-666.613) (-670.635) (-667.982) [-667.538] -- 0:00:28
530000 -- [-670.044] (-668.870) (-667.398) (-668.788) * (-667.009) (-670.459) (-670.274) [-670.136] -- 0:00:28
Average standard deviation of split frequencies: 0.012646
530500 -- (-669.198) (-670.389) (-669.517) [-669.713] * (-667.359) [-668.090] (-671.794) (-669.415) -- 0:00:28
531000 -- [-667.542] (-667.367) (-672.314) (-669.159) * (-669.545) (-669.760) (-671.216) [-670.275] -- 0:00:28
531500 -- (-667.878) (-669.315) (-669.927) [-668.065] * (-668.791) [-667.402] (-668.949) (-668.827) -- 0:00:28
532000 -- (-667.284) (-669.630) (-670.507) [-672.624] * (-668.561) (-670.789) [-668.020] (-670.280) -- 0:00:28
532500 -- [-668.619] (-669.862) (-676.346) (-670.485) * (-670.379) (-670.296) (-668.605) [-667.434] -- 0:00:28
533000 -- (-668.359) (-668.726) [-673.077] (-672.430) * (-674.842) [-670.353] (-667.579) (-674.187) -- 0:00:28
533500 -- (-671.401) (-670.580) [-667.372] (-668.734) * (-668.090) [-670.750] (-669.409) (-671.245) -- 0:00:27
534000 -- (-670.594) [-669.592] (-670.113) (-670.031) * (-667.931) (-668.874) [-669.309] (-669.236) -- 0:00:27
534500 -- (-668.283) [-667.064] (-667.199) (-671.317) * (-666.695) [-667.030] (-671.562) (-669.470) -- 0:00:27
535000 -- (-671.947) (-672.054) [-666.970] (-670.458) * (-667.212) [-670.517] (-669.792) (-666.911) -- 0:00:27
Average standard deviation of split frequencies: 0.012985
535500 -- (-670.545) (-671.546) (-670.411) [-670.534] * (-668.499) (-669.311) (-668.449) [-667.490] -- 0:00:27
536000 -- (-673.511) (-672.621) (-669.038) [-670.064] * (-668.049) (-668.027) [-669.033] (-669.417) -- 0:00:27
536500 -- [-667.828] (-669.589) (-667.088) (-670.560) * [-668.024] (-672.548) (-669.388) (-668.479) -- 0:00:27
537000 -- (-671.016) [-671.385] (-668.917) (-669.044) * [-671.046] (-668.481) (-671.774) (-669.022) -- 0:00:28
537500 -- (-671.590) (-668.682) [-669.411] (-668.967) * (-668.560) [-667.473] (-666.844) (-667.552) -- 0:00:28
538000 -- (-673.813) [-667.946] (-669.648) (-671.384) * [-666.558] (-669.838) (-667.662) (-668.560) -- 0:00:28
538500 -- (-670.533) (-666.606) (-671.147) [-673.256] * [-669.127] (-671.724) (-669.032) (-667.568) -- 0:00:28
539000 -- (-672.038) [-668.083] (-670.180) (-667.496) * (-670.041) (-669.391) [-669.152] (-670.959) -- 0:00:28
539500 -- (-669.963) [-667.588] (-668.713) (-668.277) * (-669.688) (-669.191) (-669.204) [-672.399] -- 0:00:28
540000 -- (-671.863) (-670.260) [-669.125] (-670.002) * (-673.855) (-666.839) [-668.448] (-667.762) -- 0:00:28
Average standard deviation of split frequencies: 0.013591
540500 -- (-672.277) [-667.183] (-669.112) (-674.797) * [-667.605] (-668.868) (-667.615) (-669.249) -- 0:00:28
541000 -- [-669.345] (-668.954) (-668.438) (-669.507) * (-669.597) (-668.046) (-674.858) [-670.962] -- 0:00:27
541500 -- (-668.469) [-668.367] (-667.175) (-670.214) * [-667.165] (-669.028) (-671.401) (-668.510) -- 0:00:27
542000 -- [-668.138] (-668.742) (-666.988) (-668.772) * (-669.193) (-669.945) [-669.658] (-667.761) -- 0:00:27
542500 -- (-671.817) [-669.146] (-667.695) (-670.636) * [-668.559] (-668.489) (-670.357) (-668.701) -- 0:00:27
543000 -- (-667.973) (-668.345) [-669.616] (-670.637) * (-667.782) (-670.051) (-668.517) [-668.671] -- 0:00:27
543500 -- (-667.444) [-669.111] (-668.821) (-669.990) * (-667.884) [-673.812] (-667.218) (-668.674) -- 0:00:27
544000 -- [-667.009] (-669.889) (-667.279) (-667.145) * (-671.410) (-667.647) (-668.828) [-667.158] -- 0:00:27
544500 -- [-667.794] (-670.800) (-667.383) (-668.535) * [-672.030] (-668.570) (-671.137) (-667.085) -- 0:00:27
545000 -- (-671.992) (-666.650) (-670.505) [-672.525] * [-667.953] (-672.499) (-671.006) (-668.124) -- 0:00:27
Average standard deviation of split frequencies: 0.013662
545500 -- [-670.266] (-671.077) (-673.145) (-668.721) * [-671.702] (-667.741) (-670.307) (-668.258) -- 0:00:27
546000 -- (-669.725) (-667.334) (-673.883) [-669.533] * (-669.348) (-669.376) (-669.026) [-669.522] -- 0:00:27
546500 -- (-672.792) [-670.072] (-670.944) (-667.424) * (-670.254) [-669.126] (-674.303) (-670.756) -- 0:00:27
547000 -- (-669.681) (-669.747) (-672.830) [-667.004] * [-669.736] (-667.351) (-676.378) (-668.321) -- 0:00:27
547500 -- (-668.992) (-670.043) [-672.004] (-673.749) * [-668.588] (-667.956) (-676.830) (-667.838) -- 0:00:27
548000 -- (-668.341) [-667.971] (-669.502) (-668.474) * (-668.631) (-667.208) (-671.397) [-666.680] -- 0:00:27
548500 -- [-669.628] (-666.828) (-668.246) (-673.239) * [-671.256] (-666.710) (-667.652) (-667.198) -- 0:00:27
549000 -- (-669.808) [-668.466] (-669.531) (-674.247) * (-669.241) (-670.284) [-668.905] (-667.766) -- 0:00:27
549500 -- (-667.358) (-667.713) [-671.154] (-673.362) * (-672.041) (-674.135) (-668.318) [-670.500] -- 0:00:27
550000 -- (-668.697) (-668.538) (-671.426) [-670.145] * (-667.219) [-669.525] (-668.279) (-667.593) -- 0:00:27
Average standard deviation of split frequencies: 0.013193
550500 -- (-671.325) (-668.461) [-671.037] (-667.304) * (-667.945) (-667.269) (-671.083) [-667.588] -- 0:00:26
551000 -- (-670.608) (-672.722) [-668.820] (-667.151) * [-667.986] (-668.887) (-667.609) (-669.045) -- 0:00:26
551500 -- [-669.040] (-672.187) (-668.602) (-669.921) * [-667.851] (-666.919) (-677.744) (-668.323) -- 0:00:26
552000 -- (-670.899) (-672.802) (-672.004) [-672.202] * (-667.251) [-670.113] (-667.723) (-667.602) -- 0:00:26
552500 -- (-668.579) [-670.269] (-672.162) (-670.048) * (-667.320) (-667.367) [-669.200] (-668.066) -- 0:00:26
553000 -- [-669.782] (-672.918) (-668.727) (-673.472) * (-668.488) (-670.653) (-670.311) [-670.094] -- 0:00:26
553500 -- (-669.416) (-667.620) [-667.993] (-670.275) * (-668.080) [-668.214] (-670.159) (-670.527) -- 0:00:27
554000 -- (-669.313) (-667.246) (-669.991) [-669.483] * (-671.703) (-669.781) [-669.072] (-669.278) -- 0:00:27
554500 -- [-673.491] (-669.913) (-671.911) (-666.758) * [-668.451] (-670.149) (-669.315) (-666.624) -- 0:00:27
555000 -- (-670.150) (-668.760) (-672.197) [-669.291] * (-666.977) (-668.907) (-668.360) [-669.892] -- 0:00:27
Average standard deviation of split frequencies: 0.012768
555500 -- (-669.998) [-668.944] (-669.712) (-672.257) * (-668.572) (-671.385) (-667.283) [-666.825] -- 0:00:27
556000 -- [-668.014] (-669.822) (-671.641) (-668.101) * (-668.871) (-669.274) [-667.491] (-666.985) -- 0:00:27
556500 -- (-668.121) (-672.363) [-669.179] (-673.984) * (-668.215) (-669.610) [-667.446] (-668.252) -- 0:00:27
557000 -- (-668.109) [-668.736] (-669.427) (-668.511) * (-666.920) (-669.538) [-667.508] (-668.791) -- 0:00:27
557500 -- (-667.829) (-668.785) (-670.049) [-668.902] * (-668.015) (-668.283) (-668.893) [-668.583] -- 0:00:26
558000 -- [-668.355] (-668.295) (-669.252) (-668.415) * (-667.917) (-667.553) [-668.532] (-668.913) -- 0:00:26
558500 -- [-668.491] (-668.478) (-673.415) (-668.287) * [-667.428] (-668.129) (-668.518) (-667.637) -- 0:00:26
559000 -- [-669.032] (-669.872) (-668.501) (-670.008) * (-669.114) [-666.530] (-671.181) (-669.527) -- 0:00:26
559500 -- (-668.034) (-667.197) [-670.663] (-667.648) * [-669.731] (-667.924) (-668.308) (-668.169) -- 0:00:26
560000 -- (-674.711) [-669.921] (-668.382) (-669.324) * (-667.686) [-667.392] (-668.533) (-668.477) -- 0:00:26
Average standard deviation of split frequencies: 0.011821
560500 -- [-668.838] (-669.003) (-669.304) (-668.760) * (-668.135) [-668.580] (-668.417) (-669.902) -- 0:00:26
561000 -- (-674.935) (-667.663) (-668.489) [-668.165] * (-670.263) (-669.295) [-669.681] (-670.097) -- 0:00:26
561500 -- (-673.895) (-670.040) (-667.590) [-667.514] * (-669.179) (-668.594) [-670.496] (-667.999) -- 0:00:26
562000 -- (-667.870) [-667.620] (-668.975) (-668.437) * (-668.115) [-668.324] (-669.988) (-669.049) -- 0:00:26
562500 -- (-672.106) [-668.272] (-668.933) (-668.711) * (-668.282) (-668.266) (-669.998) [-668.374] -- 0:00:26
563000 -- (-667.918) (-669.327) [-669.156] (-667.838) * [-666.943] (-670.779) (-671.590) (-670.206) -- 0:00:26
563500 -- (-672.339) (-670.885) (-669.652) [-667.590] * (-668.918) [-670.773] (-668.243) (-670.743) -- 0:00:26
564000 -- (-670.481) [-667.934] (-669.468) (-668.944) * (-667.347) (-667.397) [-672.134] (-669.006) -- 0:00:26
564500 -- (-676.630) (-668.544) (-666.845) [-668.600] * (-667.453) (-668.567) (-670.048) [-668.422] -- 0:00:26
565000 -- [-668.958] (-669.560) (-669.574) (-669.204) * (-666.923) [-668.932] (-667.890) (-671.439) -- 0:00:26
Average standard deviation of split frequencies: 0.011660
565500 -- [-673.950] (-668.225) (-667.852) (-667.304) * (-669.725) (-669.000) [-666.975] (-668.353) -- 0:00:26
566000 -- [-669.659] (-668.020) (-670.489) (-667.055) * [-670.908] (-666.843) (-667.117) (-668.824) -- 0:00:26
566500 -- (-668.202) [-667.927] (-670.474) (-667.289) * [-669.064] (-669.736) (-667.437) (-668.322) -- 0:00:26
567000 -- (-668.013) (-669.389) (-670.851) [-667.486] * (-674.869) [-668.023] (-669.403) (-668.534) -- 0:00:25
567500 -- (-669.773) [-667.865] (-667.601) (-668.401) * (-668.162) [-668.491] (-668.034) (-670.772) -- 0:00:25
568000 -- (-668.451) (-668.360) (-667.461) [-668.471] * (-672.793) (-669.182) (-669.512) [-669.841] -- 0:00:25
568500 -- (-669.531) (-668.989) (-669.704) [-668.440] * (-669.890) [-673.111] (-668.168) (-670.958) -- 0:00:25
569000 -- (-669.897) (-668.352) (-668.796) [-668.016] * (-668.140) [-671.882] (-666.929) (-672.998) -- 0:00:25
569500 -- [-669.948] (-669.415) (-667.445) (-666.927) * (-668.351) (-668.322) (-667.132) [-670.008] -- 0:00:25
570000 -- (-669.569) (-671.751) (-668.438) [-670.687] * (-669.858) [-666.929] (-669.248) (-669.734) -- 0:00:25
Average standard deviation of split frequencies: 0.011079
570500 -- (-669.448) [-668.197] (-668.399) (-668.420) * (-669.844) [-669.731] (-669.333) (-674.807) -- 0:00:26
571000 -- (-669.262) (-667.370) [-667.084] (-670.187) * (-669.074) (-675.472) (-668.567) [-667.243] -- 0:00:26
571500 -- (-667.575) [-668.968] (-667.638) (-667.737) * (-670.743) (-675.679) [-668.930] (-672.086) -- 0:00:26
572000 -- (-669.882) (-668.215) [-666.720] (-667.748) * (-670.503) (-672.202) (-668.871) [-673.246] -- 0:00:26
572500 -- (-668.577) (-667.920) (-667.616) [-667.585] * [-667.628] (-671.027) (-668.128) (-669.269) -- 0:00:26
573000 -- (-669.157) (-677.745) [-668.243] (-667.566) * (-669.122) [-670.513] (-671.655) (-668.208) -- 0:00:26
573500 -- (-669.450) [-668.707] (-667.337) (-669.649) * (-669.783) (-667.866) [-669.749] (-671.772) -- 0:00:26
574000 -- [-668.296] (-671.941) (-667.993) (-672.318) * (-671.238) [-667.583] (-672.170) (-669.995) -- 0:00:25
574500 -- [-668.768] (-667.617) (-669.769) (-667.778) * (-670.560) (-668.830) (-669.327) [-672.399] -- 0:00:25
575000 -- [-669.759] (-670.586) (-668.832) (-667.946) * (-668.449) [-668.244] (-668.450) (-672.255) -- 0:00:25
Average standard deviation of split frequencies: 0.011554
575500 -- (-667.817) [-668.438] (-672.391) (-667.026) * (-669.768) (-669.262) [-670.787] (-667.388) -- 0:00:25
576000 -- [-670.270] (-668.861) (-669.978) (-671.288) * (-668.125) (-668.161) [-669.603] (-672.397) -- 0:00:25
576500 -- (-666.958) [-668.241] (-668.337) (-672.260) * [-668.011] (-667.254) (-673.024) (-669.124) -- 0:00:25
577000 -- (-671.147) (-668.866) (-669.911) [-669.458] * [-667.797] (-667.909) (-670.568) (-672.957) -- 0:00:25
577500 -- [-668.954] (-672.607) (-670.677) (-671.937) * (-671.385) [-667.547] (-671.985) (-668.572) -- 0:00:25
578000 -- (-667.580) (-667.429) [-668.650] (-667.570) * (-668.362) (-671.165) (-668.757) [-670.317] -- 0:00:25
578500 -- [-668.359] (-667.582) (-671.049) (-667.416) * [-667.675] (-667.512) (-669.258) (-668.910) -- 0:00:25
579000 -- (-667.786) [-667.130] (-668.126) (-667.519) * (-668.653) (-667.899) (-667.980) [-668.939] -- 0:00:25
579500 -- (-675.764) (-674.297) (-667.163) [-670.610] * (-667.980) (-667.032) (-675.728) [-666.564] -- 0:00:25
580000 -- (-667.568) (-670.361) (-670.007) [-669.025] * (-666.971) (-667.286) [-669.529] (-672.900) -- 0:00:25
Average standard deviation of split frequencies: 0.011031
580500 -- [-670.080] (-668.696) (-669.574) (-670.516) * [-666.641] (-668.197) (-668.152) (-672.067) -- 0:00:25
581000 -- [-669.522] (-667.400) (-667.156) (-668.192) * (-666.916) (-668.797) [-669.950] (-675.629) -- 0:00:25
581500 -- [-668.663] (-670.273) (-668.650) (-670.503) * (-670.196) (-670.754) (-669.414) [-670.104] -- 0:00:25
582000 -- [-669.627] (-669.397) (-668.323) (-667.497) * [-669.798] (-668.505) (-668.792) (-671.514) -- 0:00:25
582500 -- (-667.666) (-669.057) [-667.984] (-669.088) * [-670.084] (-669.073) (-667.988) (-668.101) -- 0:00:25
583000 -- [-669.871] (-670.411) (-667.261) (-673.411) * [-668.241] (-668.590) (-670.318) (-669.828) -- 0:00:25
583500 -- (-670.354) [-666.895] (-668.180) (-671.443) * (-667.298) (-668.222) (-671.367) [-671.008] -- 0:00:24
584000 -- (-669.166) (-672.382) [-673.873] (-667.488) * (-671.484) (-667.455) (-669.838) [-667.955] -- 0:00:24
584500 -- (-673.053) (-669.700) (-671.103) [-670.012] * (-669.207) (-668.611) [-668.490] (-667.232) -- 0:00:24
585000 -- (-668.252) (-668.655) [-669.415] (-669.059) * (-667.679) [-669.386] (-668.150) (-668.333) -- 0:00:24
Average standard deviation of split frequencies: 0.011546
585500 -- (-669.266) [-668.474] (-668.798) (-668.542) * (-667.060) [-668.001] (-666.853) (-668.535) -- 0:00:24
586000 -- (-676.400) (-671.571) (-670.806) [-671.259] * (-670.963) (-669.374) [-667.522] (-672.150) -- 0:00:24
586500 -- (-669.679) (-670.371) [-670.636] (-670.823) * (-667.877) [-667.648] (-667.182) (-671.410) -- 0:00:24
587000 -- [-668.503] (-668.927) (-668.757) (-668.184) * [-669.291] (-669.685) (-669.874) (-667.129) -- 0:00:25
587500 -- (-668.302) (-667.537) [-669.313] (-668.746) * (-674.146) (-668.174) (-668.651) [-669.473] -- 0:00:25
588000 -- [-667.991] (-672.845) (-669.705) (-668.986) * (-670.095) (-670.913) [-670.104] (-671.200) -- 0:00:25
588500 -- (-668.317) [-667.642] (-668.301) (-669.059) * [-668.069] (-670.087) (-668.764) (-669.576) -- 0:00:25
589000 -- (-668.271) [-667.272] (-668.351) (-669.898) * (-669.939) (-670.947) [-669.223] (-669.669) -- 0:00:25
589500 -- [-668.872] (-671.757) (-668.194) (-667.349) * [-671.065] (-670.176) (-669.835) (-667.802) -- 0:00:25
590000 -- (-670.358) (-668.595) (-668.313) [-667.562] * [-666.864] (-667.332) (-667.383) (-667.480) -- 0:00:25
Average standard deviation of split frequencies: 0.012018
590500 -- (-671.645) (-668.842) (-667.572) [-669.516] * (-667.767) (-668.675) (-670.637) [-672.719] -- 0:00:24
591000 -- (-668.107) (-667.062) [-671.779] (-668.204) * [-671.129] (-666.929) (-671.460) (-667.176) -- 0:00:24
591500 -- (-669.356) (-667.523) [-668.456] (-668.578) * (-667.478) (-668.761) [-670.188] (-667.971) -- 0:00:24
592000 -- [-668.731] (-667.981) (-667.705) (-667.281) * (-667.426) (-666.752) (-672.453) [-667.599] -- 0:00:24
592500 -- (-667.099) (-669.934) (-669.851) [-669.437] * [-672.179] (-667.893) (-670.873) (-670.170) -- 0:00:24
593000 -- [-667.667] (-670.506) (-669.388) (-674.843) * [-667.018] (-668.468) (-667.924) (-671.654) -- 0:00:24
593500 -- (-669.033) [-669.934] (-671.473) (-668.425) * (-671.862) (-670.020) (-671.313) [-668.699] -- 0:00:24
594000 -- (-668.921) (-668.068) (-668.633) [-668.158] * (-667.988) (-669.406) [-668.883] (-668.503) -- 0:00:24
594500 -- (-671.184) (-668.225) [-668.512] (-668.555) * (-668.160) (-667.802) [-669.510] (-675.539) -- 0:00:24
595000 -- (-671.609) (-668.400) (-667.134) [-667.655] * (-669.485) [-668.721] (-672.532) (-671.286) -- 0:00:24
Average standard deviation of split frequencies: 0.011399
595500 -- (-669.943) (-670.530) (-667.316) [-667.800] * (-670.133) (-667.913) (-669.386) [-669.045] -- 0:00:24
596000 -- (-667.679) [-673.268] (-667.666) (-673.484) * (-668.028) (-670.324) (-668.576) [-669.026] -- 0:00:24
596500 -- (-669.874) (-668.763) (-670.749) [-668.372] * (-668.475) [-671.266] (-669.219) (-669.069) -- 0:00:24
597000 -- [-666.986] (-670.641) (-668.706) (-671.402) * [-667.161] (-668.334) (-669.350) (-669.789) -- 0:00:24
597500 -- (-666.767) (-669.522) [-669.221] (-668.718) * (-669.510) (-667.466) (-666.844) [-667.112] -- 0:00:24
598000 -- (-669.283) [-669.498] (-673.218) (-675.700) * (-669.342) (-668.701) [-667.616] (-667.367) -- 0:00:24
598500 -- (-670.509) (-669.723) (-669.294) [-668.259] * (-668.921) (-670.189) [-667.523] (-668.139) -- 0:00:24
599000 -- [-669.417] (-669.189) (-668.148) (-668.229) * [-666.899] (-667.287) (-669.606) (-669.704) -- 0:00:24
599500 -- [-667.943] (-667.011) (-669.162) (-667.140) * (-667.833) (-666.885) [-669.864] (-668.488) -- 0:00:24
600000 -- (-671.213) (-668.199) [-671.604] (-669.392) * [-667.079] (-667.912) (-667.077) (-668.480) -- 0:00:24
Average standard deviation of split frequencies: 0.011403
600500 -- (-669.255) [-667.995] (-670.092) (-668.990) * (-666.901) [-670.886] (-666.783) (-667.225) -- 0:00:23
601000 -- (-669.299) (-669.934) (-670.891) [-668.689] * (-673.258) (-668.290) (-671.942) [-669.119] -- 0:00:23
601500 -- (-670.688) [-671.795] (-668.337) (-670.696) * (-667.898) (-669.249) (-669.512) [-669.187] -- 0:00:23
