--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:59:52 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/bfrA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -669.35 -673.17
2 -669.53 -673.36
--------------------------------------
TOTAL -669.43 -673.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.869765 0.087917 0.345811 1.454291 0.836653 1409.92 1418.26 1.000
r(A<->C){all} 0.132670 0.014971 0.000012 0.383816 0.096269 217.66 243.64 1.000
r(A<->G){all} 0.141473 0.016452 0.000042 0.406753 0.105468 136.50 170.82 1.008
r(A<->T){all} 0.227505 0.026161 0.000087 0.534009 0.194074 98.86 176.77 1.006
r(C<->G){all} 0.164854 0.019196 0.000026 0.441694 0.126077 264.42 307.77 1.002
r(C<->T){all} 0.176937 0.021419 0.000024 0.482695 0.142050 199.77 302.81 1.000
r(G<->T){all} 0.156562 0.020062 0.000021 0.445118 0.119117 139.27 181.03 1.001
pi(A){all} 0.243433 0.000379 0.206571 0.282364 0.243091 1377.17 1392.63 1.001
pi(C){all} 0.254135 0.000389 0.215538 0.291861 0.253796 1315.14 1334.26 1.000
pi(G){all} 0.301998 0.000449 0.262198 0.345100 0.302231 1203.63 1234.31 1.001
pi(T){all} 0.200434 0.000342 0.166136 0.237150 0.199712 1001.94 1189.56 1.000
alpha{1,2} 0.284949 0.122287 0.000615 0.931898 0.180849 1223.38 1234.14 1.000
alpha{3} 0.408241 0.247204 0.000134 1.321192 0.238678 1263.21 1284.73 1.000
pinvar{all} 0.992301 0.000040 0.980501 0.999844 0.994056 1393.64 1447.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -633.182508
Model 2: PositiveSelection -633.0493
Model 0: one-ratio -633.049293
Model 7: beta -633.182508
Model 8: beta&w>1 -633.0493
Model 0 vs 1 0.26642999999990025
Model 2 vs 1 0.2664159999999356
Model 8 vs 7 0.2664159999999356
>C1
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C2
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C3
MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C4
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C5
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C6
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=159
C1 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C2 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C3 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C4 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C5 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C6 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
*** **********************************************
C1 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C2 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C3 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C4 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C5 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C6 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
**************************************************
C1 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C2 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C3 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C4 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C5 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C6 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
**************************************************
C1 AQCVSRPPS
C2 AQCVSRPPS
C3 AQCVSRPPS
C4 AQCVSRPPS
C5 AQCVSRPPS
C6 AQCVSRPPS
*********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4770]--->[4770]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.694 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C2 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C3 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C4 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C5 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C6 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
*** **********************************************
C1 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C2 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C3 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C4 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C5 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C6 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
**************************************************
C1 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C2 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C3 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C4 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C5 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C6 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
**************************************************
C1 AQCVSRPPS
C2 AQCVSRPPS
C3 AQCVSRPPS
C4 AQCVSRPPS
C5 AQCVSRPPS
C6 AQCVSRPPS
*********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.37 C1 C3 99.37
TOP 2 0 99.37 C3 C1 99.37
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.37 C2 C3 99.37
TOP 2 1 99.37 C3 C2 99.37
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 99.37 C3 C4 99.37
TOP 3 2 99.37 C4 C3 99.37
BOT 2 4 99.37 C3 C5 99.37
TOP 4 2 99.37 C5 C3 99.37
BOT 2 5 99.37 C3 C6 99.37