602000 -- (-672.566) (-672.028) [-669.812] (-669.384) * (-668.796) [-667.434] (-670.514) (-670.779) -- 0:00:23
602500 -- (-668.416) (-669.568) (-670.090) [-669.244] * (-668.436) (-666.729) (-669.211) [-668.018] -- 0:00:23
603000 -- (-667.894) (-667.376) [-668.389] (-667.943) * [-669.493] (-668.522) (-669.140) (-667.329) -- 0:00:23
603500 -- (-668.936) (-671.201) (-668.001) [-666.936] * (-671.686) (-670.824) (-668.636) [-672.178] -- 0:00:23
604000 -- [-668.037] (-672.140) (-669.163) (-667.913) * (-669.255) (-668.717) [-667.568] (-672.453) -- 0:00:24
604500 -- (-668.321) (-667.970) (-670.217) [-667.364] * (-668.359) (-667.445) [-667.740] (-670.558) -- 0:00:24
605000 -- (-668.573) [-667.035] (-668.399) (-668.732) * [-668.740] (-668.733) (-667.414) (-670.733) -- 0:00:24
Average standard deviation of split frequencies: 0.011119
605500 -- (-669.159) (-669.592) (-667.499) [-669.898] * (-667.838) (-667.564) [-667.432] (-672.572) -- 0:00:24
606000 -- (-668.510) (-669.713) [-668.245] (-669.602) * (-671.327) [-670.925] (-667.707) (-668.578) -- 0:00:24
606500 -- (-668.272) [-667.810] (-668.939) (-669.554) * (-671.365) (-669.193) [-669.044] (-666.914) -- 0:00:24
607000 -- (-669.790) (-667.732) [-668.757] (-669.598) * (-669.433) (-668.506) (-667.909) [-666.911] -- 0:00:23
607500 -- (-668.956) [-668.989] (-667.951) (-669.188) * [-667.344] (-671.186) (-669.807) (-667.474) -- 0:00:23
608000 -- (-666.683) [-669.323] (-669.548) (-669.478) * (-667.242) (-670.254) (-673.265) [-667.905] -- 0:00:23
608500 -- (-668.358) (-667.255) (-668.490) [-668.395] * (-670.717) (-667.720) [-670.217] (-667.154) -- 0:00:23
609000 -- (-669.836) (-668.319) (-669.318) [-667.964] * [-668.791] (-668.510) (-671.995) (-667.526) -- 0:00:23
609500 -- (-670.241) (-667.408) (-669.085) [-667.616] * (-670.757) (-668.341) [-669.321] (-674.535) -- 0:00:23
610000 -- [-669.494] (-669.343) (-667.703) (-672.109) * (-668.871) [-668.311] (-674.540) (-668.490) -- 0:00:23
Average standard deviation of split frequencies: 0.011443
610500 -- (-667.218) [-667.636] (-670.559) (-668.097) * (-668.466) [-669.447] (-674.718) (-666.582) -- 0:00:23
611000 -- (-668.318) (-668.891) (-668.995) [-668.760] * (-667.832) (-669.430) [-670.358] (-669.476) -- 0:00:23
611500 -- [-667.466] (-672.467) (-671.053) (-668.980) * (-668.809) (-669.024) [-666.635] (-672.071) -- 0:00:23
612000 -- [-668.425] (-667.237) (-667.278) (-667.731) * (-671.981) [-667.723] (-669.023) (-669.504) -- 0:00:23
612500 -- (-668.544) (-668.812) (-667.508) [-668.841] * (-669.653) (-668.184) [-667.583] (-670.756) -- 0:00:23
613000 -- (-667.259) (-671.353) (-668.233) [-668.974] * (-669.895) [-667.634] (-667.583) (-670.283) -- 0:00:23
613500 -- (-669.967) (-670.857) (-668.579) [-668.948] * [-670.967] (-669.300) (-667.683) (-673.838) -- 0:00:23
614000 -- (-670.449) (-669.702) [-668.788] (-667.109) * (-669.393) [-668.117] (-670.737) (-670.576) -- 0:00:23
614500 -- (-667.632) (-673.894) [-670.398] (-667.029) * (-669.479) [-670.850] (-670.405) (-672.342) -- 0:00:23
615000 -- [-670.013] (-669.064) (-669.616) (-667.655) * (-671.808) (-667.044) (-667.842) [-670.372] -- 0:00:23
Average standard deviation of split frequencies: 0.011389
615500 -- (-667.692) (-669.822) (-667.891) [-667.350] * (-669.080) (-670.866) (-668.412) [-668.883] -- 0:00:23
616000 -- (-667.582) (-669.861) [-667.196] (-668.235) * (-668.959) (-670.953) (-670.513) [-669.396] -- 0:00:23
616500 -- (-668.326) (-671.311) [-667.230] (-667.758) * [-672.767] (-669.890) (-672.297) (-672.057) -- 0:00:23
617000 -- [-668.404] (-668.289) (-668.217) (-676.069) * [-668.046] (-675.311) (-667.801) (-669.973) -- 0:00:22
617500 -- (-668.503) (-667.302) (-667.165) [-668.705] * [-669.112] (-670.817) (-666.610) (-668.247) -- 0:00:22
618000 -- [-669.250] (-670.250) (-671.315) (-669.648) * (-668.235) [-670.868] (-666.607) (-670.765) -- 0:00:22
618500 -- (-670.008) (-667.763) (-672.419) [-667.713] * (-671.052) (-671.695) [-667.169] (-668.613) -- 0:00:22
619000 -- (-670.547) (-667.899) (-667.035) [-667.525] * [-669.960] (-669.722) (-668.399) (-668.565) -- 0:00:22
619500 -- (-668.211) (-667.803) (-667.739) [-667.140] * (-669.546) [-669.134] (-667.431) (-670.727) -- 0:00:23
620000 -- (-669.870) (-667.738) (-666.641) [-667.660] * (-671.089) [-668.903] (-669.334) (-669.465) -- 0:00:23
Average standard deviation of split frequencies: 0.011169
620500 -- [-667.685] (-669.963) (-671.863) (-670.415) * [-670.492] (-671.116) (-668.951) (-669.061) -- 0:00:23
621000 -- (-667.303) [-670.150] (-670.049) (-670.976) * (-667.610) (-667.262) [-670.150] (-667.863) -- 0:00:23
621500 -- (-673.795) (-667.356) [-668.397] (-672.798) * (-666.806) [-666.738] (-668.909) (-669.512) -- 0:00:23
622000 -- [-667.966] (-667.440) (-670.378) (-667.895) * [-666.791] (-668.831) (-668.940) (-670.941) -- 0:00:23
622500 -- (-667.542) (-668.947) (-672.830) [-666.926] * (-668.757) (-668.275) (-672.089) [-668.022] -- 0:00:23
623000 -- (-668.777) (-669.011) (-670.541) [-666.936] * [-671.524] (-667.327) (-672.442) (-671.520) -- 0:00:22
623500 -- (-675.453) (-667.407) (-666.841) [-668.237] * (-667.642) [-669.554] (-667.412) (-671.255) -- 0:00:22
624000 -- (-668.862) (-669.585) [-669.169] (-671.010) * [-666.566] (-669.211) (-667.210) (-669.437) -- 0:00:22
624500 -- (-669.077) [-668.091] (-670.568) (-669.075) * (-670.629) (-668.632) [-666.900] (-668.990) -- 0:00:22
625000 -- [-667.351] (-668.695) (-674.929) (-668.167) * (-667.143) (-672.372) (-666.852) [-670.023] -- 0:00:22
Average standard deviation of split frequencies: 0.011030
625500 -- (-669.941) [-668.220] (-670.526) (-668.732) * (-667.010) [-671.761] (-666.832) (-669.272) -- 0:00:22
626000 -- (-670.718) [-667.866] (-667.210) (-669.034) * (-671.284) (-669.981) (-673.642) [-672.417] -- 0:00:22
626500 -- [-668.081] (-671.447) (-668.401) (-667.890) * (-668.104) (-669.439) (-669.601) [-667.443] -- 0:00:22
627000 -- (-669.270) (-668.324) [-667.032] (-673.583) * (-669.811) (-668.591) [-669.634] (-667.225) -- 0:00:22
627500 -- (-669.749) (-669.948) (-668.059) [-669.954] * (-667.956) (-670.735) (-669.460) [-667.597] -- 0:00:22
628000 -- (-668.530) (-671.338) (-671.368) [-669.575] * (-668.416) (-670.169) (-669.415) [-666.992] -- 0:00:22
628500 -- (-668.491) (-669.993) (-668.375) [-670.416] * (-674.901) [-669.147] (-669.483) (-666.822) -- 0:00:22
629000 -- (-668.667) (-667.959) (-668.602) [-669.555] * (-667.659) [-671.995] (-667.858) (-668.442) -- 0:00:22
629500 -- (-671.281) (-667.512) [-668.297] (-671.569) * (-669.142) [-668.170] (-669.100) (-669.250) -- 0:00:22
630000 -- (-675.703) (-666.862) [-669.689] (-670.727) * [-668.726] (-670.257) (-670.390) (-673.882) -- 0:00:22
Average standard deviation of split frequencies: 0.011124
630500 -- (-673.059) (-667.390) (-666.862) [-668.232] * (-669.630) (-669.440) [-668.515] (-669.856) -- 0:00:22
631000 -- (-667.751) (-667.573) [-670.489] (-668.668) * (-672.409) (-667.819) [-667.783] (-667.553) -- 0:00:22
631500 -- (-674.589) [-670.023] (-674.197) (-668.740) * (-668.926) (-669.803) [-669.329] (-669.397) -- 0:00:22
632000 -- (-671.153) (-669.283) [-668.710] (-668.439) * (-666.830) (-670.605) (-669.203) [-668.090] -- 0:00:22
632500 -- (-668.510) (-669.576) (-668.946) [-667.563] * [-670.143] (-669.714) (-668.974) (-668.438) -- 0:00:22
633000 -- (-671.282) (-668.449) [-667.640] (-669.473) * (-668.206) (-671.337) (-668.600) [-670.239] -- 0:00:22
633500 -- (-671.344) (-668.498) [-666.985] (-672.473) * [-668.499] (-667.532) (-669.901) (-668.491) -- 0:00:21
634000 -- [-667.088] (-668.777) (-666.724) (-668.142) * [-667.141] (-668.356) (-668.533) (-669.099) -- 0:00:21
634500 -- (-669.885) (-668.292) (-668.481) [-667.185] * (-667.979) [-667.152] (-668.990) (-670.529) -- 0:00:21
635000 -- [-669.413] (-667.025) (-670.372) (-667.864) * (-667.743) (-672.725) [-669.168] (-668.388) -- 0:00:21
Average standard deviation of split frequencies: 0.011074
635500 -- [-667.747] (-670.902) (-669.975) (-668.646) * (-668.545) (-675.510) [-667.572] (-671.720) -- 0:00:21
636000 -- (-670.330) (-668.393) [-667.680] (-669.916) * (-668.976) (-669.122) [-668.685] (-669.498) -- 0:00:22
636500 -- (-666.769) (-669.437) (-667.999) [-668.244] * (-667.617) (-667.955) (-669.910) [-670.310] -- 0:00:22
637000 -- (-667.108) (-668.635) (-669.700) [-667.650] * (-668.053) [-667.837] (-672.660) (-669.935) -- 0:00:22
637500 -- (-670.210) [-667.515] (-669.990) (-668.365) * (-667.967) (-667.056) [-666.587] (-672.248) -- 0:00:22
638000 -- (-668.362) [-668.719] (-676.824) (-668.410) * (-667.897) (-668.531) (-667.632) [-667.372] -- 0:00:22
638500 -- (-669.462) (-674.974) (-672.667) [-668.338] * (-669.213) [-670.344] (-668.291) (-669.137) -- 0:00:22
639000 -- [-669.719] (-671.655) (-671.264) (-669.583) * (-670.569) [-670.839] (-667.801) (-669.616) -- 0:00:22
639500 -- [-668.745] (-668.840) (-670.287) (-668.160) * [-667.589] (-670.480) (-667.915) (-667.365) -- 0:00:21
640000 -- [-669.503] (-669.791) (-671.572) (-669.566) * (-670.736) [-668.606] (-669.131) (-666.834) -- 0:00:21
Average standard deviation of split frequencies: 0.010950
640500 -- [-669.121] (-669.841) (-669.395) (-668.252) * (-669.519) [-668.332] (-669.820) (-668.432) -- 0:00:21
641000 -- (-669.056) [-669.739] (-670.728) (-669.040) * (-671.933) [-668.396] (-667.599) (-667.157) -- 0:00:21
641500 -- (-669.758) [-667.955] (-669.561) (-668.779) * (-670.162) [-668.788] (-666.754) (-668.603) -- 0:00:21
642000 -- (-668.726) (-667.471) (-671.295) [-669.204] * (-669.347) [-668.650] (-666.825) (-670.659) -- 0:00:21
642500 -- [-667.589] (-668.766) (-671.327) (-669.239) * [-669.665] (-670.112) (-667.386) (-668.113) -- 0:00:21
643000 -- (-669.070) (-669.598) (-669.942) [-667.206] * (-668.130) (-668.436) (-668.409) [-667.683] -- 0:00:21
643500 -- (-668.326) [-667.072] (-668.368) (-667.167) * (-669.475) (-671.994) [-668.607] (-667.135) -- 0:00:21
644000 -- [-667.416] (-670.031) (-670.273) (-668.509) * (-668.314) (-672.288) [-667.470] (-670.546) -- 0:00:21
644500 -- (-668.863) [-668.078] (-668.114) (-668.851) * [-668.508] (-672.371) (-667.942) (-669.260) -- 0:00:21
645000 -- [-669.969] (-667.604) (-667.712) (-668.648) * (-669.022) [-668.318] (-668.096) (-667.614) -- 0:00:21
Average standard deviation of split frequencies: 0.010731
645500 -- (-667.617) (-669.267) (-668.683) [-666.895] * [-669.374] (-669.165) (-673.568) (-667.908) -- 0:00:21
646000 -- (-667.318) (-667.870) (-669.278) [-666.984] * (-671.866) [-673.054] (-669.867) (-668.201) -- 0:00:21
646500 -- [-672.373] (-666.856) (-666.908) (-667.563) * (-667.229) (-668.729) (-669.884) [-668.948] -- 0:00:21
647000 -- (-670.078) [-666.992] (-667.888) (-669.978) * (-667.858) (-676.601) (-666.743) [-668.836] -- 0:00:21
647500 -- [-668.211] (-667.902) (-668.174) (-669.400) * (-669.612) [-669.703] (-669.500) (-667.471) -- 0:00:21
648000 -- (-669.111) (-668.651) [-668.228] (-669.704) * (-669.351) [-671.544] (-669.400) (-671.115) -- 0:00:21
648500 -- (-669.282) (-667.099) [-667.659] (-669.405) * (-669.066) (-668.417) [-667.547] (-674.155) -- 0:00:21
649000 -- (-668.660) (-670.403) (-667.375) [-669.823] * (-668.393) (-669.552) (-667.983) [-670.843] -- 0:00:21
649500 -- (-670.574) [-676.636] (-667.439) (-668.414) * (-668.430) [-669.071] (-668.893) (-667.822) -- 0:00:21
650000 -- [-667.944] (-668.783) (-671.606) (-666.786) * [-668.712] (-667.849) (-668.762) (-668.370) -- 0:00:21
Average standard deviation of split frequencies: 0.010526
650500 -- (-667.862) (-667.706) (-671.198) [-666.867] * (-667.266) (-668.107) (-670.428) [-670.789] -- 0:00:20
651000 -- (-668.633) [-668.554] (-668.996) (-668.160) * (-667.186) (-668.081) [-669.622] (-667.764) -- 0:00:20
651500 -- [-667.138] (-667.001) (-669.966) (-673.757) * (-669.173) (-668.578) [-670.462] (-667.181) -- 0:00:20
652000 -- [-667.980] (-668.968) (-672.954) (-671.965) * (-673.132) (-669.774) (-670.201) [-672.271] -- 0:00:20
652500 -- (-667.440) [-668.014] (-668.783) (-669.032) * (-668.038) (-672.351) [-668.719] (-671.246) -- 0:00:20
653000 -- [-669.860] (-668.068) (-668.866) (-668.735) * (-668.038) (-667.129) [-668.829] (-668.311) -- 0:00:21
653500 -- (-670.230) [-670.311] (-668.991) (-669.136) * (-667.589) (-667.471) [-668.866] (-667.040) -- 0:00:21
654000 -- (-669.912) (-667.836) (-670.817) [-671.165] * [-667.172] (-668.081) (-672.559) (-668.112) -- 0:00:21
654500 -- (-671.205) (-668.091) (-670.563) [-669.862] * (-669.675) (-676.495) (-669.762) [-669.213] -- 0:00:21
655000 -- (-667.788) (-667.372) (-669.668) [-672.021] * (-670.296) (-668.636) (-669.343) [-669.521] -- 0:00:21
Average standard deviation of split frequencies: 0.010610
655500 -- (-670.755) (-667.926) [-667.418] (-670.175) * (-668.596) [-667.266] (-668.539) (-669.358) -- 0:00:21
656000 -- (-670.868) (-667.828) (-667.290) [-667.726] * [-668.549] (-667.212) (-668.724) (-669.217) -- 0:00:20
656500 -- (-670.116) (-668.694) [-667.736] (-667.940) * (-669.567) [-666.765] (-672.148) (-666.945) -- 0:00:20
657000 -- (-668.032) (-667.449) (-670.097) [-667.576] * (-668.849) [-666.951] (-672.190) (-668.558) -- 0:00:20
657500 -- [-667.421] (-668.026) (-668.597) (-667.468) * [-667.830] (-667.037) (-668.271) (-668.204) -- 0:00:20
658000 -- (-668.048) (-667.725) (-669.378) [-669.416] * (-670.172) [-668.294] (-668.048) (-667.910) -- 0:00:20
658500 -- (-666.952) [-667.277] (-668.889) (-669.669) * (-669.719) (-673.268) (-674.356) [-670.620] -- 0:00:20
659000 -- (-667.636) (-669.381) [-667.883] (-667.074) * [-668.457] (-667.634) (-670.482) (-671.891) -- 0:00:20
659500 -- (-668.087) (-668.147) (-667.267) [-668.105] * (-667.299) (-670.257) [-669.508] (-669.185) -- 0:00:20
660000 -- (-667.322) (-668.404) [-667.139] (-668.153) * [-668.554] (-670.716) (-668.591) (-671.845) -- 0:00:20
Average standard deviation of split frequencies: 0.010493
660500 -- (-668.114) [-666.695] (-666.878) (-668.370) * (-668.573) (-672.144) [-675.316] (-669.874) -- 0:00:20
661000 -- (-668.056) [-670.893] (-670.478) (-667.668) * (-670.139) (-667.692) (-671.714) [-667.818] -- 0:00:20
661500 -- (-668.005) (-671.023) [-668.172] (-667.929) * (-667.133) (-667.251) [-673.297] (-668.628) -- 0:00:20
662000 -- (-668.227) (-667.963) [-667.675] (-669.278) * (-668.749) (-667.283) [-670.772] (-670.384) -- 0:00:20
662500 -- (-668.462) (-668.862) (-666.848) [-667.137] * (-667.994) (-667.607) [-666.698] (-675.483) -- 0:00:20
663000 -- (-670.025) (-667.824) [-673.284] (-667.263) * [-667.877] (-671.659) (-668.599) (-671.398) -- 0:00:20
663500 -- [-669.555] (-668.655) (-671.010) (-671.634) * (-671.824) (-669.105) [-667.862] (-670.939) -- 0:00:20
664000 -- (-670.407) (-666.614) [-667.077] (-671.916) * (-668.152) [-670.043] (-667.630) (-669.571) -- 0:00:20
664500 -- (-667.980) (-668.747) (-669.182) [-667.642] * (-668.210) (-669.465) [-674.576] (-669.550) -- 0:00:20
665000 -- (-670.965) [-669.688] (-669.362) (-667.651) * [-668.282] (-669.206) (-668.866) (-669.347) -- 0:00:20
Average standard deviation of split frequencies: 0.010659
665500 -- (-673.041) [-667.276] (-667.061) (-669.069) * (-669.332) [-668.316] (-670.857) (-668.705) -- 0:00:20
666000 -- (-667.169) [-667.792] (-670.367) (-668.809) * (-668.390) (-670.602) [-668.767] (-670.918) -- 0:00:20
666500 -- (-670.213) (-671.731) (-671.875) [-669.503] * (-670.098) (-667.033) (-667.865) [-669.363] -- 0:00:20
667000 -- (-668.536) [-667.627] (-669.077) (-667.680) * (-672.578) (-667.771) [-668.447] (-667.429) -- 0:00:19
667500 -- (-670.979) (-669.398) [-667.404] (-668.066) * (-671.508) [-668.585] (-668.234) (-670.014) -- 0:00:19
668000 -- [-669.826] (-669.516) (-669.666) (-670.832) * (-671.171) (-668.195) [-668.401] (-669.118) -- 0:00:19
668500 -- (-667.273) (-669.148) [-668.312] (-668.786) * (-670.952) (-669.044) (-667.863) [-668.711] -- 0:00:19
669000 -- [-668.592] (-675.308) (-667.157) (-671.279) * (-669.077) [-667.904] (-668.920) (-671.224) -- 0:00:19
669500 -- [-667.157] (-675.520) (-667.190) (-670.837) * (-670.087) (-669.503) [-670.590] (-670.635) -- 0:00:20
670000 -- (-667.005) [-671.908] (-668.606) (-669.692) * [-668.507] (-670.226) (-667.628) (-669.251) -- 0:00:20
Average standard deviation of split frequencies: 0.010915
670500 -- [-667.060] (-667.773) (-667.969) (-670.292) * (-670.213) (-670.159) (-667.173) [-668.228] -- 0:00:20
671000 -- (-666.746) [-668.103] (-670.228) (-669.369) * (-674.290) [-667.501] (-667.016) (-673.079) -- 0:00:20
671500 -- [-667.385] (-670.463) (-671.164) (-670.168) * (-668.228) (-669.555) [-668.894] (-668.341) -- 0:00:20
672000 -- [-667.725] (-667.744) (-668.633) (-669.737) * (-672.285) (-668.514) [-671.829] (-666.773) -- 0:00:20
672500 -- [-669.394] (-670.597) (-667.263) (-669.013) * (-670.627) [-669.521] (-672.920) (-671.363) -- 0:00:19
673000 -- (-667.368) (-671.939) [-667.332] (-675.151) * (-670.287) [-670.045] (-669.654) (-670.439) -- 0:00:19
673500 -- (-668.687) [-671.183] (-667.218) (-669.124) * (-670.373) (-672.148) (-670.397) [-668.202] -- 0:00:19
674000 -- [-667.755] (-671.392) (-668.280) (-667.612) * (-670.644) (-668.326) [-669.147] (-668.164) -- 0:00:19
674500 -- (-668.367) (-667.202) [-669.456] (-668.400) * [-672.207] (-667.486) (-669.414) (-670.767) -- 0:00:19
675000 -- [-667.734] (-667.216) (-671.074) (-668.212) * (-667.096) (-667.417) [-669.875] (-669.440) -- 0:00:19
Average standard deviation of split frequencies: 0.010911
675500 -- (-669.045) [-669.671] (-669.746) (-667.986) * [-670.883] (-670.089) (-671.194) (-671.378) -- 0:00:19
676000 -- (-671.555) (-671.204) (-675.654) [-667.089] * (-668.400) (-668.141) [-672.087] (-668.759) -- 0:00:19
676500 -- (-670.992) (-668.735) (-668.992) [-667.649] * [-671.551] (-669.572) (-668.819) (-667.594) -- 0:00:19
677000 -- [-667.815] (-667.591) (-670.274) (-667.403) * (-669.211) (-667.669) [-671.263] (-671.014) -- 0:00:19
677500 -- [-670.290] (-671.352) (-667.353) (-669.082) * (-668.840) (-670.268) (-669.525) [-668.508] -- 0:00:19
678000 -- (-668.021) (-668.973) (-668.877) [-668.162] * (-669.124) (-673.326) [-668.418] (-668.837) -- 0:00:19
678500 -- [-668.860] (-667.829) (-673.517) (-669.253) * (-668.859) [-668.644] (-667.249) (-669.235) -- 0:00:19
679000 -- (-669.789) [-669.063] (-670.275) (-670.070) * (-668.037) [-668.173] (-669.417) (-668.454) -- 0:00:19
679500 -- [-668.060] (-667.760) (-669.014) (-672.231) * (-668.270) [-667.256] (-671.891) (-670.164) -- 0:00:19
680000 -- (-668.033) (-668.227) [-669.208] (-670.827) * (-667.897) [-668.311] (-676.668) (-671.625) -- 0:00:19
Average standard deviation of split frequencies: 0.011040
680500 -- [-667.673] (-669.668) (-669.259) (-673.901) * (-667.630) [-668.001] (-670.318) (-670.754) -- 0:00:19
681000 -- [-668.408] (-669.983) (-669.819) (-672.057) * (-669.930) (-667.476) (-670.330) [-671.294] -- 0:00:19
681500 -- (-669.535) (-673.662) (-670.000) [-667.116] * (-670.568) (-669.331) [-669.461] (-669.137) -- 0:00:19
682000 -- [-668.314] (-666.932) (-668.779) (-668.823) * (-667.875) [-670.040] (-670.275) (-667.864) -- 0:00:19
682500 -- (-667.958) (-667.316) (-668.741) [-668.346] * (-668.856) (-670.264) (-666.936) [-669.559] -- 0:00:19
683000 -- (-669.592) [-667.164] (-668.466) (-667.197) * [-668.413] (-668.996) (-667.849) (-668.582) -- 0:00:19
683500 -- (-669.979) [-670.514] (-670.982) (-668.619) * (-670.567) [-670.036] (-670.556) (-668.380) -- 0:00:18
684000 -- (-668.980) (-671.086) [-669.670] (-668.822) * (-669.516) (-669.670) [-670.478] (-670.161) -- 0:00:18
684500 -- [-669.489] (-669.030) (-669.793) (-670.892) * (-670.846) [-668.066] (-670.558) (-670.174) -- 0:00:18
685000 -- [-668.901] (-668.513) (-673.752) (-667.309) * [-667.835] (-669.510) (-668.540) (-673.904) -- 0:00:18
Average standard deviation of split frequencies: 0.010227
685500 -- (-671.163) (-669.163) (-668.502) [-667.045] * (-671.129) (-671.073) (-667.698) [-667.274] -- 0:00:18
686000 -- (-673.249) (-667.947) [-667.216] (-667.045) * (-669.824) [-669.988] (-670.786) (-670.002) -- 0:00:19
686500 -- (-668.607) (-668.937) (-668.866) [-667.157] * (-667.998) (-671.526) [-668.109] (-669.464) -- 0:00:19
687000 -- (-670.340) (-667.783) [-668.945] (-673.253) * [-669.884] (-668.186) (-669.527) (-668.837) -- 0:00:19
687500 -- (-668.551) (-672.176) (-668.902) [-668.596] * (-669.520) [-670.928] (-669.742) (-668.488) -- 0:00:19
688000 -- (-669.186) [-670.339] (-668.323) (-669.803) * (-671.882) (-671.954) [-668.120] (-668.294) -- 0:00:19
688500 -- [-673.244] (-668.934) (-667.767) (-669.047) * (-674.858) (-669.567) (-667.172) [-667.887] -- 0:00:19
689000 -- [-669.408] (-668.767) (-668.416) (-669.467) * (-676.144) [-667.535] (-668.624) (-669.181) -- 0:00:18
689500 -- [-668.676] (-675.991) (-668.151) (-670.937) * (-668.445) [-670.160] (-670.579) (-672.600) -- 0:00:18
690000 -- (-667.463) (-670.954) (-667.841) [-668.842] * (-668.762) (-667.805) (-669.061) [-668.957] -- 0:00:18
Average standard deviation of split frequencies: 0.010281
690500 -- (-667.837) (-668.352) (-667.516) [-668.849] * (-668.046) (-668.505) [-666.927] (-667.204) -- 0:00:18
691000 -- (-671.325) (-669.967) (-669.886) [-667.282] * [-667.379] (-671.832) (-668.898) (-667.280) -- 0:00:18
691500 -- (-667.186) (-669.384) [-666.830] (-667.634) * (-667.869) (-672.444) [-667.337] (-672.911) -- 0:00:18
692000 -- (-671.619) (-671.770) (-668.095) [-668.512] * (-668.726) (-670.505) [-667.704] (-669.117) -- 0:00:18
692500 -- [-667.909] (-674.381) (-667.640) (-668.133) * (-668.188) [-670.991] (-667.971) (-666.926) -- 0:00:18
693000 -- (-667.585) (-672.886) (-668.642) [-668.276] * (-666.981) [-668.680] (-668.549) (-670.789) -- 0:00:18
693500 -- [-673.447] (-670.037) (-669.192) (-668.333) * (-668.562) [-667.103] (-667.967) (-670.296) -- 0:00:18
694000 -- (-672.267) (-669.751) [-673.609] (-668.362) * [-668.015] (-668.682) (-671.415) (-670.167) -- 0:00:18
694500 -- (-671.596) (-668.728) (-673.751) [-667.895] * (-674.591) [-667.978] (-667.928) (-669.638) -- 0:00:18
695000 -- [-667.935] (-668.979) (-668.285) (-669.079) * (-669.894) (-673.827) [-667.709] (-669.320) -- 0:00:18
Average standard deviation of split frequencies: 0.010033
695500 -- (-668.027) (-668.363) (-669.420) [-668.891] * (-668.192) (-671.464) [-669.133] (-671.832) -- 0:00:18
696000 -- (-670.375) [-668.365] (-670.812) (-671.484) * [-668.197] (-667.105) (-666.994) (-668.673) -- 0:00:18
696500 -- (-668.874) (-670.926) [-667.549] (-668.725) * (-668.846) (-667.431) [-668.842] (-667.314) -- 0:00:18
697000 -- (-670.003) (-672.025) [-667.944] (-670.732) * (-668.721) [-667.513] (-668.201) (-668.089) -- 0:00:18
697500 -- (-670.210) (-673.182) [-669.181] (-673.891) * (-668.365) (-667.429) (-669.706) [-667.220] -- 0:00:18
698000 -- (-672.498) (-672.820) [-668.041] (-669.743) * (-669.025) [-668.551] (-667.130) (-667.950) -- 0:00:18
698500 -- (-668.731) (-669.504) (-668.914) [-670.123] * (-670.469) (-669.879) [-667.677] (-668.693) -- 0:00:18
699000 -- [-667.481] (-668.643) (-668.590) (-667.840) * (-667.346) (-668.285) [-667.087] (-670.536) -- 0:00:18
699500 -- (-675.260) (-667.141) [-668.015] (-671.821) * (-669.459) [-671.116] (-668.842) (-672.160) -- 0:00:18
700000 -- (-668.646) (-668.507) [-670.784] (-667.975) * (-668.082) [-669.971] (-668.512) (-672.242) -- 0:00:18
Average standard deviation of split frequencies: 0.010344
700500 -- [-669.515] (-668.858) (-668.520) (-669.531) * (-668.264) [-668.798] (-670.079) (-669.147) -- 0:00:17
701000 -- (-669.411) (-668.594) (-667.239) [-669.822] * (-667.773) (-669.371) [-668.597] (-673.351) -- 0:00:17
701500 -- [-667.530] (-667.370) (-667.614) (-673.177) * (-668.004) (-669.781) (-668.383) [-668.593] -- 0:00:17
702000 -- (-668.898) (-667.749) (-668.757) [-668.405] * (-668.868) (-670.289) (-670.522) [-668.261] -- 0:00:17
702500 -- [-669.069] (-674.042) (-670.015) (-669.006) * [-671.135] (-668.114) (-668.634) (-670.225) -- 0:00:17
703000 -- (-667.064) (-669.643) (-667.317) [-666.730] * (-667.543) (-666.873) (-669.508) [-668.160] -- 0:00:18
703500 -- (-668.579) (-669.357) [-667.093] (-667.852) * (-669.682) (-668.410) (-668.016) [-667.641] -- 0:00:18
704000 -- (-669.165) (-667.909) [-667.176] (-670.365) * (-667.489) [-668.013] (-667.297) (-669.158) -- 0:00:18
704500 -- (-668.297) (-668.990) (-669.143) [-671.606] * (-673.943) (-669.903) (-668.852) [-667.338] -- 0:00:18
705000 -- (-668.710) (-668.675) [-669.856] (-669.580) * (-669.566) [-668.568] (-668.528) (-672.878) -- 0:00:17
Average standard deviation of split frequencies: 0.010016
705500 -- (-667.586) (-668.997) [-667.243] (-668.052) * [-671.738] (-669.359) (-669.157) (-671.150) -- 0:00:17
706000 -- [-668.094] (-667.814) (-669.777) (-666.623) * (-667.700) (-669.390) [-669.603] (-671.974) -- 0:00:17
706500 -- [-669.330] (-668.095) (-670.931) (-669.948) * (-668.968) (-671.585) [-669.805] (-669.089) -- 0:00:17
707000 -- (-674.890) [-669.525] (-669.397) (-670.684) * (-672.650) (-668.491) (-670.089) [-669.073] -- 0:00:17
707500 -- (-668.946) [-668.108] (-670.516) (-668.457) * (-672.406) (-672.368) [-672.226] (-667.389) -- 0:00:17
708000 -- (-670.696) (-668.772) (-668.858) [-667.758] * [-670.163] (-668.563) (-667.961) (-667.411) -- 0:00:17
708500 -- [-670.543] (-673.815) (-667.630) (-669.765) * [-668.782] (-668.263) (-672.904) (-669.799) -- 0:00:17
709000 -- (-670.405) [-669.755] (-666.730) (-673.305) * (-668.430) (-671.583) (-670.454) [-671.361] -- 0:00:17
709500 -- [-668.008] (-673.014) (-671.633) (-669.563) * (-667.624) (-670.176) (-667.722) [-673.470] -- 0:00:17
710000 -- (-667.115) (-669.383) (-668.780) [-668.114] * (-669.321) [-669.324] (-666.787) (-668.813) -- 0:00:17
Average standard deviation of split frequencies: 0.009826
710500 -- [-667.513] (-669.719) (-670.121) (-668.042) * (-668.031) (-667.121) (-667.386) [-671.101] -- 0:00:17
711000 -- (-667.650) [-667.491] (-669.078) (-669.922) * (-669.906) [-669.267] (-672.719) (-669.862) -- 0:00:17
711500 -- [-668.708] (-667.645) (-670.469) (-670.769) * (-668.108) (-667.614) [-668.419] (-669.986) -- 0:00:17
712000 -- (-667.755) [-667.973] (-673.233) (-673.751) * [-668.154] (-671.291) (-667.670) (-667.724) -- 0:00:17
712500 -- (-668.677) (-672.235) (-667.610) [-668.569] * (-670.197) (-667.636) (-668.738) [-669.036] -- 0:00:17
713000 -- [-667.955] (-669.989) (-668.328) (-668.854) * [-669.733] (-669.202) (-672.874) (-669.760) -- 0:00:17
713500 -- (-672.288) [-669.475] (-670.229) (-669.906) * (-667.534) (-675.832) (-668.881) [-667.310] -- 0:00:17
714000 -- (-667.799) [-668.638] (-668.511) (-671.356) * [-669.639] (-673.278) (-667.940) (-669.632) -- 0:00:17
714500 -- (-667.349) (-668.048) [-671.038] (-669.153) * (-667.394) [-667.980] (-670.082) (-669.240) -- 0:00:17
715000 -- (-670.191) [-669.823] (-669.859) (-667.837) * (-668.784) [-668.890] (-668.800) (-667.508) -- 0:00:17
Average standard deviation of split frequencies: 0.010805
715500 -- [-673.722] (-668.903) (-670.799) (-667.195) * [-670.087] (-671.999) (-667.821) (-668.504) -- 0:00:17
716000 -- (-674.589) (-669.754) (-674.000) [-668.442] * (-668.680) (-671.620) (-667.547) [-668.004] -- 0:00:17
716500 -- (-669.851) [-666.817] (-672.123) (-668.370) * [-667.102] (-668.205) (-667.507) (-667.032) -- 0:00:17
717000 -- [-667.514] (-669.213) (-669.220) (-668.281) * (-667.446) [-668.603] (-670.029) (-667.360) -- 0:00:16
717500 -- (-668.034) (-672.542) [-668.554] (-669.350) * (-672.156) (-671.194) (-671.660) [-668.768] -- 0:00:16
718000 -- [-667.180] (-670.376) (-667.913) (-667.231) * (-669.349) (-669.040) [-670.080] (-672.168) -- 0:00:16
718500 -- (-671.446) [-669.566] (-667.611) (-667.387) * (-668.727) (-670.090) [-667.022] (-668.578) -- 0:00:16
719000 -- (-669.750) [-668.532] (-668.854) (-667.594) * (-669.096) (-667.788) [-667.252] (-668.287) -- 0:00:16
719500 -- (-669.223) [-668.395] (-670.170) (-668.502) * [-669.165] (-668.536) (-668.302) (-670.935) -- 0:00:17
720000 -- (-668.762) (-669.192) [-670.193] (-671.513) * (-668.698) [-666.837] (-667.730) (-669.962) -- 0:00:17
Average standard deviation of split frequencies: 0.009853
720500 -- (-670.189) (-667.294) (-669.778) [-672.278] * (-668.880) (-667.795) (-669.663) [-667.118] -- 0:00:17
721000 -- (-667.944) [-667.739] (-672.570) (-667.170) * [-668.292] (-667.349) (-669.224) (-669.622) -- 0:00:17
721500 -- (-669.204) [-667.652] (-668.692) (-668.116) * (-666.576) [-668.944] (-667.822) (-669.539) -- 0:00:16
722000 -- (-668.180) (-669.185) [-669.192] (-668.780) * [-666.815] (-667.562) (-670.903) (-673.577) -- 0:00:16
722500 -- (-668.849) [-666.915] (-668.335) (-668.974) * (-668.420) (-669.254) (-673.791) [-667.096] -- 0:00:16
723000 -- [-670.640] (-667.090) (-667.439) (-669.958) * [-669.544] (-669.829) (-669.362) (-670.580) -- 0:00:16
723500 -- [-667.786] (-669.269) (-667.894) (-667.759) * (-670.309) [-668.704] (-669.540) (-669.490) -- 0:00:16
724000 -- (-668.787) (-668.530) (-667.212) [-668.148] * [-668.352] (-668.560) (-670.291) (-671.530) -- 0:00:16
724500 -- (-667.174) (-669.511) (-672.439) [-668.113] * (-669.913) (-668.417) [-669.421] (-670.873) -- 0:00:16
725000 -- (-669.813) (-667.069) [-668.421] (-667.623) * (-667.660) (-669.165) [-667.821] (-668.482) -- 0:00:16
Average standard deviation of split frequencies: 0.009983
725500 -- [-668.570] (-668.371) (-668.446) (-666.937) * [-667.229] (-669.338) (-669.714) (-668.365) -- 0:00:16
726000 -- (-669.509) [-667.951] (-673.210) (-667.187) * (-669.706) [-667.334] (-667.919) (-666.906) -- 0:00:16
726500 -- [-668.131] (-667.776) (-667.879) (-668.539) * (-673.332) [-666.839] (-667.885) (-668.971) -- 0:00:16
727000 -- (-668.793) [-672.115] (-669.293) (-669.490) * (-673.022) (-672.791) (-669.643) [-668.827] -- 0:00:16
727500 -- [-669.616] (-672.252) (-671.647) (-668.082) * (-669.408) [-670.967] (-670.764) (-667.999) -- 0:00:16
728000 -- [-669.155] (-670.972) (-669.440) (-668.230) * (-668.997) [-668.930] (-668.566) (-671.399) -- 0:00:16
728500 -- [-667.590] (-669.187) (-671.000) (-668.564) * (-668.960) [-673.578] (-667.298) (-672.402) -- 0:00:16
729000 -- (-669.132) (-667.589) (-670.393) [-668.739] * [-669.542] (-671.412) (-667.355) (-667.996) -- 0:00:16
729500 -- (-668.955) (-668.509) (-667.644) [-669.435] * (-670.076) (-667.020) [-667.926] (-668.573) -- 0:00:16
730000 -- (-671.096) (-672.393) [-666.791] (-669.381) * [-668.234] (-668.087) (-667.057) (-667.584) -- 0:00:16
Average standard deviation of split frequencies: 0.010161
730500 -- (-670.153) (-670.950) (-667.578) [-667.751] * (-668.250) [-669.794] (-668.897) (-667.685) -- 0:00:16
731000 -- (-671.413) (-671.804) (-667.445) [-672.906] * (-671.680) (-668.374) [-668.207] (-668.760) -- 0:00:16
731500 -- (-671.602) (-670.681) [-672.088] (-672.889) * (-669.918) [-666.661] (-670.579) (-669.688) -- 0:00:16
732000 -- [-671.034] (-668.213) (-667.138) (-669.774) * (-667.735) [-667.384] (-668.688) (-673.355) -- 0:00:16
732500 -- (-668.760) [-669.507] (-668.554) (-672.791) * (-670.352) [-666.654] (-670.110) (-667.470) -- 0:00:16
733000 -- (-667.264) (-669.542) (-668.047) [-671.713] * (-669.832) [-667.069] (-670.006) (-669.822) -- 0:00:16
733500 -- (-670.166) (-668.518) (-670.117) [-670.509] * (-672.795) (-669.635) (-674.537) [-669.182] -- 0:00:15
734000 -- (-669.440) (-672.432) (-667.687) [-669.560] * (-671.409) (-668.595) (-667.416) [-668.459] -- 0:00:15
734500 -- (-669.151) (-670.531) (-672.542) [-670.400] * (-667.836) [-667.221] (-673.417) (-672.086) -- 0:00:15
735000 -- (-668.483) (-668.734) [-668.263] (-670.466) * (-668.319) [-668.128] (-667.581) (-669.328) -- 0:00:15
Average standard deviation of split frequencies: 0.011604
735500 -- (-669.314) [-668.261] (-668.826) (-667.310) * (-670.661) (-667.428) [-671.098] (-669.526) -- 0:00:15
736000 -- (-668.436) (-674.219) (-667.877) [-669.489] * (-668.357) [-668.808] (-669.995) (-669.074) -- 0:00:15
736500 -- [-666.664] (-671.534) (-670.352) (-670.985) * (-671.324) (-671.819) [-668.880] (-667.327) -- 0:00:16
737000 -- (-667.000) [-670.226] (-674.109) (-669.105) * (-668.898) [-668.402] (-668.250) (-667.468) -- 0:00:16
737500 -- [-669.208] (-670.814) (-668.188) (-669.446) * [-668.135] (-668.228) (-671.450) (-670.805) -- 0:00:16
738000 -- (-667.809) (-667.591) [-673.755] (-672.841) * (-668.496) (-672.983) (-669.182) [-670.228] -- 0:00:15
738500 -- (-669.291) [-668.926] (-674.751) (-673.710) * [-670.127] (-673.932) (-669.364) (-668.021) -- 0:00:15
739000 -- [-669.835] (-670.368) (-668.928) (-673.391) * (-668.330) (-669.071) [-666.701] (-668.119) -- 0:00:15
739500 -- (-671.598) (-667.831) (-670.711) [-669.186] * (-668.554) (-670.702) [-671.417] (-668.279) -- 0:00:15
740000 -- (-671.510) (-671.354) [-669.757] (-667.464) * (-668.542) (-669.013) [-670.810] (-669.505) -- 0:00:15
Average standard deviation of split frequencies: 0.011606
740500 -- (-669.421) (-668.914) [-667.408] (-667.157) * (-667.378) (-671.405) (-669.279) [-670.005] -- 0:00:15
741000 -- (-669.353) [-669.658] (-669.299) (-666.829) * (-669.572) (-671.005) (-667.294) [-669.051] -- 0:00:15
741500 -- (-672.208) (-669.387) (-669.192) [-668.753] * (-668.493) (-673.017) (-669.455) [-669.051] -- 0:00:15
742000 -- (-671.624) (-668.385) [-669.052] (-671.351) * (-668.091) (-670.672) [-668.304] (-667.877) -- 0:00:15
742500 -- (-672.934) (-672.345) [-667.949] (-669.550) * (-667.640) (-671.391) [-667.996] (-667.865) -- 0:00:15
743000 -- [-667.321] (-669.971) (-668.631) (-670.274) * (-667.272) (-669.740) (-667.092) [-671.566] -- 0:00:15
743500 -- (-672.129) (-669.285) (-670.036) [-668.172] * (-667.000) (-667.033) [-667.639] (-671.111) -- 0:00:15
744000 -- (-672.230) (-667.335) [-667.657] (-671.204) * (-669.755) (-669.588) [-668.531] (-671.783) -- 0:00:15
744500 -- (-675.278) (-667.141) [-667.575] (-668.429) * (-670.500) [-670.900] (-668.865) (-669.933) -- 0:00:15
745000 -- (-669.213) (-667.998) [-668.260] (-668.501) * (-669.145) (-669.648) (-667.840) [-669.390] -- 0:00:15
Average standard deviation of split frequencies: 0.011412
745500 -- (-673.805) (-669.937) [-668.187] (-671.081) * (-668.980) (-667.241) [-669.709] (-667.264) -- 0:00:15
746000 -- (-670.946) (-671.909) [-668.679] (-667.187) * (-666.945) (-668.094) [-669.636] (-666.943) -- 0:00:15
746500 -- (-667.547) [-667.691] (-668.666) (-671.800) * (-672.109) (-667.753) (-671.759) [-668.638] -- 0:00:15
747000 -- (-670.391) (-671.810) (-669.726) [-668.052] * (-667.591) (-667.797) [-672.700] (-667.037) -- 0:00:15