TOP 5 2 99.37 C6 C3 99.37
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.87
AVG 1 C2 * 99.87
AVG 2 C3 * 99.37
AVG 3 C4 * 99.87
AVG 4 C5 * 99.87
AVG 5 C6 * 99.87
TOT TOT * 99.79
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C2 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C3 ATGCAAGGTGTTCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C4 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C5 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C6 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
**********:***************************************
C1 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C2 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C3 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C4 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C5 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C6 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
**************************************************
C1 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C2 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C3 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C4 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C5 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C6 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
**************************************************
C1 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C2 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C3 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C4 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C5 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C6 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
**************************************************
C1 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C2 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C3 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C4 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C5 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C6 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
**************************************************
C1 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C2 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C3 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C4 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C5 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C6 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
**************************************************
C1 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C2 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C3 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C4 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C5 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C6 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
**************************************************
C1 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C2 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C3 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C4 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C5 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C6 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
**************************************************
C1 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C2 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C3 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C4 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C5 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C6 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
**************************************************
C1 GCGCAATGCGTCTCCCGGCCGCCGAGT
C2 GCGCAATGCGTCTCCCGGCCGCCGAGT
C3 GCGCAATGCGTCTCCCGGCCGCCGAGT
C4 GCGCAATGCGTCTCCCGGCCGCCGAGT
C5 GCGCAATGCGTCTCCCGGCCGCCGAGT
C6 GCGCAATGCGTCTCCCGGCCGCCGAGT
***************************
>C1
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C2
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C3
ATGCAAGGTGTTCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C4
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C5
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C6
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C1
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C2
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C3
MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C4
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C5
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C6
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 477 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773508
Setting output file names to "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 531277281
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8058583201
Seed = 1972366896
Swapseed = 1579773508
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1070.951502 -- -24.965149
Chain 2 -- -1070.950181 -- -24.965149
Chain 3 -- -1070.950181 -- -24.965149