747500 -- [-667.287] (-668.787) (-668.445) (-668.915) * (-667.646) (-670.278) [-668.596] (-669.281) -- 0:00:15
748000 -- (-670.224) [-672.027] (-668.570) (-669.036) * [-669.494] (-666.754) (-668.086) (-668.241) -- 0:00:15
748500 -- (-669.920) (-669.545) (-669.943) [-668.461] * [-668.674] (-667.704) (-668.816) (-668.073) -- 0:00:15
749000 -- (-669.203) (-666.899) [-672.749] (-667.559) * (-671.954) [-669.507] (-670.714) (-673.468) -- 0:00:15
749500 -- (-667.554) (-671.170) [-667.269] (-672.658) * (-670.863) (-669.848) [-670.652] (-669.807) -- 0:00:15
750000 -- (-669.727) [-669.218] (-668.437) (-668.968) * (-669.738) (-671.369) [-668.088] (-668.884) -- 0:00:15
Average standard deviation of split frequencies: 0.010597
750500 -- [-668.726] (-668.751) (-668.815) (-667.957) * (-667.448) (-671.093) [-670.292] (-668.307) -- 0:00:14
751000 -- (-666.812) (-667.350) (-668.112) [-667.995] * (-669.325) (-667.431) [-668.939] (-670.361) -- 0:00:14
751500 -- (-669.420) [-668.342] (-671.849) (-668.600) * (-669.196) (-667.905) [-668.625] (-673.612) -- 0:00:14
752000 -- (-669.965) (-669.536) (-669.628) [-669.208] * [-670.726] (-671.721) (-669.280) (-669.737) -- 0:00:14
752500 -- (-669.336) (-667.441) (-675.826) [-672.598] * (-669.192) [-669.186] (-672.172) (-669.501) -- 0:00:14
753000 -- (-669.690) [-667.300] (-674.863) (-668.472) * (-673.873) (-667.609) [-669.831] (-671.715) -- 0:00:14
753500 -- (-672.707) (-670.833) [-667.930] (-667.917) * (-669.224) (-668.795) [-670.278] (-669.880) -- 0:00:15
754000 -- (-671.663) (-672.155) [-666.720] (-669.080) * (-669.568) (-668.428) (-668.572) [-669.900] -- 0:00:15
754500 -- [-669.116] (-669.089) (-670.532) (-668.921) * [-667.561] (-671.683) (-667.899) (-669.325) -- 0:00:14
755000 -- (-672.425) [-668.565] (-668.339) (-670.988) * (-669.856) (-671.266) [-670.585] (-668.948) -- 0:00:14
Average standard deviation of split frequencies: 0.010328
755500 -- (-674.157) (-667.626) (-667.473) [-668.945] * [-667.527] (-669.260) (-671.423) (-668.288) -- 0:00:14
756000 -- [-671.241] (-668.838) (-667.447) (-671.455) * (-667.762) (-669.042) [-669.881] (-668.766) -- 0:00:14
756500 -- (-671.152) [-666.979] (-667.375) (-668.976) * (-669.074) (-671.600) (-668.121) [-670.281] -- 0:00:14
757000 -- (-673.208) [-670.712] (-667.487) (-669.488) * [-669.821] (-671.293) (-669.175) (-669.357) -- 0:00:14
757500 -- [-668.722] (-669.229) (-667.771) (-669.272) * (-667.355) (-668.380) [-668.215] (-669.760) -- 0:00:14
758000 -- (-667.612) (-668.575) (-667.551) [-667.290] * [-669.229] (-668.392) (-669.082) (-669.468) -- 0:00:14
758500 -- (-667.487) (-670.046) (-669.468) [-667.444] * [-667.836] (-668.183) (-669.096) (-667.846) -- 0:00:14
759000 -- (-667.878) (-669.495) [-667.006] (-672.079) * (-672.413) (-670.381) [-670.559] (-669.714) -- 0:00:14
759500 -- (-666.934) (-672.470) (-670.116) [-669.100] * (-670.035) (-667.695) (-673.666) [-669.164] -- 0:00:14
760000 -- (-667.836) (-670.311) (-668.486) [-669.845] * (-669.465) [-667.785] (-670.198) (-669.697) -- 0:00:14
Average standard deviation of split frequencies: 0.010900
760500 -- (-671.553) [-668.464] (-668.242) (-670.271) * (-667.308) [-669.290] (-669.235) (-667.984) -- 0:00:14
761000 -- [-668.704] (-669.592) (-667.895) (-667.380) * (-670.005) (-673.747) (-669.754) [-669.297] -- 0:00:14
761500 -- (-667.228) [-668.885] (-670.154) (-669.630) * (-668.136) (-672.319) [-669.679] (-669.044) -- 0:00:14
762000 -- (-667.427) (-670.747) [-669.659] (-668.364) * (-668.476) (-671.716) (-674.206) [-668.482] -- 0:00:14
762500 -- (-670.030) [-670.800] (-669.388) (-668.473) * (-669.576) (-670.747) (-671.517) [-669.418] -- 0:00:14
763000 -- (-669.793) [-669.518] (-668.670) (-669.553) * (-670.647) (-666.882) (-670.744) [-672.373] -- 0:00:14
763500 -- (-668.161) [-667.423] (-670.961) (-670.310) * (-670.730) [-667.725] (-672.639) (-669.228) -- 0:00:14
764000 -- (-675.200) (-675.239) (-669.394) [-670.004] * (-668.286) (-669.971) (-669.845) [-667.848] -- 0:00:14
764500 -- [-671.790] (-669.579) (-669.592) (-670.320) * (-668.952) (-670.175) [-668.191] (-670.597) -- 0:00:14
765000 -- (-670.564) [-668.747] (-670.098) (-672.346) * (-672.441) [-668.319] (-667.686) (-669.956) -- 0:00:14
Average standard deviation of split frequencies: 0.011150
765500 -- (-669.977) (-667.514) [-670.833] (-669.457) * (-670.409) (-667.667) (-669.852) [-668.414] -- 0:00:14
766000 -- (-670.421) (-668.640) (-671.291) [-670.099] * (-668.919) [-667.667] (-668.111) (-669.264) -- 0:00:14
766500 -- (-668.674) (-667.523) [-669.394] (-668.871) * [-667.641] (-668.395) (-669.230) (-670.438) -- 0:00:14
767000 -- [-668.771] (-667.515) (-667.740) (-668.147) * (-667.268) (-669.070) (-668.440) [-669.216] -- 0:00:13
767500 -- (-667.547) (-670.982) [-669.465] (-669.134) * (-669.821) (-668.165) (-669.304) [-668.818] -- 0:00:13
768000 -- (-669.759) (-668.919) (-674.079) [-671.233] * (-669.190) [-669.544] (-668.463) (-668.180) -- 0:00:13
768500 -- (-668.065) [-670.028] (-676.078) (-669.056) * (-669.074) [-668.417] (-669.739) (-667.972) -- 0:00:13
769000 -- (-667.926) (-667.722) [-673.272] (-669.130) * (-671.398) [-668.825] (-668.758) (-668.758) -- 0:00:13
769500 -- (-668.750) [-668.834] (-666.995) (-669.574) * (-668.822) (-685.008) (-668.167) [-670.693] -- 0:00:13
770000 -- [-670.123] (-668.747) (-668.404) (-667.888) * (-670.925) (-670.214) (-673.026) [-668.670] -- 0:00:14
Average standard deviation of split frequencies: 0.010207
770500 -- (-669.321) [-669.413] (-669.361) (-668.512) * (-681.815) [-668.257] (-675.549) (-669.925) -- 0:00:13
771000 -- (-669.861) (-667.617) [-669.067] (-668.110) * (-671.309) [-673.170] (-673.880) (-670.447) -- 0:00:13
771500 -- (-669.953) (-667.591) (-674.176) [-667.326] * (-668.286) (-669.910) [-667.115] (-668.370) -- 0:00:13
772000 -- (-669.346) (-674.518) (-670.100) [-667.646] * [-670.117] (-671.220) (-668.699) (-667.999) -- 0:00:13
772500 -- (-671.094) (-668.890) [-670.957] (-666.820) * [-667.321] (-670.119) (-667.811) (-670.436) -- 0:00:13
773000 -- (-668.758) (-669.759) [-670.223] (-666.846) * (-667.763) (-668.336) (-669.651) [-669.580] -- 0:00:13
773500 -- (-674.014) (-670.972) (-672.453) [-668.869] * (-670.103) (-669.799) [-671.519] (-668.288) -- 0:00:13
774000 -- (-667.173) (-670.393) [-668.621] (-671.465) * (-668.297) (-670.758) [-669.177] (-667.968) -- 0:00:13
774500 -- (-667.173) [-668.554] (-675.964) (-668.628) * (-668.281) (-669.208) [-670.319] (-668.589) -- 0:00:13
775000 -- (-667.429) (-666.926) [-667.536] (-669.576) * (-669.447) (-668.587) (-669.661) [-671.570] -- 0:00:13
Average standard deviation of split frequencies: 0.010099
775500 -- (-667.297) (-667.052) [-670.461] (-667.894) * [-669.879] (-668.878) (-670.858) (-669.821) -- 0:00:13
776000 -- (-668.184) (-668.904) (-667.272) [-668.134] * (-670.416) (-669.161) (-673.266) [-667.344] -- 0:00:13
776500 -- [-667.657] (-670.103) (-670.526) (-675.097) * (-667.386) (-671.591) [-667.460] (-673.381) -- 0:00:13
777000 -- (-668.429) (-667.664) (-669.716) [-668.773] * (-671.023) [-667.214] (-668.405) (-668.538) -- 0:00:13
777500 -- [-668.946] (-667.897) (-672.132) (-668.873) * [-669.873] (-667.626) (-668.150) (-671.501) -- 0:00:13
778000 -- (-668.475) (-667.746) (-670.661) [-667.147] * (-668.687) [-668.156] (-672.333) (-669.594) -- 0:00:13
778500 -- (-668.443) [-669.618] (-669.937) (-667.156) * (-669.226) [-669.669] (-669.704) (-668.248) -- 0:00:13
779000 -- (-673.709) (-667.666) (-667.803) [-668.347] * (-668.597) (-667.371) [-668.300] (-668.250) -- 0:00:13
779500 -- (-669.109) (-666.536) [-670.822] (-667.399) * (-671.013) (-668.486) (-669.486) [-667.512] -- 0:00:13
780000 -- (-670.066) [-667.393] (-669.830) (-667.537) * (-671.393) [-667.523] (-668.984) (-672.554) -- 0:00:13
Average standard deviation of split frequencies: 0.009888
780500 -- (-669.265) (-667.878) (-670.350) [-668.422] * (-668.476) (-669.815) (-668.111) [-669.337] -- 0:00:13
781000 -- (-670.194) (-668.592) [-668.631] (-668.784) * (-668.104) (-668.753) [-667.766] (-672.134) -- 0:00:13
781500 -- (-668.558) (-671.050) (-667.613) [-667.265] * (-669.523) (-670.053) [-668.572] (-669.976) -- 0:00:13
782000 -- (-668.353) [-668.867] (-668.346) (-671.005) * (-669.558) (-666.976) [-671.659] (-669.888) -- 0:00:13
782500 -- (-668.809) [-668.086] (-670.587) (-670.448) * (-670.713) (-668.703) [-667.038] (-668.861) -- 0:00:13
783000 -- (-667.942) (-671.187) [-667.772] (-670.271) * (-669.711) (-668.166) [-667.984] (-667.153) -- 0:00:13
783500 -- (-668.059) (-668.506) (-669.335) [-671.388] * (-668.353) [-667.899] (-668.657) (-670.074) -- 0:00:12
784000 -- (-669.611) (-667.646) [-667.934] (-670.099) * (-668.277) (-667.723) [-667.027] (-668.794) -- 0:00:12
784500 -- [-670.616] (-671.147) (-668.418) (-668.399) * [-668.931] (-667.266) (-667.709) (-667.142) -- 0:00:12
785000 -- (-670.478) (-669.818) (-670.942) [-668.359] * [-668.437] (-670.071) (-671.917) (-667.831) -- 0:00:12
Average standard deviation of split frequencies: 0.009933
785500 -- (-670.619) (-667.612) [-667.848] (-667.830) * (-668.572) (-667.392) (-666.692) [-668.812] -- 0:00:12
786000 -- (-668.647) (-668.103) (-672.425) [-668.364] * (-667.809) [-669.541] (-667.232) (-668.115) -- 0:00:12
786500 -- (-669.426) [-668.558] (-668.577) (-668.375) * (-668.991) (-670.058) (-669.544) [-668.010] -- 0:00:12
787000 -- (-667.417) [-670.287] (-668.261) (-670.038) * (-668.483) (-670.781) [-668.001] (-670.746) -- 0:00:12
787500 -- (-669.108) (-668.629) [-667.595] (-670.688) * [-668.137] (-668.240) (-668.448) (-669.422) -- 0:00:12
788000 -- [-672.217] (-666.820) (-666.760) (-668.800) * (-668.875) (-668.452) [-670.015] (-669.561) -- 0:00:12
788500 -- (-668.841) (-670.699) (-668.605) [-668.040] * [-669.419] (-669.367) (-669.045) (-668.994) -- 0:00:12
789000 -- (-667.470) (-670.883) [-668.361] (-669.975) * (-667.652) (-671.705) (-667.617) [-667.232] -- 0:00:12
789500 -- (-667.958) (-668.218) [-669.147] (-670.585) * (-668.164) (-670.040) (-669.529) [-669.212] -- 0:00:12
790000 -- (-672.959) (-670.241) [-668.220] (-670.213) * (-668.259) (-669.232) [-669.206] (-671.227) -- 0:00:12
Average standard deviation of split frequencies: 0.010173
790500 -- (-668.649) (-675.015) (-668.013) [-668.032] * (-670.292) (-667.637) [-667.467] (-675.749) -- 0:00:12
791000 -- (-666.706) (-670.044) (-668.681) [-669.529] * (-670.119) (-669.345) (-669.172) [-667.604] -- 0:00:12
791500 -- [-669.449] (-668.957) (-667.448) (-669.211) * (-670.300) [-670.599] (-672.271) (-671.935) -- 0:00:12
792000 -- (-669.960) [-667.151] (-667.423) (-671.132) * (-670.319) [-669.309] (-673.349) (-670.385) -- 0:00:12
792500 -- [-669.566] (-671.452) (-667.289) (-671.172) * (-672.909) [-668.000] (-669.608) (-670.898) -- 0:00:12
793000 -- (-673.096) (-675.859) [-668.288] (-668.431) * [-667.956] (-667.440) (-668.545) (-671.370) -- 0:00:12
793500 -- (-672.645) (-668.872) [-669.674] (-671.031) * (-667.567) [-667.134] (-667.776) (-669.498) -- 0:00:12
794000 -- [-669.576] (-668.232) (-671.063) (-669.128) * [-668.555] (-667.659) (-669.612) (-667.918) -- 0:00:12
794500 -- (-668.959) (-669.344) (-669.501) [-667.789] * [-668.798] (-668.654) (-670.173) (-668.524) -- 0:00:12
795000 -- (-671.679) (-666.845) [-668.934] (-669.627) * (-673.745) (-669.092) (-670.215) [-670.081] -- 0:00:12
Average standard deviation of split frequencies: 0.009735
795500 -- [-669.363] (-667.820) (-667.086) (-669.556) * (-670.926) [-667.794] (-668.836) (-668.473) -- 0:00:12
796000 -- (-669.876) (-671.346) (-668.138) [-669.888] * [-668.247] (-668.854) (-671.436) (-668.851) -- 0:00:12
796500 -- [-672.215] (-669.817) (-668.599) (-671.255) * (-667.592) (-669.926) (-670.123) [-668.799] -- 0:00:12
797000 -- (-668.366) (-669.369) [-667.800] (-669.468) * (-668.103) (-670.166) [-670.175] (-672.122) -- 0:00:12
797500 -- (-671.168) (-669.282) [-667.246] (-669.664) * (-668.635) [-667.228] (-667.617) (-667.475) -- 0:00:12
798000 -- (-668.725) (-669.660) [-668.033] (-671.067) * [-670.637] (-667.067) (-669.484) (-667.838) -- 0:00:12
798500 -- (-667.442) (-670.438) (-669.236) [-669.579] * (-669.965) (-667.491) [-668.677] (-670.575) -- 0:00:12
799000 -- [-667.935] (-673.942) (-668.063) (-670.871) * [-668.556] (-668.421) (-667.144) (-668.756) -- 0:00:12
799500 -- (-667.875) (-668.524) [-667.282] (-672.125) * [-668.218] (-669.299) (-668.554) (-668.927) -- 0:00:12
800000 -- (-667.500) (-671.059) [-667.778] (-670.024) * (-668.920) (-668.098) [-668.927] (-672.717) -- 0:00:12
Average standard deviation of split frequencies: 0.009641
800500 -- (-667.759) (-666.962) [-667.945] (-671.768) * (-668.174) (-669.747) (-670.765) [-667.805] -- 0:00:11
801000 -- (-669.075) (-670.747) [-667.267] (-672.191) * (-669.078) [-670.442] (-669.080) (-667.583) -- 0:00:11
801500 -- (-672.088) (-669.977) (-667.442) [-670.200] * (-670.256) (-666.899) [-669.699] (-670.994) -- 0:00:11
802000 -- (-669.957) (-668.538) (-668.348) [-671.576] * (-667.762) [-667.301] (-670.331) (-668.713) -- 0:00:11
802500 -- [-667.357] (-668.169) (-669.331) (-668.115) * (-671.530) (-668.285) (-672.977) [-668.386] -- 0:00:11
803000 -- (-670.388) (-668.343) (-666.885) [-668.974] * [-671.221] (-669.199) (-670.435) (-667.577) -- 0:00:11
803500 -- (-667.546) (-668.474) [-667.404] (-669.381) * [-667.588] (-668.467) (-669.128) (-670.398) -- 0:00:11
804000 -- (-668.936) [-667.228] (-667.849) (-669.072) * (-669.680) (-668.573) (-670.421) [-669.464] -- 0:00:11
804500 -- [-670.264] (-669.142) (-668.055) (-667.055) * (-667.380) [-668.570] (-670.239) (-668.837) -- 0:00:11
805000 -- (-668.015) (-668.581) [-667.354] (-666.930) * (-667.970) [-670.204] (-667.418) (-671.090) -- 0:00:11
Average standard deviation of split frequencies: 0.009321
805500 -- (-669.026) [-667.597] (-668.340) (-669.019) * [-667.456] (-671.939) (-668.738) (-667.894) -- 0:00:11
806000 -- (-670.862) (-668.642) [-668.275] (-670.492) * (-667.466) (-669.575) [-668.567] (-667.152) -- 0:00:11
806500 -- (-672.393) (-668.948) (-673.955) [-668.643] * (-671.370) [-670.086] (-667.973) (-667.257) -- 0:00:11
807000 -- (-672.741) (-668.248) (-669.444) [-667.128] * (-667.770) [-669.523] (-667.311) (-668.768) -- 0:00:11
807500 -- (-666.598) (-667.524) (-670.943) [-669.291] * (-673.175) [-672.204] (-668.365) (-668.407) -- 0:00:11
808000 -- [-667.477] (-669.510) (-668.493) (-667.246) * (-670.512) [-669.705] (-671.852) (-672.836) -- 0:00:11
808500 -- (-666.859) (-671.235) [-669.851] (-667.520) * (-669.250) [-668.215] (-671.993) (-668.000) -- 0:00:11
809000 -- (-669.163) [-667.068] (-667.176) (-667.706) * (-667.386) (-668.204) [-669.799] (-668.668) -- 0:00:11
809500 -- (-670.440) (-667.134) (-671.849) [-666.690] * (-668.878) (-668.889) [-668.529] (-666.778) -- 0:00:11
810000 -- (-669.048) (-666.971) (-667.876) [-668.986] * (-669.548) (-669.942) (-668.611) [-668.526] -- 0:00:11
Average standard deviation of split frequencies: 0.009522
810500 -- [-669.905] (-669.675) (-667.895) (-667.491) * (-669.412) [-668.172] (-669.294) (-668.225) -- 0:00:11
811000 -- [-668.826] (-668.400) (-668.940) (-667.215) * (-670.190) (-670.309) [-672.704] (-668.057) -- 0:00:11
811500 -- (-668.918) (-671.774) [-668.297] (-671.400) * [-670.003] (-669.346) (-667.464) (-673.332) -- 0:00:11
812000 -- (-669.316) [-668.387] (-672.639) (-673.728) * (-669.726) [-671.352] (-668.165) (-672.123) -- 0:00:11
812500 -- (-666.707) [-666.883] (-668.949) (-671.966) * (-669.535) [-670.388] (-667.743) (-667.566) -- 0:00:11
813000 -- [-669.143] (-669.557) (-672.153) (-668.852) * [-667.361] (-671.515) (-668.565) (-668.287) -- 0:00:11
813500 -- (-668.031) [-667.578] (-672.027) (-672.234) * (-667.513) (-670.221) [-667.899] (-670.143) -- 0:00:11
814000 -- (-668.723) (-671.072) [-671.210] (-669.762) * (-668.584) (-672.669) (-667.259) [-668.512] -- 0:00:11
814500 -- (-669.260) (-669.737) (-667.091) [-667.351] * [-668.700] (-667.721) (-669.421) (-669.664) -- 0:00:11
815000 -- [-667.050] (-669.670) (-668.579) (-668.642) * (-668.834) [-667.388] (-670.095) (-667.418) -- 0:00:11
Average standard deviation of split frequencies: 0.009640
815500 -- [-669.898] (-668.179) (-667.483) (-667.521) * (-669.491) (-670.302) [-668.641] (-667.484) -- 0:00:11
816000 -- (-669.777) (-672.302) [-670.700] (-667.128) * [-672.261] (-669.627) (-670.100) (-669.211) -- 0:00:11
816500 -- (-675.814) (-668.794) [-671.147] (-669.235) * (-668.263) (-671.768) [-672.408] (-667.020) -- 0:00:11
817000 -- (-669.921) (-668.934) [-670.050] (-667.811) * (-667.554) [-672.938] (-669.694) (-668.217) -- 0:00:10
817500 -- (-670.032) (-669.644) (-667.086) [-671.550] * (-668.355) (-672.370) [-667.074] (-669.790) -- 0:00:10
818000 -- (-669.583) [-668.835] (-667.528) (-668.766) * [-670.371] (-668.832) (-667.444) (-670.180) -- 0:00:10
818500 -- [-668.578] (-668.560) (-671.586) (-667.865) * (-668.867) [-668.131] (-669.236) (-669.756) -- 0:00:10
819000 -- (-668.630) (-671.134) (-668.877) [-669.382] * (-670.127) (-669.341) (-668.896) [-669.462] -- 0:00:10
819500 -- (-674.591) [-668.358] (-667.080) (-667.911) * (-666.960) [-668.465] (-668.573) (-670.302) -- 0:00:10
820000 -- (-673.893) [-669.348] (-670.335) (-667.639) * (-666.850) (-668.176) (-668.075) [-668.165] -- 0:00:10
Average standard deviation of split frequencies: 0.010016
820500 -- (-672.559) (-669.705) [-669.095] (-666.884) * (-669.411) [-669.257] (-671.877) (-670.399) -- 0:00:10
821000 -- (-669.654) (-669.193) (-669.345) [-671.104] * [-670.695] (-669.635) (-670.770) (-666.721) -- 0:00:10
821500 -- [-672.450] (-669.024) (-668.696) (-669.230) * [-670.531] (-668.519) (-668.678) (-667.721) -- 0:00:10
822000 -- (-671.238) (-669.132) (-671.035) [-668.302] * [-668.962] (-669.845) (-667.264) (-666.901) -- 0:00:10
822500 -- (-671.073) (-669.490) (-671.454) [-667.797] * (-670.891) [-669.917] (-667.379) (-670.678) -- 0:00:10
823000 -- (-667.849) (-669.923) [-670.868] (-667.917) * (-669.436) [-670.541] (-668.660) (-670.326) -- 0:00:10
823500 -- [-670.079] (-667.758) (-672.413) (-669.520) * (-673.023) [-671.192] (-672.242) (-668.117) -- 0:00:10
824000 -- (-670.684) (-667.389) (-671.130) [-669.537] * (-668.368) (-670.530) [-668.596] (-666.937) -- 0:00:10
824500 -- (-668.982) [-667.823] (-667.921) (-669.452) * (-668.764) (-670.244) (-667.756) [-666.669] -- 0:00:10
825000 -- (-668.738) (-667.811) (-667.644) [-671.353] * (-669.465) (-669.582) (-669.880) [-667.384] -- 0:00:10
Average standard deviation of split frequencies: 0.009987
825500 -- [-667.905] (-670.327) (-669.368) (-670.118) * [-671.623] (-666.863) (-667.686) (-670.240) -- 0:00:10
826000 -- (-668.825) (-669.965) [-668.572] (-670.988) * (-671.225) (-666.865) (-669.582) [-671.270] -- 0:00:10
826500 -- (-669.776) [-668.757] (-668.099) (-671.100) * (-667.761) [-668.835] (-669.680) (-668.157) -- 0:00:10
827000 -- [-668.976] (-668.065) (-668.444) (-670.386) * (-667.649) [-668.175] (-667.579) (-667.760) -- 0:00:10
827500 -- [-669.405] (-668.093) (-673.372) (-670.065) * (-670.490) (-669.722) [-667.789] (-667.807) -- 0:00:10
828000 -- (-670.964) [-667.853] (-669.286) (-669.694) * (-669.508) (-670.696) [-667.526] (-667.309) -- 0:00:10
828500 -- [-668.294] (-671.049) (-668.182) (-671.129) * (-667.474) (-670.074) [-668.746] (-668.467) -- 0:00:10
829000 -- (-669.824) (-670.426) [-669.793] (-669.544) * [-666.933] (-669.240) (-668.368) (-667.188) -- 0:00:10
829500 -- (-670.592) (-667.543) (-673.613) [-668.195] * (-671.896) (-669.607) (-667.489) [-668.710] -- 0:00:10
830000 -- (-668.751) [-671.373] (-668.821) (-669.382) * (-666.723) (-669.327) [-667.465] (-669.692) -- 0:00:10
Average standard deviation of split frequencies: 0.010109
830500 -- (-670.755) (-670.170) (-668.197) [-667.905] * (-670.065) [-667.801] (-667.737) (-668.228) -- 0:00:10
831000 -- [-670.429] (-667.538) (-669.195) (-668.722) * (-670.826) (-672.735) (-672.182) [-669.714] -- 0:00:10
831500 -- (-668.614) (-667.525) [-668.835] (-668.181) * (-668.242) [-668.090] (-667.214) (-669.821) -- 0:00:10
832000 -- (-676.292) [-671.285] (-669.922) (-669.189) * (-669.595) (-672.147) (-670.603) [-668.463] -- 0:00:10
832500 -- (-669.429) (-670.774) [-671.187] (-667.848) * (-667.683) [-669.416] (-670.104) (-669.814) -- 0:00:10
833000 -- [-667.797] (-669.706) (-669.701) (-672.133) * (-668.542) (-673.411) (-671.262) [-674.068] -- 0:00:10
833500 -- (-668.129) (-668.209) [-667.620] (-668.719) * (-668.400) [-668.496] (-671.145) (-668.575) -- 0:00:09
834000 -- [-669.280] (-669.207) (-669.226) (-667.171) * (-670.540) (-668.705) [-669.212] (-667.389) -- 0:00:09
834500 -- (-670.594) (-666.945) (-669.768) [-668.814] * [-668.840] (-671.086) (-667.642) (-667.904) -- 0:00:09
835000 -- [-667.183] (-669.241) (-669.605) (-667.980) * (-670.299) [-667.355] (-667.215) (-674.244) -- 0:00:09
Average standard deviation of split frequencies: 0.009339
835500 -- [-669.580] (-670.658) (-667.621) (-669.106) * (-669.493) (-667.780) [-668.630] (-670.713) -- 0:00:09
836000 -- (-669.355) [-667.667] (-669.401) (-668.792) * [-670.361] (-668.166) (-668.195) (-668.751) -- 0:00:09
836500 -- (-667.107) (-667.844) [-669.401] (-668.526) * (-672.198) [-670.312] (-669.083) (-667.678) -- 0:00:09
837000 -- (-667.178) (-671.589) (-671.182) [-669.194] * [-667.975] (-669.788) (-672.868) (-669.016) -- 0:00:09
837500 -- (-668.257) (-670.573) [-667.711] (-668.033) * (-671.775) (-670.158) (-672.006) [-667.946] -- 0:00:09
838000 -- (-669.290) [-667.593] (-666.701) (-667.847) * [-668.011] (-666.966) (-667.975) (-669.424) -- 0:00:09
838500 -- (-669.880) [-670.074] (-670.636) (-673.915) * [-667.876] (-669.406) (-668.948) (-669.315) -- 0:00:09
839000 -- (-670.401) [-667.425] (-668.681) (-669.141) * [-668.191] (-668.344) (-668.344) (-667.977) -- 0:00:09
839500 -- [-670.448] (-668.924) (-666.515) (-667.465) * [-667.780] (-669.861) (-668.384) (-668.721) -- 0:00:09
840000 -- (-668.159) (-667.548) (-666.613) [-667.758] * (-673.214) (-669.391) [-671.102] (-667.658) -- 0:00:09
Average standard deviation of split frequencies: 0.009673
840500 -- (-668.242) (-669.605) [-668.054] (-668.378) * (-668.467) (-667.293) [-670.005] (-670.392) -- 0:00:09
841000 -- (-668.395) (-670.898) [-667.625] (-668.739) * (-666.712) [-669.287] (-668.384) (-667.580) -- 0:00:09
841500 -- (-670.267) (-668.650) (-673.883) [-667.792] * [-666.791] (-673.264) (-669.626) (-668.722) -- 0:00:09
842000 -- [-667.443] (-669.359) (-675.109) (-666.923) * (-666.534) (-669.594) [-668.281] (-669.388) -- 0:00:09
842500 -- (-668.061) (-668.060) [-668.686] (-668.031) * (-672.257) (-671.084) [-668.061] (-672.112) -- 0:00:09
843000 -- (-666.604) (-670.216) (-670.316) [-667.972] * (-667.532) [-669.161] (-668.369) (-669.409) -- 0:00:09
843500 -- (-668.634) (-669.530) [-666.705] (-669.453) * (-668.568) (-668.819) [-673.022] (-668.342) -- 0:00:09
844000 -- (-669.501) [-667.463] (-667.650) (-670.487) * [-669.140] (-668.272) (-671.666) (-668.667) -- 0:00:09
844500 -- [-669.541] (-668.119) (-668.654) (-668.084) * (-669.248) [-667.037] (-670.456) (-670.777) -- 0:00:09
845000 -- (-667.422) (-667.195) [-669.186] (-670.383) * (-675.027) [-666.964] (-668.520) (-668.272) -- 0:00:09
Average standard deviation of split frequencies: 0.009507
845500 -- (-668.852) (-667.558) [-670.378] (-667.956) * [-668.760] (-668.912) (-671.792) (-670.157) -- 0:00:09
846000 -- (-668.069) (-670.194) [-667.837] (-670.598) * (-670.099) (-670.788) (-672.534) [-667.449] -- 0:00:09
846500 -- (-668.167) (-667.811) (-667.759) [-670.287] * (-670.593) (-668.344) (-669.709) [-668.313] -- 0:00:09
847000 -- (-667.662) (-667.980) (-668.042) [-668.430] * (-666.999) [-670.435] (-670.625) (-668.907) -- 0:00:09
847500 -- (-667.473) (-668.578) (-667.781) [-669.634] * (-667.642) [-668.299] (-667.251) (-676.980) -- 0:00:09
848000 -- (-667.297) [-668.914] (-668.900) (-670.530) * (-667.158) (-670.638) [-668.947] (-670.989) -- 0:00:09
848500 -- (-667.462) [-669.325] (-669.688) (-673.267) * [-667.282] (-668.061) (-667.090) (-668.110) -- 0:00:09
849000 -- [-669.985] (-671.251) (-668.455) (-667.298) * (-669.081) (-668.011) [-668.782] (-667.515) -- 0:00:09
849500 -- (-671.575) [-667.777] (-670.074) (-667.018) * [-669.016] (-671.621) (-669.890) (-667.931) -- 0:00:09
850000 -- [-669.403] (-668.030) (-667.862) (-667.418) * (-667.943) (-673.663) (-667.508) [-667.527] -- 0:00:09
Average standard deviation of split frequencies: 0.009248
850500 -- (-673.399) (-668.191) (-668.393) [-667.326] * (-668.541) (-668.857) (-668.931) [-668.302] -- 0:00:08
851000 -- (-670.079) (-671.561) [-668.942] (-668.441) * (-672.160) [-669.805] (-671.053) (-668.466) -- 0:00:08
851500 -- [-673.045] (-667.700) (-671.481) (-669.373) * (-667.501) [-667.704] (-667.179) (-667.918) -- 0:00:08
852000 -- (-668.657) (-666.738) [-669.384] (-667.750) * (-669.018) (-669.317) [-669.135] (-668.645) -- 0:00:08
852500 -- (-668.170) (-669.169) [-670.781] (-670.461) * (-672.229) (-668.815) [-668.769] (-668.668) -- 0:00:08
853000 -- (-670.504) [-667.709] (-668.809) (-668.543) * (-672.384) [-668.193] (-670.308) (-669.015) -- 0:00:08
853500 -- (-672.636) [-667.952] (-669.977) (-667.219) * (-668.541) (-671.089) [-668.139] (-668.548) -- 0:00:08
854000 -- [-668.956] (-667.011) (-670.304) (-668.775) * (-668.676) [-667.692] (-667.210) (-668.745) -- 0:00:08
854500 -- [-670.355] (-671.653) (-668.237) (-668.986) * [-668.431] (-668.587) (-671.266) (-668.245) -- 0:00:08
855000 -- (-670.220) (-668.452) (-668.249) [-669.686] * (-670.514) [-668.167] (-669.704) (-671.220) -- 0:00:08
Average standard deviation of split frequencies: 0.008708
855500 -- (-668.025) (-668.305) [-667.557] (-667.474) * (-673.348) (-669.130) (-667.800) [-668.152] -- 0:00:08
856000 -- (-668.209) (-669.559) (-667.361) [-668.247] * (-667.945) [-667.272] (-668.145) (-669.130) -- 0:00:08
856500 -- (-667.281) [-669.746] (-668.362) (-670.647) * (-670.973) [-667.761] (-668.423) (-668.693) -- 0:00:08
857000 -- (-668.188) (-671.084) [-668.247] (-674.928) * (-670.501) (-668.294) (-670.544) [-670.153] -- 0:00:08
857500 -- (-668.369) (-673.008) [-667.327] (-668.151) * (-669.519) (-667.342) (-667.751) [-669.741] -- 0:00:08
858000 -- (-669.410) [-667.093] (-668.758) (-668.612) * (-668.821) (-668.009) [-670.663] (-667.944) -- 0:00:08
858500 -- [-670.592] (-669.765) (-670.087) (-667.350) * (-669.387) (-668.320) (-669.366) [-667.872] -- 0:00:08
859000 -- (-670.600) (-672.048) [-667.772] (-669.144) * (-668.615) (-672.820) [-667.646] (-667.519) -- 0:00:08
859500 -- (-668.963) (-671.892) (-669.018) [-670.519] * (-668.066) (-671.504) [-667.713] (-668.598) -- 0:00:08
860000 -- (-671.426) [-667.877] (-670.004) (-672.950) * (-668.538) (-667.795) (-670.028) [-669.889] -- 0:00:08
Average standard deviation of split frequencies: 0.009072
860500 -- (-669.204) [-668.868] (-666.908) (-668.595) * (-667.312) (-673.391) (-666.975) [-668.089] -- 0:00:08
861000 -- (-666.834) [-667.359] (-667.439) (-668.573) * (-667.828) (-669.087) [-668.245] (-667.711) -- 0:00:08
861500 -- (-667.426) (-668.200) (-670.906) [-668.100] * (-667.225) (-667.930) [-667.912] (-668.920) -- 0:00:08
862000 -- (-667.486) [-669.202] (-669.921) (-668.454) * (-667.920) (-668.701) (-669.087) [-669.603] -- 0:00:08
862500 -- (-668.255) [-670.962] (-668.998) (-670.551) * (-668.801) (-669.086) (-669.663) [-669.084] -- 0:00:08
863000 -- (-669.136) (-670.025) [-668.404] (-668.841) * (-668.266) [-671.011] (-670.005) (-671.671) -- 0:00:08
863500 -- [-667.611] (-669.084) (-669.171) (-668.765) * (-670.457) [-667.946] (-674.572) (-669.878) -- 0:00:08
864000 -- (-670.275) [-667.972] (-669.323) (-674.189) * [-669.432] (-671.108) (-669.060) (-669.771) -- 0:00:08
864500 -- (-671.599) [-668.379] (-670.481) (-671.039) * (-668.747) (-667.530) (-670.736) [-667.144] -- 0:00:08
865000 -- (-671.473) [-671.067] (-669.876) (-669.256) * (-674.094) (-670.439) (-671.202) [-668.048] -- 0:00:08
Average standard deviation of split frequencies: 0.009050
865500 -- (-668.050) (-670.476) [-668.719] (-668.700) * (-668.558) (-669.677) [-672.062] (-667.610) -- 0:00:08
866000 -- (-666.842) (-668.081) [-668.124] (-667.873) * (-667.616) (-670.684) [-671.529] (-666.883) -- 0:00:08
866500 -- (-667.611) (-667.399) [-666.948] (-668.256) * (-669.213) [-668.405] (-670.119) (-667.892) -- 0:00:08
867000 -- (-670.441) [-666.941] (-671.145) (-670.837) * (-667.528) (-669.497) [-674.068] (-666.849) -- 0:00:07
867500 -- (-667.448) (-667.434) (-667.693) [-667.357] * (-668.179) (-667.846) [-668.422] (-670.754) -- 0:00:07
868000 -- (-671.018) (-667.439) [-668.404] (-667.820) * (-670.376) (-669.182) (-667.424) [-666.850] -- 0:00:07
868500 -- [-668.154] (-667.439) (-670.838) (-667.570) * (-668.785) (-671.260) (-675.396) [-667.372] -- 0:00:07
869000 -- (-668.367) [-667.349] (-671.928) (-669.199) * [-671.118] (-668.065) (-675.910) (-668.188) -- 0:00:07
869500 -- (-671.974) [-668.605] (-668.560) (-667.793) * (-671.990) [-668.718] (-669.682) (-667.501) -- 0:00:07
870000 -- (-668.313) [-668.824] (-669.394) (-670.543) * (-670.989) [-667.694] (-671.199) (-669.554) -- 0:00:07
Average standard deviation of split frequencies: 0.008900
870500 -- (-668.177) (-667.054) [-667.608] (-669.950) * (-671.474) [-671.672] (-669.252) (-669.841) -- 0:00:07
871000 -- [-670.534] (-668.293) (-668.222) (-667.096) * [-668.242] (-670.385) (-672.670) (-672.907) -- 0:00:07
871500 -- (-669.088) [-666.972] (-667.537) (-666.836) * (-667.907) [-667.777] (-670.414) (-670.894) -- 0:00:07
872000 -- [-669.809] (-669.461) (-667.563) (-669.401) * (-669.050) (-668.609) [-669.951] (-667.459) -- 0:00:07
872500 -- (-668.440) (-668.878) (-671.703) [-668.045] * (-670.995) (-672.592) (-668.425) [-669.580] -- 0:00:07
873000 -- (-668.999) (-669.581) (-669.816) [-668.722] * (-667.665) (-667.010) [-668.367] (-672.137) -- 0:00:07
873500 -- [-670.904] (-668.494) (-670.202) (-673.452) * [-666.830] (-667.818) (-667.363) (-668.376) -- 0:00:07
874000 -- (-670.648) (-667.485) [-670.191] (-669.053) * [-667.466] (-670.381) (-668.521) (-668.182) -- 0:00:07
874500 -- (-668.801) (-669.645) (-670.652) [-670.806] * (-669.583) (-671.117) [-668.543] (-674.370) -- 0:00:07
875000 -- (-668.443) [-667.859] (-668.903) (-669.321) * (-670.305) (-673.313) [-669.254] (-667.801) -- 0:00:07
Average standard deviation of split frequencies: 0.008711
875500 -- (-671.239) (-668.106) [-668.836] (-670.483) * (-669.356) (-669.121) [-668.020] (-669.728) -- 0:00:07
876000 -- (-670.006) (-668.560) (-670.353) [-669.546] * (-670.567) (-668.044) [-668.102] (-672.624) -- 0:00:07
876500 -- [-667.644] (-672.730) (-668.311) (-669.209) * (-669.168) (-666.729) (-667.591) [-668.531] -- 0:00:07
877000 -- [-668.075] (-668.426) (-670.062) (-671.302) * [-669.598] (-667.709) (-668.072) (-669.330) -- 0:00:07
877500 -- (-667.289) [-672.335] (-672.129) (-671.592) * [-666.776] (-668.404) (-667.589) (-669.295) -- 0:00:07
878000 -- (-668.246) (-669.159) [-673.354] (-667.874) * (-667.435) [-667.193] (-668.016) (-669.305) -- 0:00:07
878500 -- [-667.081] (-667.737) (-671.011) (-668.261) * [-670.291] (-670.025) (-667.733) (-668.864) -- 0:00:07
879000 -- (-669.998) [-669.114] (-673.731) (-668.117) * [-672.459] (-667.097) (-670.075) (-666.596) -- 0:00:07
879500 -- (-668.078) [-668.739] (-672.170) (-669.007) * (-667.764) (-669.315) (-667.871) [-667.892] -- 0:00:07
880000 -- (-668.150) (-668.298) (-667.672) [-670.347] * (-669.819) [-669.685] (-667.962) (-670.714) -- 0:00:07
Average standard deviation of split frequencies: 0.009066
880500 -- (-668.808) [-669.152] (-668.507) (-668.192) * (-667.829) [-670.539] (-668.976) (-671.623) -- 0:00:07
881000 -- (-670.860) (-666.733) [-667.054] (-666.773) * (-668.911) (-668.409) [-668.136] (-670.366) -- 0:00:07
881500 -- [-667.692] (-668.118) (-668.672) (-666.740) * (-670.396) (-667.771) (-668.785) [-669.324] -- 0:00:07
882000 -- (-672.634) (-669.155) [-668.559] (-668.654) * (-666.957) [-666.798] (-669.855) (-667.751) -- 0:00:07
882500 -- (-672.751) (-667.860) (-666.813) [-668.168] * (-669.390) (-668.844) [-672.685] (-674.371) -- 0:00:07
883000 -- (-668.882) [-669.736] (-667.569) (-667.374) * [-668.350] (-668.445) (-672.388) (-666.667) -- 0:00:07
883500 -- (-670.370) (-671.053) [-669.342] (-668.190) * (-670.666) [-669.397] (-667.937) (-667.192) -- 0:00:06
884000 -- (-667.116) [-668.334] (-671.874) (-670.117) * (-671.727) (-670.079) (-671.084) [-670.111] -- 0:00:06
884500 -- (-669.011) (-671.000) (-669.031) [-667.997] * (-668.314) (-668.233) (-670.956) [-667.513] -- 0:00:06
885000 -- (-672.569) [-672.068] (-669.595) (-667.783) * (-674.450) (-669.985) (-668.336) [-666.988] -- 0:00:06
Average standard deviation of split frequencies: 0.008845
885500 -- [-670.870] (-668.805) (-667.694) (-666.903) * (-667.009) (-668.994) [-667.465] (-666.865) -- 0:00:06
886000 -- (-669.911) (-670.125) (-669.622) [-668.419] * (-669.207) (-670.840) [-668.109] (-669.295) -- 0:00:06
886500 -- (-670.136) (-668.558) (-667.355) [-668.646] * [-669.332] (-669.722) (-667.193) (-668.944) -- 0:00:06
887000 -- (-668.386) (-667.198) (-668.212) [-667.984] * (-668.619) [-669.373] (-669.055) (-667.914) -- 0:00:06
887500 -- (-669.032) (-669.433) [-667.407] (-669.474) * (-667.490) (-666.791) [-669.854] (-670.176) -- 0:00:06
888000 -- (-667.504) (-666.943) [-667.444] (-668.382) * (-674.299) [-669.195] (-670.650) (-672.394) -- 0:00:06
888500 -- [-668.961] (-667.813) (-666.544) (-670.146) * (-669.367) (-670.691) [-667.864] (-669.367) -- 0:00:06
889000 -- (-670.768) (-667.802) (-667.440) [-667.596] * (-679.649) [-666.826] (-668.687) (-667.510) -- 0:00:06
889500 -- (-670.594) [-671.440] (-668.386) (-669.245) * (-671.091) [-669.225] (-669.492) (-672.787) -- 0:00:06
890000 -- (-670.535) (-671.269) (-669.580) [-667.319] * (-671.631) (-667.739) [-667.704] (-670.463) -- 0:00:06
Average standard deviation of split frequencies: 0.008700
890500 -- [-668.368] (-668.814) (-667.548) (-669.822) * (-670.523) [-667.983] (-667.525) (-667.438) -- 0:00:06
891000 -- (-667.864) [-670.337] (-668.103) (-668.827) * (-669.885) (-667.280) [-670.351] (-669.508) -- 0:00:06
891500 -- (-668.337) (-667.720) [-667.693] (-669.113) * (-669.719) [-667.552] (-673.619) (-671.689) -- 0:00:06
892000 -- (-668.378) [-669.395] (-667.402) (-667.324) * (-669.330) (-667.718) (-671.386) [-668.271] -- 0:00:06
892500 -- (-669.564) (-670.016) (-667.181) [-667.630] * (-667.920) [-669.176] (-669.984) (-668.047) -- 0:00:06
893000 -- (-673.757) (-669.884) [-669.422] (-669.302) * (-670.850) (-668.512) [-670.026] (-669.250) -- 0:00:06
893500 -- [-671.083] (-667.599) (-667.137) (-668.306) * (-668.072) (-668.662) [-667.465] (-668.490) -- 0:00:06
894000 -- (-668.501) (-669.476) [-667.802] (-672.552) * (-667.970) [-669.413] (-670.661) (-672.297) -- 0:00:06
894500 -- (-668.822) [-667.329] (-667.240) (-671.047) * [-672.493] (-668.496) (-670.593) (-674.804) -- 0:00:06
895000 -- [-669.087] (-667.338) (-672.079) (-669.507) * (-667.546) [-667.471] (-668.603) (-674.486) -- 0:00:06
Average standard deviation of split frequencies: 0.008681
895500 -- (-668.511) (-667.174) (-667.980) [-671.482] * [-667.113] (-670.559) (-667.533) (-672.134) -- 0:00:06
896000 -- (-671.833) (-668.904) (-668.954) [-668.149] * (-669.218) [-671.626] (-669.041) (-674.788) -- 0:00:06
896500 -- (-670.516) (-669.089) [-668.390] (-668.589) * (-668.114) [-669.539] (-666.946) (-670.924) -- 0:00:06
897000 -- [-668.551] (-668.456) (-669.074) (-668.488) * [-669.967] (-668.421) (-669.647) (-670.601) -- 0:00:06
897500 -- [-667.670] (-670.463) (-667.697) (-666.812) * (-667.318) [-667.928] (-670.273) (-672.357) -- 0:00:06
898000 -- (-668.208) [-669.595] (-668.340) (-667.127) * (-667.016) (-670.266) [-668.521] (-674.476) -- 0:00:06
898500 -- (-670.798) (-671.408) [-666.757] (-667.284) * [-668.257] (-667.884) (-668.859) (-669.484) -- 0:00:06
899000 -- (-671.964) (-673.940) [-667.873] (-667.240) * (-668.114) [-667.909] (-671.970) (-669.711) -- 0:00:06
899500 -- [-673.028] (-669.304) (-667.566) (-669.882) * [-669.376] (-669.034) (-673.054) (-674.590) -- 0:00:06
900000 -- (-667.739) [-669.826] (-667.706) (-670.035) * (-670.589) (-669.390) (-672.813) [-666.829] -- 0:00:06
Average standard deviation of split frequencies: 0.008603
900500 -- (-667.694) (-668.894) [-669.036] (-669.840) * (-670.679) [-670.586] (-667.645) (-666.756) -- 0:00:05
901000 -- (-668.448) (-669.417) [-669.250] (-669.890) * (-667.769) (-668.215) (-669.272) [-666.737] -- 0:00:05
901500 -- [-666.664] (-674.280) (-671.994) (-668.746) * (-669.828) [-668.290] (-666.867) (-669.618) -- 0:00:05
902000 -- (-670.985) (-667.275) (-669.149) [-668.341] * (-671.064) (-674.846) [-669.819] (-669.659) -- 0:00:05
902500 -- (-667.690) [-667.376] (-667.211) (-667.446) * [-666.925] (-668.694) (-669.928) (-668.544) -- 0:00:05
903000 -- [-667.722] (-667.965) (-666.775) (-669.462) * (-667.570) (-668.941) (-669.099) [-668.426] -- 0:00:05
903500 -- (-667.343) (-669.921) (-672.363) [-672.889] * (-669.059) (-669.131) (-671.634) [-671.983] -- 0:00:05
904000 -- [-668.306] (-673.625) (-672.212) (-669.017) * [-667.113] (-672.308) (-666.958) (-669.087) -- 0:00:05
904500 -- [-670.553] (-669.155) (-668.929) (-675.355) * [-668.989] (-669.504) (-668.279) (-668.418) -- 0:00:05
905000 -- (-666.951) [-669.651] (-669.801) (-674.512) * (-667.894) [-671.482] (-667.721) (-667.175) -- 0:00:05
Average standard deviation of split frequencies: 0.008553
905500 -- (-668.718) (-668.409) [-669.564] (-677.823) * (-669.536) (-670.857) [-667.916] (-668.079) -- 0:00:05
906000 -- [-667.524] (-667.104) (-671.008) (-670.686) * (-666.810) (-669.326) [-667.925] (-671.642) -- 0:00:05
906500 -- (-667.813) [-667.944] (-669.343) (-669.987) * [-670.564] (-670.184) (-668.677) (-668.268) -- 0:00:05
907000 -- [-667.818] (-669.697) (-672.735) (-666.988) * (-669.693) [-669.898] (-670.170) (-669.296) -- 0:00:05
907500 -- [-667.747] (-672.224) (-677.207) (-671.736) * (-672.363) [-668.057] (-667.988) (-670.184) -- 0:00:05
908000 -- (-668.300) (-670.046) [-670.018] (-670.695) * (-669.408) (-666.954) [-671.348] (-675.484) -- 0:00:05
908500 -- [-666.760] (-668.757) (-667.186) (-667.990) * (-668.211) (-668.287) (-668.160) [-672.595] -- 0:00:05
909000 -- (-669.241) (-668.881) [-668.765] (-669.071) * (-667.897) [-669.144] (-669.391) (-669.792) -- 0:00:05
909500 -- (-668.735) [-667.523] (-668.130) (-668.561) * (-669.315) (-667.461) [-671.410] (-668.473) -- 0:00:05
910000 -- (-668.062) [-669.602] (-668.458) (-667.158) * (-672.372) [-668.220] (-666.679) (-668.431) -- 0:00:05
Average standard deviation of split frequencies: 0.008315
910500 -- [-668.658] (-667.658) (-671.243) (-667.316) * (-672.006) (-667.880) (-666.870) [-667.630] -- 0:00:05
911000 -- (-668.812) (-670.833) [-668.804] (-667.464) * (-668.884) (-674.359) [-667.480] (-669.101) -- 0:00:05
911500 -- (-670.523) [-667.747] (-670.753) (-667.900) * (-667.655) [-672.229] (-667.592) (-668.531) -- 0:00:05
912000 -- (-669.577) (-667.553) (-668.353) [-668.041] * (-667.116) [-667.927] (-669.579) (-667.464) -- 0:00:05
912500 -- (-670.866) [-668.887] (-669.041) (-669.305) * [-669.820] (-667.672) (-669.105) (-668.947) -- 0:00:05
913000 -- (-667.472) [-667.948] (-672.246) (-668.741) * (-670.047) [-668.127] (-666.937) (-668.028) -- 0:00:05
913500 -- (-667.623) (-669.368) (-672.405) [-667.923] * (-668.549) [-669.876] (-668.414) (-669.104) -- 0:00:05
914000 -- (-667.827) [-667.623] (-671.551) (-675.717) * (-668.691) (-667.157) [-668.532] (-670.088) -- 0:00:05
914500 -- [-667.634] (-671.396) (-667.578) (-669.493) * [-670.122] (-668.457) (-668.977) (-670.913) -- 0:00:05
915000 -- (-668.564) (-666.772) (-668.079) [-668.201] * (-669.569) [-668.457] (-667.570) (-671.099) -- 0:00:05
Average standard deviation of split frequencies: 0.007912
915500 -- (-670.948) (-671.286) [-668.785] (-670.994) * (-668.467) [-667.454] (-669.419) (-670.316) -- 0:00:05
916000 -- (-672.505) (-670.675) [-666.799] (-667.939) * [-667.496] (-666.846) (-670.010) (-668.501) -- 0:00:05
916500 -- (-670.582) (-668.289) (-672.040) [-667.966] * [-667.196] (-667.214) (-667.726) (-667.495) -- 0:00:05
917000 -- [-667.699] (-667.540) (-667.752) (-669.263) * (-672.949) [-667.527] (-669.152) (-671.307) -- 0:00:04
917500 -- (-667.592) (-670.834) (-671.467) [-668.632] * (-669.884) [-668.707] (-668.062) (-668.486) -- 0:00:04
918000 -- (-667.730) (-666.931) (-668.198) [-666.651] * [-669.807] (-669.166) (-667.873) (-675.422) -- 0:00:04
918500 -- [-667.192] (-666.790) (-670.037) (-666.648) * [-671.202] (-667.786) (-669.941) (-669.501) -- 0:00:04
919000 -- (-667.762) (-667.782) (-675.271) [-667.192] * [-667.833] (-668.223) (-674.692) (-671.412) -- 0:00:04
919500 -- (-669.018) (-669.047) (-669.169) [-669.031] * (-670.015) (-669.085) [-669.434] (-668.910) -- 0:00:04
920000 -- (-668.570) (-669.257) [-670.085] (-668.500) * (-668.560) [-667.246] (-670.467) (-669.001) -- 0:00:04
Average standard deviation of split frequencies: 0.008384
920500 -- (-668.499) (-668.258) (-667.067) [-669.586] * (-667.816) (-667.628) (-671.612) [-667.687] -- 0:00:04
921000 -- (-667.507) (-666.994) [-667.939] (-668.778) * (-668.629) (-667.963) (-667.573) [-669.500] -- 0:00:04
921500 -- (-667.594) (-668.320) (-667.191) [-667.434] * (-667.713) (-667.780) [-668.865] (-673.428) -- 0:00:04
922000 -- (-667.358) [-667.539] (-668.689) (-667.444) * (-668.687) (-671.273) (-671.755) [-668.108] -- 0:00:04
922500 -- [-667.287] (-670.108) (-668.984) (-667.355) * (-667.923) [-669.431] (-670.717) (-671.010) -- 0:00:04
923000 -- (-669.776) [-668.894] (-667.700) (-667.075) * [-672.149] (-667.589) (-674.693) (-669.760) -- 0:00:04
923500 -- (-666.767) (-667.884) (-670.587) [-669.825] * (-670.703) (-673.053) [-673.686] (-669.778) -- 0:00:04
924000 -- (-668.267) (-667.998) [-667.174] (-668.171) * (-668.690) (-667.950) (-673.449) [-668.630] -- 0:00:04
924500 -- [-670.619] (-672.429) (-670.372) (-666.994) * [-667.277] (-667.906) (-668.856) (-667.900) -- 0:00:04
925000 -- (-668.216) (-668.884) (-669.508) [-666.984] * (-667.785) (-671.770) [-667.808] (-667.924) -- 0:00:04
Average standard deviation of split frequencies: 0.008209
925500 -- (-671.116) [-667.571] (-668.722) (-667.993) * (-673.523) (-671.002) [-669.074] (-672.417) -- 0:00:04
926000 -- [-668.582] (-667.016) (-668.255) (-669.332) * (-668.505) (-668.208) [-669.253] (-671.095) -- 0:00:04
926500 -- [-668.449] (-667.112) (-670.451) (-669.677) * (-669.022) (-667.280) [-666.951] (-671.660) -- 0:00:04
927000 -- (-671.544) (-669.043) (-668.687) [-668.341] * (-669.058) (-667.974) (-669.573) [-667.841] -- 0:00:04
927500 -- [-669.098] (-669.707) (-668.318) (-673.314) * [-669.448] (-670.748) (-669.432) (-666.871) -- 0:00:04
928000 -- (-669.787) [-669.884] (-668.994) (-670.280) * (-668.689) [-670.072] (-671.435) (-667.163) -- 0:00:04
928500 -- [-668.907] (-671.278) (-669.529) (-669.160) * [-669.927] (-669.929) (-668.897) (-672.306) -- 0:00:04
929000 -- (-669.746) (-667.403) [-667.798] (-667.908) * (-668.351) [-667.829] (-668.211) (-668.356) -- 0:00:04
929500 -- (-671.040) (-668.001) [-669.993] (-668.697) * (-667.896) (-667.869) (-668.583) [-669.143] -- 0:00:04
930000 -- (-671.322) (-667.524) [-668.867] (-670.417) * (-669.681) (-667.518) [-667.132] (-669.777) -- 0:00:04
Average standard deviation of split frequencies: 0.008041
930500 -- (-674.764) (-668.779) [-666.591] (-668.733) * (-668.253) (-669.846) (-668.446) [-670.502] -- 0:00:04
931000 -- (-669.740) (-669.449) [-670.472] (-669.654) * (-669.179) [-667.340] (-674.114) (-671.534) -- 0:00:04
931500 -- (-668.518) (-669.822) [-666.774] (-675.354) * [-666.874] (-667.340) (-669.536) (-667.122) -- 0:00:04
932000 -- (-668.202) (-667.728) [-666.960] (-667.951) * (-668.836) (-668.175) (-670.169) [-669.465] -- 0:00:04
932500 -- [-671.343] (-668.267) (-669.249) (-668.120) * (-670.611) (-678.352) [-669.003] (-668.646) -- 0:00:04
933000 -- (-667.840) [-666.914] (-668.192) (-667.883) * (-669.502) (-671.346) [-666.687] (-668.555) -- 0:00:04
933500 -- [-667.851] (-667.251) (-666.967) (-667.681) * (-668.539) (-669.511) (-669.067) [-669.195] -- 0:00:03
934000 -- (-668.652) (-667.612) [-670.863] (-667.516) * (-670.812) [-668.384] (-669.570) (-668.317) -- 0:00:03
934500 -- (-668.387) [-674.636] (-670.270) (-667.571) * (-667.700) [-668.177] (-668.022) (-669.789) -- 0:00:03
935000 -- [-668.295] (-670.253) (-671.033) (-668.021) * (-667.579) (-667.963) [-670.288] (-671.914) -- 0:00:03
Average standard deviation of split frequencies: 0.008373
935500 -- (-669.426) (-672.710) [-669.750] (-667.093) * (-669.947) (-669.977) [-670.668] (-674.801) -- 0:00:03
936000 -- (-667.493) (-674.157) [-666.739] (-668.108) * (-669.411) (-669.711) [-668.773] (-674.001) -- 0:00:03
936500 -- (-667.834) (-668.143) (-671.070) [-667.706] * (-666.841) (-670.512) (-671.088) [-668.671] -- 0:00:03
937000 -- (-668.875) [-672.277] (-671.269) (-668.694) * (-667.396) [-668.517] (-667.891) (-667.673) -- 0:00:03
937500 -- [-667.748] (-667.756) (-669.502) (-667.515) * (-670.886) (-673.340) (-672.411) [-669.366] -- 0:00:03
938000 -- (-668.361) (-668.734) [-672.897] (-669.404) * (-667.000) [-668.592] (-668.904) (-667.899) -- 0:00:03
938500 -- (-669.588) [-669.043] (-669.709) (-667.617) * (-668.165) [-670.438] (-670.591) (-668.530) -- 0:00:03
939000 -- (-669.350) (-667.945) (-678.443) [-667.894] * (-667.366) [-669.832] (-670.095) (-667.962) -- 0:00:03
939500 -- (-668.043) (-668.438) (-676.285) [-667.250] * (-672.409) (-669.371) (-669.987) [-668.582] -- 0:00:03
940000 -- [-669.677] (-667.796) (-670.180) (-668.218) * [-670.840] (-668.361) (-670.267) (-669.133) -- 0:00:03
Average standard deviation of split frequencies: 0.008864
940500 -- [-668.256] (-669.974) (-668.575) (-668.077) * (-668.993) (-673.255) [-667.537] (-668.373) -- 0:00:03
941000 -- [-668.817] (-668.192) (-668.138) (-668.258) * (-669.745) (-673.769) [-668.399] (-669.726) -- 0:00:03
941500 -- (-671.799) (-672.068) (-668.151) [-667.207] * (-669.821) (-669.069) [-667.693] (-668.485) -- 0:00:03
942000 -- (-668.504) (-671.079) [-668.676] (-667.689) * (-672.683) [-670.873] (-668.631) (-666.857) -- 0:00:03
942500 -- [-668.073] (-670.988) (-667.353) (-666.944) * (-671.501) (-671.243) (-669.683) [-669.663] -- 0:00:03
943000 -- (-668.843) [-667.997] (-668.471) (-668.731) * (-670.780) [-669.060] (-670.903) (-669.956) -- 0:00:03
943500 -- [-668.505] (-667.272) (-668.002) (-667.548) * (-669.557) (-667.478) [-669.619] (-668.025) -- 0:00:03
944000 -- (-667.925) (-667.806) [-668.007] (-666.891) * (-671.620) (-667.380) [-668.360] (-668.412) -- 0:00:03
944500 -- (-667.081) (-667.779) (-668.705) [-667.870] * (-673.047) (-667.322) (-672.644) [-668.458] -- 0:00:03
945000 -- (-666.895) [-670.053] (-668.403) (-672.089) * (-667.888) [-668.381] (-671.768) (-667.754) -- 0:00:03
Average standard deviation of split frequencies: 0.008814
945500 -- (-667.095) [-668.500] (-667.278) (-670.212) * (-669.722) [-669.001] (-670.734) (-672.139) -- 0:00:03
946000 -- (-667.472) [-672.912] (-669.594) (-669.196) * (-676.770) (-669.531) [-672.757] (-669.197) -- 0:00:03
946500 -- (-667.351) [-669.441] (-667.250) (-668.883) * [-668.156] (-669.877) (-670.223) (-667.426) -- 0:00:03
947000 -- (-667.893) [-669.515] (-668.830) (-670.818) * (-668.152) [-667.525] (-670.551) (-667.433) -- 0:00:03
947500 -- (-668.131) (-667.789) (-667.017) [-669.645] * (-668.028) (-670.551) (-671.726) [-668.520] -- 0:00:03
948000 -- (-667.504) (-668.016) [-667.071] (-669.288) * [-667.174] (-670.220) (-671.700) (-668.828) -- 0:00:03
948500 -- (-667.966) [-666.788] (-668.099) (-668.621) * (-667.720) [-669.366] (-671.150) (-667.213) -- 0:00:03
949000 -- (-668.095) (-668.634) [-667.782] (-673.209) * (-669.140) (-667.450) [-672.710] (-667.425) -- 0:00:03
949500 -- (-667.883) (-667.166) [-669.396] (-667.411) * (-667.109) [-668.847] (-670.025) (-670.623) -- 0:00:03
950000 -- (-669.153) [-669.432] (-672.108) (-667.487) * [-668.148] (-671.860) (-670.335) (-667.894) -- 0:00:03
Average standard deviation of split frequencies: 0.008616
950500 -- [-667.471] (-669.962) (-668.182) (-667.219) * (-669.842) (-670.186) (-670.281) [-667.821] -- 0:00:02
951000 -- (-667.541) [-670.687] (-668.534) (-667.473) * (-668.588) (-667.890) (-669.680) [-667.185] -- 0:00:02
951500 -- (-667.849) [-668.218] (-667.445) (-668.565) * (-671.333) [-671.416] (-668.881) (-669.446) -- 0:00:02
952000 -- (-668.122) (-667.580) [-667.357] (-669.630) * (-669.112) (-668.554) (-668.245) [-671.385] -- 0:00:02
952500 -- [-666.998] (-668.483) (-667.287) (-669.740) * [-668.649] (-667.916) (-668.419) (-668.017) -- 0:00:02
953000 -- (-668.449) (-671.304) [-666.920] (-670.737) * [-667.856] (-669.812) (-668.699) (-667.542) -- 0:00:02
953500 -- (-671.084) [-668.615] (-667.723) (-670.227) * [-667.119] (-667.319) (-670.282) (-667.053) -- 0:00:02
954000 -- (-669.256) (-669.344) (-669.151) [-668.554] * (-667.910) (-670.281) [-669.093] (-669.428) -- 0:00:02
954500 -- (-666.840) (-671.191) (-671.288) [-668.304] * (-674.283) [-671.710] (-667.375) (-667.569) -- 0:00:02
955000 -- [-667.733] (-670.754) (-671.064) (-666.840) * (-669.955) [-672.454] (-672.098) (-671.265) -- 0:00:02
Average standard deviation of split frequencies: 0.008568
955500 -- (-670.290) (-667.233) [-668.592] (-669.883) * (-670.617) (-670.501) (-670.875) [-669.927] -- 0:00:02
956000 -- [-667.890] (-667.206) (-671.769) (-670.612) * [-669.052] (-668.063) (-671.228) (-670.991) -- 0:00:02
956500 -- (-668.051) (-668.437) (-669.709) [-668.862] * (-668.201) (-668.672) (-668.480) [-668.556] -- 0:00:02
957000 -- (-668.814) (-666.829) (-670.451) [-667.683] * (-667.601) [-667.318] (-671.249) (-669.915) -- 0:00:02
957500 -- (-668.558) [-667.945] (-668.619) (-666.630) * [-667.214] (-666.741) (-668.755) (-668.868) -- 0:00:02
958000 -- (-669.307) (-668.733) [-670.285] (-669.041) * [-666.994] (-670.308) (-667.136) (-667.707) -- 0:00:02
958500 -- (-669.225) (-670.680) (-668.507) [-669.604] * [-668.476] (-668.263) (-672.135) (-667.332) -- 0:00:02
959000 -- (-668.934) (-671.545) [-668.627] (-667.388) * (-669.559) (-667.547) [-667.082] (-666.957) -- 0:00:02
959500 -- [-667.679] (-670.924) (-669.329) (-670.735) * (-673.809) (-670.434) (-668.257) [-670.052] -- 0:00:02
960000 -- [-668.566] (-672.049) (-668.678) (-668.009) * (-671.683) (-670.000) [-668.507] (-668.037) -- 0:00:02
Average standard deviation of split frequencies: 0.008465
960500 -- (-667.756) (-667.295) (-668.175) [-671.590] * (-669.480) (-667.477) (-670.389) [-668.171] -- 0:00:02
961000 -- (-668.070) (-669.265) [-667.509] (-671.629) * (-668.466) [-667.504] (-668.016) (-668.961) -- 0:00:02
961500 -- [-668.704] (-669.550) (-667.477) (-668.335) * [-667.701] (-667.572) (-669.365) (-670.943) -- 0:00:02
962000 -- (-669.945) [-667.371] (-668.281) (-669.134) * [-670.446] (-669.076) (-670.639) (-673.564) -- 0:00:02
962500 -- (-671.393) [-668.573] (-668.273) (-671.537) * (-672.149) (-668.730) [-670.369] (-673.544) -- 0:00:02
963000 -- (-668.913) (-669.636) (-667.288) [-668.832] * (-669.719) (-667.621) [-668.322] (-671.808) -- 0:00:02
963500 -- (-667.084) (-671.348) [-668.791] (-669.564) * (-673.206) (-668.786) [-668.387] (-671.273) -- 0:00:02
964000 -- [-668.552] (-670.021) (-668.103) (-670.274) * (-671.332) [-668.135] (-667.558) (-670.924) -- 0:00:02
964500 -- (-671.419) (-668.498) [-669.369] (-668.871) * (-669.887) [-668.858] (-667.289) (-667.669) -- 0:00:02
965000 -- (-667.034) (-667.531) (-669.292) [-669.756] * (-669.320) (-668.122) [-667.337] (-668.337) -- 0:00:02
Average standard deviation of split frequencies: 0.008235
965500 -- (-667.325) (-669.688) [-669.318] (-669.903) * (-667.887) (-667.434) (-667.014) [-669.701] -- 0:00:02
966000 -- (-669.520) [-669.763] (-668.855) (-668.509) * [-667.519] (-669.866) (-668.482) (-667.580) -- 0:00:02
966500 -- (-667.568) [-668.702] (-668.383) (-668.145) * (-669.191) (-668.927) [-667.026] (-668.332) -- 0:00:02
967000 -- (-667.558) (-667.640) (-667.061) [-667.167] * (-667.730) [-667.388] (-668.578) (-666.861) -- 0:00:01
967500 -- (-668.537) (-668.936) [-667.393] (-667.170) * (-668.938) [-668.092] (-671.464) (-668.052) -- 0:00:01
968000 -- (-668.067) [-666.616] (-668.706) (-667.681) * (-670.035) [-668.651] (-668.276) (-670.958) -- 0:00:01
968500 -- (-674.020) (-668.766) [-669.526] (-666.931) * (-670.085) (-669.945) (-667.634) [-668.825] -- 0:00:01
969000 -- [-667.577] (-669.697) (-668.001) (-666.923) * (-667.160) (-671.201) (-668.823) [-670.379] -- 0:00:01
969500 -- (-668.403) [-667.975] (-667.962) (-668.844) * (-668.189) (-670.843) (-668.597) [-668.766] -- 0:00:01
970000 -- (-669.334) [-668.198] (-667.946) (-668.269) * (-668.801) (-669.834) [-668.950] (-672.542) -- 0:00:01
Average standard deviation of split frequencies: 0.008772
970500 -- (-672.104) [-669.208] (-667.707) (-669.704) * [-667.682] (-674.449) (-671.312) (-669.645) -- 0:00:01
971000 -- (-671.049) (-669.539) [-668.165] (-672.666) * [-668.647] (-667.635) (-669.031) (-671.813) -- 0:00:01
971500 -- (-675.544) (-671.133) [-671.180] (-668.957) * (-668.305) [-668.132] (-674.581) (-668.004) -- 0:00:01
972000 -- (-671.356) (-667.755) (-667.731) [-668.173] * (-670.145) [-667.706] (-671.023) (-669.423) -- 0:00:01
972500 -- [-675.932] (-668.940) (-669.653) (-668.039) * (-669.410) (-668.020) [-669.459] (-671.954) -- 0:00:01
973000 -- [-667.990] (-670.226) (-671.006) (-667.774) * (-669.414) (-670.021) (-672.110) [-669.069] -- 0:00:01
973500 -- (-671.503) [-669.497] (-668.717) (-666.877) * (-670.123) (-669.468) [-672.667] (-671.492) -- 0:00:01
974000 -- (-671.645) (-668.801) (-668.430) [-669.043] * (-670.163) [-668.014] (-667.554) (-669.006) -- 0:00:01
974500 -- (-671.964) (-671.100) (-671.055) [-670.747] * [-669.160] (-670.106) (-668.631) (-667.352) -- 0:00:01
975000 -- (-673.548) (-668.602) (-670.372) [-667.275] * (-667.848) (-669.903) [-668.746] (-668.604) -- 0:00:01
Average standard deviation of split frequencies: 0.008875
975500 -- (-670.427) [-669.031] (-668.472) (-671.049) * (-672.994) (-670.682) (-671.450) [-667.209] -- 0:00:01
976000 -- (-667.724) [-668.254] (-668.991) (-667.100) * [-667.737] (-667.914) (-669.008) (-667.254) -- 0:00:01
976500 -- [-668.022] (-669.779) (-668.845) (-668.450) * (-670.687) [-667.649] (-668.474) (-667.163) -- 0:00:01
977000 -- [-669.453] (-668.773) (-671.157) (-668.548) * (-669.555) (-668.232) [-668.401] (-668.139) -- 0:00:01
977500 -- [-668.372] (-670.795) (-668.455) (-667.612) * [-667.130] (-669.694) (-670.074) (-668.290) -- 0:00:01
978000 -- (-670.903) (-667.530) (-670.605) [-669.196] * (-670.433) (-670.574) (-672.772) [-669.693] -- 0:00:01
978500 -- (-668.499) [-667.646] (-670.241) (-669.246) * (-668.289) (-669.739) [-668.744] (-667.441) -- 0:00:01
979000 -- (-667.395) (-666.838) (-669.955) [-670.098] * (-668.329) (-668.441) [-671.804] (-668.852) -- 0:00:01
979500 -- (-667.050) [-668.197] (-668.966) (-673.802) * [-668.340] (-671.136) (-668.377) (-668.590) -- 0:00:01
980000 -- [-667.043] (-670.321) (-675.435) (-671.065) * (-670.519) [-668.710] (-670.772) (-668.439) -- 0:00:01
Average standard deviation of split frequencies: 0.008653
980500 -- (-669.881) (-675.992) [-669.317] (-670.662) * (-668.937) [-668.387] (-668.735) (-668.287) -- 0:00:01
981000 -- (-668.794) [-668.528] (-670.035) (-668.900) * [-669.509] (-668.323) (-670.320) (-668.283) -- 0:00:01
981500 -- (-670.196) [-669.222] (-670.229) (-669.249) * [-667.664] (-667.817) (-670.681) (-669.340) -- 0:00:01
982000 -- (-670.664) (-669.555) [-671.608] (-670.457) * [-668.491] (-667.688) (-673.225) (-668.342) -- 0:00:01
982500 -- (-667.675) (-666.764) (-671.219) [-672.694] * (-670.174) [-668.062] (-671.032) (-668.834) -- 0:00:01
983000 -- (-667.997) (-667.706) [-669.608] (-668.666) * (-667.850) (-669.147) [-670.331] (-669.405) -- 0:00:01
983500 -- (-669.019) (-667.288) (-669.521) [-667.545] * [-669.326] (-669.877) (-669.179) (-670.329) -- 0:00:00
984000 -- [-669.479] (-667.232) (-671.738) (-671.683) * (-668.979) (-669.286) (-666.983) [-669.281] -- 0:00:00
984500 -- (-669.072) (-668.311) [-669.570] (-670.144) * [-667.570] (-668.730) (-666.907) (-669.976) -- 0:00:00
985000 -- (-672.222) (-670.014) (-668.149) [-667.319] * (-668.193) (-669.348) (-667.632) [-671.474] -- 0:00:00
Average standard deviation of split frequencies: 0.008546
985500 -- (-670.596) (-667.863) [-667.369] (-666.967) * (-668.824) (-668.605) [-669.198] (-671.723) -- 0:00:00
986000 -- (-667.428) (-670.009) [-667.556] (-668.932) * (-671.042) [-670.740] (-668.881) (-674.482) -- 0:00:00
986500 -- (-670.208) (-668.489) (-667.692) [-670.255] * (-668.852) [-669.154] (-669.531) (-670.907) -- 0:00:00
987000 -- (-667.851) [-667.134] (-669.083) (-673.571) * (-668.688) (-669.853) [-668.881] (-668.238) -- 0:00:00
987500 -- (-668.657) (-667.965) (-670.399) [-669.145] * [-668.235] (-672.479) (-672.269) (-667.746) -- 0:00:00
988000 -- (-669.828) (-670.349) [-667.768] (-669.798) * [-668.267] (-670.229) (-671.152) (-667.520) -- 0:00:00
988500 -- (-670.342) (-670.967) (-669.848) [-671.858] * (-669.740) (-669.398) (-667.803) [-668.552] -- 0:00:00
989000 -- (-669.362) [-668.898] (-667.306) (-669.325) * (-668.908) (-668.502) [-667.179] (-673.838) -- 0:00:00
989500 -- (-669.521) (-668.131) [-668.891] (-668.036) * [-670.572] (-668.687) (-668.850) (-669.299) -- 0:00:00
990000 -- (-668.125) [-667.000] (-668.166) (-667.932) * [-669.713] (-668.209) (-670.404) (-667.758) -- 0:00:00
Average standard deviation of split frequencies: 0.008773
990500 -- (-669.223) [-667.181] (-666.989) (-667.040) * (-669.905) (-667.002) (-674.184) [-668.448] -- 0:00:00
991000 -- (-669.550) (-670.447) [-669.136] (-667.596) * (-669.259) (-667.022) [-668.374] (-669.069) -- 0:00:00
991500 -- (-674.547) (-668.740) (-670.488) [-667.517] * (-667.956) [-667.912] (-668.970) (-668.362) -- 0:00:00
992000 -- (-675.215) (-669.937) [-671.741] (-667.987) * (-668.140) (-672.116) [-669.533] (-667.177) -- 0:00:00
992500 -- (-668.941) (-674.350) [-667.893] (-669.096) * (-669.342) [-667.069] (-667.302) (-667.216) -- 0:00:00
993000 -- (-668.498) (-672.728) (-668.261) [-669.726] * (-671.884) (-668.080) [-667.515] (-668.363) -- 0:00:00
993500 -- (-668.693) (-668.045) (-668.389) [-668.866] * (-668.564) (-671.979) [-667.776] (-668.388) -- 0:00:00
994000 -- [-669.876] (-667.821) (-668.013) (-669.687) * [-667.462] (-673.745) (-670.690) (-667.238) -- 0:00:00
994500 -- (-668.690) (-672.734) [-667.587] (-669.109) * [-667.459] (-672.080) (-668.728) (-669.013) -- 0:00:00
995000 -- (-669.427) (-671.138) [-669.654] (-671.967) * (-668.857) (-670.684) [-668.111] (-669.195) -- 0:00:00
Average standard deviation of split frequencies: 0.008519
995500 -- [-667.793] (-672.204) (-672.179) (-673.371) * (-670.358) (-671.228) (-670.955) [-669.613] -- 0:00:00
996000 -- [-667.543] (-668.404) (-669.768) (-679.146) * (-671.608) (-668.959) [-667.499] (-669.400) -- 0:00:00
996500 -- (-667.828) (-668.351) [-669.877] (-669.687) * (-669.982) [-668.090] (-667.186) (-671.078) -- 0:00:00
997000 -- (-668.108) (-667.205) (-671.630) [-667.355] * [-669.588] (-670.530) (-667.424) (-670.003) -- 0:00:00
997500 -- (-671.554) (-667.239) [-669.464] (-672.024) * (-669.892) (-672.924) [-667.300] (-670.918) -- 0:00:00
998000 -- (-669.580) (-668.326) [-667.574] (-671.628) * (-668.701) (-673.913) [-669.560] (-668.790) -- 0:00:00
998500 -- (-669.237) [-668.747] (-667.425) (-668.212) * (-669.500) (-668.917) [-667.073] (-669.128) -- 0:00:00
999000 -- (-676.095) (-674.932) (-667.177) [-668.303] * (-674.800) (-669.516) [-669.389] (-668.386) -- 0:00:00
999500 -- (-668.388) (-671.558) (-668.001) [-668.680] * (-670.009) (-669.763) (-668.352) [-670.687] -- 0:00:00
1000000 -- [-668.164] (-671.398) (-668.242) (-672.401) * (-669.333) [-668.959] (-668.280) (-667.897) -- 0:00:00
Average standard deviation of split frequencies: 0.008421
Analysis completed in 60 seconds
Analysis used 58.63 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -666.43
Likelihood of best state for "cold" chain of run 2 was -666.43
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 73 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
31.5 % ( 31 %) Dirichlet(Pi{all})
33.1 % ( 23 %) Slider(Pi{all})
78.8 % ( 56 %) Multiplier(Alpha{1,2})
77.9 % ( 60 %) Multiplier(Alpha{3})
23.6 % ( 31 %) Slider(Pinvar{all})
98.5 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.6 % ( 23 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.1 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
31.7 % ( 26 %) Dirichlet(Pi{all})
33.1 % ( 25 %) Slider(Pi{all})
78.6 % ( 46 %) Multiplier(Alpha{1,2})
78.1 % ( 53 %) Multiplier(Alpha{3})
23.4 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.4 % ( 74 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 25 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166779 0.82 0.67
3 | 166681 167308 0.84
4 | 166430 166320 166482
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167511 0.82 0.67
3 | 166501 166107 0.84
4 | 167049 166622 166210
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -668.18
| 2 1 |
| 1 12 |
|2 2 2 1 1 2 1 1 2|
| 1 2 2 2 12 |
| 2 1 1 2 1 1 1 1 2 2 1 2 |
| 2 2 1 1 1 212 1 1 1 1 2 1|
|1 1 2 1 1 1 1 1 2* 1 2 1 |
| 1 * 1 2 2 1 22 1 1 2 2 2 |
| 1 11 2 2 2 1 1 1 1 |
| 2 1 2 1 1 2 2 2 2 |
| 2 2 2 1 2 2 |
| 2 21 1 2 2 2* |
| 2 2 1 |
| 2 2 2 2 |
| 1 * 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -669.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -668.17 -671.14
2 -668.18 -670.90
--------------------------------------
TOTAL -668.17 -671.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893921 0.088972 0.322268 1.459693 0.864591 1290.23 1325.50 1.000
r(A<->C){all} 0.160751 0.019036 0.000179 0.439043 0.123153 222.54 239.57 1.000
r(A<->G){all} 0.174784 0.020772 0.000037 0.464746 0.138812 208.87 257.17 1.001
r(A<->T){all} 0.159280 0.019376 0.000122 0.452633 0.121841 178.73 219.46 1.001
r(C<->G){all} 0.162248 0.019311 0.000031 0.443438 0.128908 259.43 299.70 1.000
r(C<->T){all} 0.172383 0.022011 0.000116 0.465211 0.130904 338.73 369.23 1.001
r(G<->T){all} 0.170554 0.021483 0.000009 0.469751 0.130808 150.73 230.85 1.001
pi(A){all} 0.221675 0.000356 0.187121 0.260398 0.221973 1313.31 1319.56 1.001
pi(C){all} 0.280740 0.000406 0.241271 0.319069 0.280491 1198.18 1349.59 1.000
pi(G){all} 0.275550 0.000402 0.240000 0.318679 0.274933 1126.95 1151.64 1.003
pi(T){all} 0.222035 0.000341 0.184966 0.256353 0.221148 1168.41 1202.56 1.000
alpha{1,2} 0.429733 0.234479 0.000248 1.400922 0.253700 1273.23 1287.18 1.001
alpha{3} 0.472316 0.242007 0.000195 1.481140 0.310018 1062.07 1146.16 1.000
pinvar{all} 0.996845 0.000014 0.989834 0.999998 0.998079 1295.44 1296.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ...**.
9 -- .**.**
10 -- .*...*
11 -- ..*.*.
12 -- ..****
13 -- ....**
14 -- ...*.*
15 -- .*.***
16 -- ..**..
17 -- .*..*.
18 -- ..*..*
19 -- .****.
20 -- .***.*
21 -- .*.*..
22 -- .**..*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 473 0.157562 0.024968 0.139907 0.175217 2
8 462 0.153897 0.005653 0.149900 0.157895 2
9 458 0.152565 0.010364 0.145237 0.159893 2
10 447 0.148901 0.010835 0.141239 0.156562 2
11 439 0.146236 0.001413 0.145237 0.147235 2
12 430 0.143238 0.016959 0.131246 0.155230 2
13 427 0.142239 0.003298 0.139907 0.144570 2
14 424 0.141239 0.011306 0.133245 0.149234 2
15 419 0.139574 0.004240 0.136576 0.142572 2
16 418 0.139241 0.001884 0.137908 0.140573 2
17 417 0.138907 0.006124 0.134577 0.143238 2
18 417 0.138907 0.009893 0.131912 0.145903 2
19 411 0.136909 0.001413 0.135909 0.137908 2
20 405 0.134910 0.013662 0.125250 0.144570 2
21 383 0.127582 0.006124 0.123251 0.131912 2
22 304 0.101266 0.006595 0.096602 0.105929 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098863 0.009903 0.000114 0.298783 0.066186 1.000 2
length{all}[2] 0.098677 0.010047 0.000012 0.297744 0.067263 1.000 2
length{all}[3] 0.102423 0.011301 0.000004 0.311351 0.069996 1.000 2
length{all}[4] 0.097787 0.009514 0.000006 0.293565 0.067201 1.000 2
length{all}[5] 0.099640 0.009845 0.000016 0.293533 0.070806 1.001 2
length{all}[6] 0.100642 0.010100 0.000023 0.306763 0.070184 1.000 2
length{all}[7] 0.100226 0.009726 0.000501 0.286574 0.073057 1.003 2
length{all}[8] 0.099882 0.009053 0.000067 0.278363 0.068089 0.998 2
length{all}[9] 0.098856 0.010540 0.000004 0.293609 0.066954 0.999 2
length{all}[10] 0.098550 0.009290 0.000104 0.297637 0.064362 1.010 2
length{all}[11] 0.100668 0.012153 0.000296 0.331752 0.066139 0.998 2
length{all}[12] 0.089322 0.008269 0.000050 0.275412 0.065159 1.009 2
length{all}[13] 0.098663 0.008505 0.000249 0.302464 0.071037 0.998 2
length{all}[14] 0.096544 0.009507 0.000002 0.276516 0.071709 0.998 2
length{all}[15] 0.104053 0.011533 0.000516 0.327579 0.071270 1.005 2
length{all}[16] 0.099709 0.008371 0.000079 0.285974 0.073414 1.008 2
length{all}[17] 0.100658 0.010019 0.000405 0.324383 0.069285 0.998 2
length{all}[18] 0.093180 0.008527 0.000192 0.268849 0.067578 0.998 2
length{all}[19] 0.098319 0.009119 0.000016 0.287738 0.074117 1.000 2
length{all}[20] 0.097565 0.009387 0.000572 0.301695 0.066375 0.998 2
length{all}[21] 0.096527 0.011324 0.000567 0.288164 0.062232 0.999 2
length{all}[22] 0.104003 0.011148 0.000634 0.303533 0.072726 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008421
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|----------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\----------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 483
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 161 / 161 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 161 / 161 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076088 0.032680 0.063202 0.085532 0.060287 0.063457 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -708.889203
Iterating by ming2
Initial: fx= 708.889203
x= 0.07609 0.03268 0.06320 0.08553 0.06029 0.06346 0.30000 1.30000
1 h-m-p 0.0000 0.0002 386.3824 +++ 678.043154 m 0.0002 14 | 1/8
2 h-m-p 0.0024 0.0121 29.0737 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 354.3572 +++ 656.025722 m 0.0002 47 | 2/8
4 h-m-p 0.0030 0.0296 18.2482 ------------.. | 2/8
5 h-m-p 0.0000 0.0000 318.3524 ++ 654.152535 m 0.0000 79 | 3/8
6 h-m-p 0.0004 0.0875 13.7591 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 275.6990 ++ 654.029480 m 0.0000 109 | 4/8
8 h-m-p 0.0002 0.1011 10.8537 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 224.8885 ++ 649.966086 m 0.0001 139 | 5/8
10 h-m-p 0.0017 0.1620 7.4687 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 159.2409 ++ 648.440552 m 0.0001 171 | 6/8
12 h-m-p 0.0982 8.0000 0.0000 ++++ 648.440552 m 8.0000 184 | 6/8
13 h-m-p 0.3280 8.0000 0.0001 +++ 648.440552 m 8.0000 198 | 6/8
14 h-m-p 0.0160 8.0000 0.1938 ++++Y 648.440551 0 2.7788 215 | 6/8
15 h-m-p 1.6000 8.0000 0.0141 C 648.440551 0 1.3326 228 | 6/8
16 h-m-p 1.6000 8.0000 0.0005 N 648.440551 0 0.4000 241 | 6/8
17 h-m-p 1.1739 8.0000 0.0002 Y 648.440551 0 1.1739 254 | 6/8
18 h-m-p 1.6000 8.0000 0.0001 ----------------.. | 6/8
19 h-m-p 0.0160 8.0000 0.0000 ------------- | 6/8
20 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -648.440551
330 lfun, 330 eigenQcodon, 1980 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.022958 0.087354 0.072093 0.084887 0.106351 0.104500 0.814656 0.711129 0.172991
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.033295
np = 9
lnL0 = -719.106158
Iterating by ming2
Initial: fx= 719.106158
x= 0.02296 0.08735 0.07209 0.08489 0.10635 0.10450 0.81466 0.71113 0.17299
1 h-m-p 0.0000 0.0002 338.7964 +++ 699.929444 m 0.0002 24 | 1/9
2 h-m-p 0.0001 0.0004 411.6365 ++ 663.210351 m 0.0004 45 | 2/9
3 h-m-p 0.0000 0.0000 2509.3870 ++ 655.971654 m 0.0000 65 | 3/9
4 h-m-p 0.0018 0.0213 13.5343 ------------.. | 3/9
5 h-m-p 0.0000 0.0000 307.8464 ++ 655.203853 m 0.0000 112 | 4/9
6 h-m-p 0.0002 0.0280 11.2397 ----------.. | 4/9
7 h-m-p 0.0000 0.0000 267.2224 ++ 654.072066 m 0.0000 155 | 5/9
8 h-m-p 0.0003 0.0314 10.0450 ----------.. | 5/9
9 h-m-p 0.0000 0.0001 218.9266 ++ 648.734093 m 0.0001 196 | 6/9
10 h-m-p 0.0029 0.0559 5.8244 ------------.. | 6/9
11 h-m-p 0.0000 0.0000 158.8321 ++ 648.440542 m 0.0000 237 | 7/9
12 h-m-p 0.0160 8.0000 0.0000 -------------.. | 7/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 648.440542 m 8.0000 280 | 7/9
14 h-m-p 0.0071 3.5540 0.2964 --------N 648.440542 0 0.0000 302 | 7/9
15 h-m-p 0.0160 8.0000 0.0003 ----C 648.440542 0 0.0000 320 | 7/9
16 h-m-p 0.0160 8.0000 0.0002 ------------N 648.440542 0 0.0000 346
Out..
lnL = -648.440542
347 lfun, 1041 eigenQcodon, 4164 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.093570 0.093379 0.030398 0.010488 0.098038 0.014682 0.804945 1.543685 0.379183 0.435516 1.319623
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.876139
np = 11
lnL0 = -701.170282
Iterating by ming2
Initial: fx= 701.170282
x= 0.09357 0.09338 0.03040 0.01049 0.09804 0.01468 0.80494 1.54368 0.37918 0.43552 1.31962
1 h-m-p 0.0000 0.0001 370.5461 ++ 691.683588 m 0.0001 27 | 1/11
2 h-m-p 0.0000 0.0001 204.3506 ++ 688.385825 m 0.0001 52 | 2/11
3 h-m-p 0.0001 0.0003 122.4462 ++ 679.976037 m 0.0003 76 | 3/11
4 h-m-p 0.0003 0.0030 90.8934 ++ 649.354183 m 0.0030 99 | 4/11
5 h-m-p 0.0000 0.0000 907.7057 ++ 649.282102 m 0.0000 121 | 5/11
6 h-m-p 0.0000 0.0017 96.4980 ++++ 648.929377 m 0.0017 144 | 6/11
7 h-m-p 0.0001 0.0007 70.4009 ++ 648.440542 m 0.0007 164 | 7/11
8 h-m-p 1.6000 8.0000 0.0004 ++ 648.440542 m 8.0000 183 | 7/11
9 h-m-p 0.0160 8.0000 0.8282 ---------C 648.440542 0 0.0000 210 | 7/11
10 h-m-p 0.0160 8.0000 0.0002 +++++ 648.440542 m 8.0000 231 | 7/11
11 h-m-p 0.0160 8.0000 0.8364 ---------Y 648.440542 0 0.0000 258 | 7/11
12 h-m-p 0.0160 8.0000 0.0003 ---------C 648.440542 0 0.0000 285 | 7/11
13 h-m-p 0.0160 8.0000 0.0001 +++++ 648.440542 m 8.0000 306 | 7/11
14 h-m-p 0.0160 8.0000 1.1311 ---------C 648.440542 0 0.0000 333 | 7/11
15 h-m-p 0.0160 8.0000 0.0002 +++++ 648.440542 m 8.0000 354 | 7/11
16 h-m-p 0.0160 8.0000 1.2884 ---------C 648.440542 0 0.0000 381 | 7/11
17 h-m-p 0.0160 8.0000 0.0004 -------Y 648.440542 0 0.0000 406 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 648.440542 m 8.0000 427 | 7/11
19 h-m-p 0.0160 8.0000 0.6836 ------------C 648.440542 0 0.0000 457 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 --N 648.440542 0 0.0003 477 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 648.440542 m 8.0000 498 | 7/11
22 h-m-p 0.0049 2.4290 0.1531 +++++ 648.440540 m 2.4290 519 | 8/11
23 h-m-p 0.1996 8.0000 1.2719 +C 648.440538 0 0.7985 538 | 8/11
24 h-m-p 1.6000 8.0000 0.0028 C 648.440538 0 1.6435 555 | 8/11
25 h-m-p 1.6000 8.0000 0.0001 ++ 648.440538 m 8.0000 572 | 8/11
26 h-m-p 0.0160 8.0000 0.0944 +++Y 648.440538 0 2.2729 592 | 8/11
27 h-m-p 1.6000 8.0000 0.0125 ++ 648.440537 m 8.0000 609 | 8/11
28 h-m-p 0.0265 8.0000 3.7917 ----------Y 648.440537 0 0.0000 636 | 8/11
29 h-m-p 0.0160 8.0000 2.9422 +++Y 648.440531 0 1.0240 656 | 8/11
30 h-m-p 1.6000 8.0000 0.4891 Y 648.440531 0 3.4843 673 | 8/11
31 h-m-p 1.6000 8.0000 0.1513 C 648.440531 0 2.1732 690 | 8/11
32 h-m-p 1.6000 8.0000 0.0317 ++ 648.440531 m 8.0000 707 | 8/11
33 h-m-p 0.8136 8.0000 0.3114 +Y 648.440530 0 3.2543 725 | 8/11
34 h-m-p 1.6000 8.0000 0.1635 ++ 648.440527 m 8.0000 742 | 8/11
35 h-m-p 0.0315 0.3826 41.5315 ++ 648.440428 m 0.3826 759 | 9/11
36 h-m-p 1.6000 8.0000 0.0081 ++ 648.440428 m 8.0000 776 | 9/11
37 h-m-p 0.0042 2.1232 39.1862 ++++Y 648.440428 0 1.0871 796 | 9/11
38 h-m-p 1.6000 8.0000 0.0000 N 648.440428 0 1.6000 812 | 9/11
39 h-m-p 0.0160 8.0000 0.0000 Y 648.440428 0 0.0160 828
Out..
lnL = -648.440428
829 lfun, 3316 eigenQcodon, 14922 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -648.478188 S = -648.441190 -0.014249
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:06
did 20 / 58 patterns 0:06
did 30 / 58 patterns 0:06
did 40 / 58 patterns 0:06
did 50 / 58 patterns 0:06
did 58 / 58 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074477 0.072290 0.031947 0.042538 0.101383 0.024149 0.000100 0.591224 1.430235
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.539472
np = 9
lnL0 = -700.129942
Iterating by ming2
Initial: fx= 700.129942
x= 0.07448 0.07229 0.03195 0.04254 0.10138 0.02415 0.00011 0.59122 1.43024
1 h-m-p 0.0000 0.0000 347.1098 ++ 699.905641 m 0.0000 23 | 1/9
2 h-m-p 0.0000 0.0130 45.5439 +++++ 680.425737 m 0.0130 47 | 2/9
3 h-m-p 0.0001 0.0007 142.4986 ++ 668.346686 m 0.0007 67 | 3/9
4 h-m-p 0.0003 0.0015 30.0632 ++ 657.749932 m 0.0015 86 | 4/9
5 h-m-p 0.0000 0.0002 8.4867 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 303.8971 ++ 657.148804 m 0.0000 128 | 5/9
7 h-m-p 0.0160 8.0000 1.6672 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 262.1423 ++ 650.698529 m 0.0001 172 | 6/9
9 h-m-p 0.0160 8.0000 1.3714 -------------.. | 6/9
10 h-m-p 0.0000 0.0000 216.6440 ++ 649.060503 m 0.0000 214 | 7/9
11 h-m-p 0.0160 8.0000 0.9708 -------------.. | 7/9
12 h-m-p 0.0000 0.0000 153.7157 ++ 648.440428 m 0.0000 254 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 -N 648.440428 0 0.1000 269 | 8/9
14 h-m-p 0.0160 8.0000 0.0000 N 648.440428 0 0.0040 282
Out..
lnL = -648.440428
283 lfun, 3113 eigenQcodon, 16980 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.100865 0.072405 0.050560 0.016478 0.068989 0.031964 0.000100 0.900000 0.295651 1.510672 1.225131
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 22.522579
np = 11
lnL0 = -696.761722
Iterating by ming2
Initial: fx= 696.761722
x= 0.10087 0.07240 0.05056 0.01648 0.06899 0.03196 0.00011 0.90000 0.29565 1.51067 1.22513
1 h-m-p 0.0000 0.0000 316.5674 ++ 696.629162 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0007 160.2293 ++++ 683.133381 m 0.0007 54 | 2/11
3 h-m-p 0.0001 0.0003 185.7491 ++ 672.248933 m 0.0003 78 | 3/11
4 h-m-p 0.0003 0.0017 120.9441 ++ 660.523216 m 0.0017 101 | 4/11
5 h-m-p 0.0000 0.0000 3663566.5551 ++ 659.223570 m 0.0000 123 | 5/11
6 h-m-p 0.0016 0.0120 9.3338 -----------.. | 5/11
7 h-m-p 0.0000 0.0001 247.0499 ++ 653.245338 m 0.0001 173 | 6/11
8 h-m-p 0.0011 0.0067 17.5688 ++ 651.702608 m 0.0067 193 | 7/11
9 h-m-p 0.0000 0.0002 445.1741 ++ 648.440446 m 0.0002 212 | 8/11
10 h-m-p 1.6000 8.0000 0.0002 ++ 648.440446 m 8.0000 230 | 8/11
11 h-m-p 0.0160 8.0000 0.1061 ----------Y 648.440446 0 0.0000 257 | 8/11
12 h-m-p 0.0160 8.0000 0.0029 +++++ 648.440431 m 8.0000 277 | 8/11
13 h-m-p 0.1955 8.0000 0.1173 ------------Y 648.440431 0 0.0000 306 | 8/11
14 h-m-p 0.0160 8.0000 0.0001 +++++ 648.440430 m 8.0000 326 | 8/11
15 h-m-p 0.0114 5.7064 0.1101 -----------Y 648.440430 0 0.0000 354 | 8/11
16 h-m-p 0.0063 3.1384 0.0008 +++++ 648.440428 m 3.1384 374 | 9/11
17 h-m-p 1.6000 8.0000 0.0000 ------N 648.440428 0 0.0001 397
Out..
lnL = -648.440428
398 lfun, 4776 eigenQcodon, 26268 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -648.489344 S = -648.441190 -0.021334
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:16
did 20 / 58 patterns 0:17
did 30 / 58 patterns 0:17
did 40 / 58 patterns 0:17
did 50 / 58 patterns 0:17
did 58 / 58 patterns 0:17
Time used: 0:17
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=161
NC_011896_1_WP_010907719_1_437_MLBR_RS02075 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
NC_002677_1_NP_301395_1_267_bcp LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT
**************************************************
NC_011896_1_WP_010907719_1_437_MLBR_RS02075 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
NC_002677_1_NP_301395_1_267_bcp KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC
**************************************************
NC_011896_1_WP_010907719_1_437_MLBR_RS02075 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
NC_002677_1_NP_301395_1_267_bcp KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK
**************************************************
NC_011896_1_WP_010907719_1_437_MLBR_RS02075 LRRDLSLLECC
NC_002677_1_NP_301395_1_267_bcp LRRDLSLLECC
NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 LRRDLSLLECC
NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 LRRDLSLLECC
NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 LRRDLSLLECC
NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 LRRDLSLLECC
***********
>NC_011896_1_WP_010907719_1_437_MLBR_RS02075 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT >NC_002677_1_NP_301395_1_267_bcp TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT >NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT >NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT >NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT >NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 TTGACCGAGACCACACGGCTGGCGCCCGGCGACCAAGCGCCCGCCTTCAG CTTGCCTGATGCCGATGGCAGGATAGTTTCGCTGGGAGACTATCGGGGAC AGCGTGTCACCGTATATTTCTACCCGGCAGCCTTGACACCAGGATGCACT AAACAAGCATGTGATTTTCGAGACAATTTGCATGACCTCAACGATGCCGG GCTCGATGTCGTCGGGATCTCTCCTGACCCACTAACCAAGCTGGCCGAAT TCCGTGACGCAGAGGCGTTGACGTTTCCGCTACTGTCCGACCACGACTGT AAGGTGCTGTCAGCTTGGGGCGCCTATGGCAAGAAGCAGATATACGGCAA GACCGTCCTGGGTGTTATCCGTTCCACATTTGTGGTCGATGAAAAAGGCA AAATTGTGCTCGCGCAGTACAACGTCAAAGCCACAGGCCATGTCGCCAAA CTTCGGCGCGACTTGTCGCTCTTAGAGTGTTGT
>NC_011896_1_WP_010907719_1_437_MLBR_RS02075 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC >NC_002677_1_NP_301395_1_267_bcp LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC >NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC >NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC >NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC >NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360 LTETTRLAPGDQAPAFSLPDADGRIVSLGDYRGQRVTVYFYPAALTPGCT KQACDFRDNLHDLNDAGLDVVGISPDPLTKLAEFRDAEALTFPLLSDHDC KVLSAWGAYGKKQIYGKTVLGVIRSTFVVDEKGKIVLAQYNVKATGHVAK LRRDLSLLECC
#NEXUS
[ID: 8404762428]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907719_1_437_MLBR_RS02075
NC_002677_1_NP_301395_1_267_bcp
NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025
NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360
NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275
NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907719_1_437_MLBR_RS02075,
2 NC_002677_1_NP_301395_1_267_bcp,
3 NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025,
4 NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360,
5 NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275,
6 NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06618617,2:0.06726256,3:0.06999603,4:0.06720131,5:0.07080587,6:0.07018376);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06618617,2:0.06726256,3:0.06999603,4:0.06720131,5:0.07080587,6:0.07018376);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -668.17 -671.14
2 -668.18 -670.90
--------------------------------------
TOTAL -668.17 -671.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bcp/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.893921 0.088972 0.322268 1.459693 0.864591 1290.23 1325.50 1.000
r(A<->C){all} 0.160751 0.019036 0.000179 0.439043 0.123153 222.54 239.57 1.000
r(A<->G){all} 0.174784 0.020772 0.000037 0.464746 0.138812 208.87 257.17 1.001
r(A<->T){all} 0.159280 0.019376 0.000122 0.452633 0.121841 178.73 219.46 1.001
r(C<->G){all} 0.162248 0.019311 0.000031 0.443438 0.128908 259.43 299.70 1.000
r(C<->T){all} 0.172383 0.022011 0.000116 0.465211 0.130904 338.73 369.23 1.001
r(G<->T){all} 0.170554 0.021483 0.000009 0.469751 0.130808 150.73 230.85 1.001
pi(A){all} 0.221675 0.000356 0.187121 0.260398 0.221973 1313.31 1319.56 1.001
pi(C){all} 0.280740 0.000406 0.241271 0.319069 0.280491 1198.18 1349.59 1.000
pi(G){all} 0.275550 0.000402 0.240000 0.318679 0.274933 1126.95 1151.64 1.003
pi(T){all} 0.222035 0.000341 0.184966 0.256353 0.221148 1168.41 1202.56 1.000
alpha{1,2} 0.429733 0.234479 0.000248 1.400922 0.253700 1273.23 1287.18 1.001
alpha{3} 0.472316 0.242007 0.000195 1.481140 0.310018 1062.07 1146.16 1.000
pinvar{all} 0.996845 0.000014 0.989834 0.999998 0.998079 1295.44 1296.61 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/bcp/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 161
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 4 4 4 4 4 4
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 3 3 3 3 3 3 | TGC 1 1 1 1 1 1
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 2 2 2 2 2 2 | His CAT 2 2 2 2 2 2 | Arg CGT 3 3 3 3 3 3
CTC 4 4 4 4 4 4 | CCC 2 2 2 2 2 2 | CAC 1 1 1 1 1 1 | CGC 1 1 1 1 1 1
CTA 2 2 2 2 2 2 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 6 6 6 6 6 6 | CCG 2 2 2 2 2 2 | CAG 3 3 3 3 3 3 | CGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 1 1 1 1 1 1 | Asn AAT 1 1 1 1 1 1 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 2 2 2 2 2 2 | ACA 4 4 4 4 4 4 | Lys AAA 5 5 5 5 5 5 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 1 1 1 1 1 1 | AAG 5 5 5 5 5 5 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 6 6 6 6 6 6 | Gly GGT 1 1 1 1 1 1
GTC 7 7 7 7 7 7 | GCC 8 8 8 8 8 8 | GAC 9 9 9 9 9 9 | GGC 7 7 7 7 7 7
GTA 1 1 1 1 1 1 | GCA 3 3 3 3 3 3 | Glu GAA 2 2 2 2 2 2 | GGA 3 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 3 3 3 3 3 3 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907719_1_437_MLBR_RS02075
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
#2: NC_002677_1_NP_301395_1_267_bcp
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
#3: NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
#4: NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
#5: NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
#6: NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 18 | Cys C TGT 24
TTC 18 | TCC 12 | TAC 18 | TGC 6
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 12 | His H CAT 12 | Arg R CGT 18
CTC 24 | CCC 12 | CAC 6 | CGC 6
CTA 12 | CCA 12 | Gln Q CAA 12 | CGA 6
CTG 36 | CCG 12 | CAG 18 | CGG 18
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 6 | Asn N AAT 6 | Ser S AGT 0
ATC 12 | ACC 30 | AAC 12 | AGC 6
ATA 12 | ACA 24 | Lys K AAA 30 | Arg R AGA 0
Met M ATG 0 | ACG 6 | AAG 30 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 6 | Asp D GAT 36 | Gly G GGT 6
GTC 42 | GCC 48 | GAC 54 | GGC 42
GTA 6 | GCA 18 | Glu E GAA 12 | GGA 18
GTG 18 | GCG 24 | GAG 18 | GGG 12
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.19255 C:0.22981 A:0.19255 G:0.38509
position 2: T:0.27329 C:0.25466 A:0.29193 G:0.18012
position 3: T:0.19876 C:0.36025 A:0.18012 G:0.26087
Average T:0.22153 C:0.28157 A:0.22153 G:0.27536
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 8): -648.440551 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.814656 1.225131
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907719_1_437_MLBR_RS02075: 0.000004, NC_002677_1_NP_301395_1_267_bcp: 0.000004, NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025: 0.000004, NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360: 0.000004, NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275: 0.000004, NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.81466
omega (dN/dS) = 1.22513
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
7..2 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
7..3 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
7..4 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
7..5 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
7..6 0.000 366.7 116.3 1.2251 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -648.440542 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.804945 0.698466 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907719_1_437_MLBR_RS02075: 0.000004, NC_002677_1_NP_301395_1_267_bcp: 0.000004, NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025: 0.000004, NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360: 0.000004, NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275: 0.000004, NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.80494
MLEs of dN/dS (w) for site classes (K=2)
p: 0.69847 0.30153
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
7..2 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
7..3 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
7..4 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
7..5 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
7..6 0.000 366.9 116.1 0.3015 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -648.440428 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907719_1_437_MLBR_RS02075: 0.000004, NC_002677_1_NP_301395_1_267_bcp: 0.000004, NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025: 0.000004, NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360: 0.000004, NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275: 0.000004, NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907719_1_437_MLBR_RS02075)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -648.440428 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.403092
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907719_1_437_MLBR_RS02075: 0.000004, NC_002677_1_NP_301395_1_267_bcp: 0.000004, NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025: 0.000004, NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360: 0.000004, NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275: 0.000004, NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.40309
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -648.440428 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.552641 1.414614
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907719_1_437_MLBR_RS02075: 0.000004, NC_002677_1_NP_301395_1_267_bcp: 0.000004, NZ_LVXE01000046_1_WP_010907719_1_1958_A3216_RS11025: 0.000004, NZ_LYPH01000052_1_WP_010907719_1_1958_A8144_RS09360: 0.000004, NZ_CP029543_1_WP_010907719_1_445_DIJ64_RS02275: 0.000004, NZ_AP014567_1_WP_010907719_1_462_JK2ML_RS02360: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.55264
(p1 = 0.00001) w = 1.41461
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.41461
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 385.5 97.5 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907719_1_437_MLBR_RS02075)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.096 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.104
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.103 0.102 0.101 0.100 0.100 0.099 0.098 0.097 0.097
Time used: 0:17
Model 1: NearlyNeutral -648.440542 Model 2: PositiveSelection -648.440428 Model 0: one-ratio -648.440551 Model 7: beta -648.440428 Model 8: beta&w>1 -648.440428 Model 0 vs 1 1.799999995455437E-5 Model 2 vs 1 2.2800000010647636E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