Chain 4 -- -1070.951669 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1070.950181 -- -24.965149
Chain 2 -- -1070.950119 -- -24.965149
Chain 3 -- -1070.950181 -- -24.965149
Chain 4 -- -1070.951730 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1070.952] (-1070.950) (-1070.950) (-1070.952) * [-1070.950] (-1070.950) (-1070.950) (-1070.952)
500 -- (-679.267) [-676.980] (-671.723) (-675.977) * (-673.575) [-673.539] (-680.677) (-675.855) -- 0:00:00
1000 -- (-681.125) [-675.323] (-673.087) (-675.099) * (-678.819) (-674.176) [-673.991] (-678.234) -- 0:00:00
1500 -- (-672.961) [-674.145] (-673.717) (-674.997) * (-676.851) (-671.999) (-677.029) [-673.590] -- 0:00:00
2000 -- (-674.068) (-686.434) [-675.930] (-676.876) * [-669.817] (-679.751) (-681.801) (-677.601) -- 0:00:00
2500 -- [-680.379] (-681.564) (-672.389) (-684.350) * (-672.279) [-674.532] (-675.265) (-674.623) -- 0:00:00
3000 -- (-675.142) [-671.584] (-679.130) (-673.030) * [-675.435] (-677.775) (-673.972) (-682.322) -- 0:00:00
3500 -- [-672.900] (-672.899) (-670.510) (-670.425) * (-680.496) (-675.718) [-671.488] (-674.830) -- 0:00:00
4000 -- (-673.904) (-675.816) (-672.295) [-672.264] * [-672.639] (-678.260) (-678.122) (-675.225) -- 0:04:09
4500 -- (-674.887) [-670.972] (-671.856) (-678.322) * (-671.795) [-675.285] (-671.659) (-674.044) -- 0:03:41
5000 -- [-675.536] (-679.134) (-672.873) (-674.352) * (-677.924) [-675.901] (-674.298) (-680.789) -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- (-673.436) (-674.171) (-679.455) [-676.519] * (-676.664) [-673.237] (-674.016) (-676.400) -- 0:03:00
6000 -- (-680.355) (-676.391) [-671.240] (-676.181) * (-679.724) [-673.639] (-676.018) (-671.633) -- 0:02:45
6500 -- (-673.103) (-682.060) (-670.674) [-672.106] * [-670.211] (-675.590) (-679.178) (-677.129) -- 0:02:32
7000 -- (-674.291) (-671.350) (-681.539) [-672.945] * (-680.735) (-695.061) (-677.914) [-670.479] -- 0:02:21
7500 -- (-673.517) (-676.668) [-670.394] (-677.882) * [-669.910] (-680.006) (-688.114) (-679.053) -- 0:02:12
8000 -- [-673.040] (-675.507) (-674.734) (-673.933) * (-679.506) [-673.405] (-680.681) (-677.193) -- 0:02:04
8500 -- (-674.820) (-676.236) [-668.776] (-678.357) * (-669.084) (-681.068) (-671.435) [-673.938] -- 0:01:56
9000 -- (-682.427) [-682.024] (-669.822) (-680.868) * (-669.789) (-684.207) [-672.082] (-679.096) -- 0:01:50
9500 -- [-670.501] (-680.188) (-681.048) (-677.709) * (-672.899) (-677.715) (-673.345) [-673.149] -- 0:01:44
10000 -- (-670.368) (-677.133) (-670.551) [-672.283] * (-668.969) (-677.349) (-672.045) [-671.731] -- 0:01:39
Average standard deviation of split frequencies: 0.074327
10500 -- (-670.960) [-670.704] (-672.694) (-672.883) * (-669.604) (-680.457) (-671.810) [-674.088] -- 0:01:34
11000 -- [-668.834] (-678.874) (-673.222) (-673.706) * (-671.238) [-676.868] (-676.396) (-676.251) -- 0:01:29
11500 -- (-670.340) (-676.231) [-673.114] (-679.915) * (-670.629) (-675.829) (-673.104) [-671.056] -- 0:01:25
12000 -- [-669.848] (-671.800) (-683.234) (-683.307) * (-672.037) (-675.476) [-674.332] (-672.473) -- 0:01:22
12500 -- (-672.349) (-678.245) (-683.845) [-672.167] * (-672.275) [-670.287] (-670.967) (-675.632) -- 0:01:19
13000 -- (-673.214) [-675.303] (-690.637) (-673.150) * (-674.898) [-674.556] (-674.960) (-671.145) -- 0:01:15
13500 -- (-670.868) (-682.018) [-670.057] (-672.457) * (-671.170) (-680.186) (-670.870) [-677.396] -- 0:01:13
14000 -- (-670.627) [-673.096] (-669.923) (-676.340) * (-671.244) [-675.775] (-670.868) (-671.411) -- 0:01:10
14500 -- (-672.779) (-677.048) (-667.402) [-674.398] * (-670.115) (-678.030) [-672.215] (-679.656) -- 0:01:07
15000 -- (-674.408) (-674.637) [-669.333] (-674.220) * (-670.134) (-685.006) (-673.049) [-671.511] -- 0:01:05
Average standard deviation of split frequencies: 0.062199
15500 -- (-672.193) (-677.287) [-672.406] (-674.398) * (-669.179) (-672.312) (-675.944) [-671.671] -- 0:01:03
16000 -- (-669.863) (-681.895) (-669.994) [-675.398] * [-669.741] (-673.753) (-671.589) (-676.988) -- 0:01:01
16500 -- (-674.876) [-673.996] (-668.261) (-680.096) * (-668.700) (-677.309) (-671.744) [-675.553] -- 0:00:59
17000 -- (-667.361) [-669.696] (-673.502) (-674.906) * (-667.610) (-674.136) (-671.497) [-669.211] -- 0:00:57
17500 -- [-669.946] (-682.921) (-668.186) (-671.456) * (-669.518) (-681.955) (-671.278) [-676.033] -- 0:00:56
18000 -- (-669.071) (-672.520) [-669.303] (-675.129) * [-670.121] (-669.627) (-673.321) (-672.772) -- 0:00:54
18500 -- (-669.172) [-672.077] (-672.407) (-680.099) * (-670.862) [-675.544] (-672.002) (-671.736) -- 0:00:53
19000 -- (-669.004) [-676.581] (-670.910) (-675.035) * (-672.675) (-678.417) (-671.576) [-675.661] -- 0:00:51
19500 -- (-670.864) (-672.668) [-667.794] (-675.222) * (-671.903) (-682.851) [-671.340] (-685.367) -- 0:01:40
20000 -- (-676.452) (-670.564) (-667.262) [-675.941] * (-670.781) [-671.295] (-671.015) (-680.817) -- 0:01:38
Average standard deviation of split frequencies: 0.055884
20500 -- (-670.953) (-674.282) [-669.413] (-681.967) * (-673.875) (-678.395) (-674.104) [-670.820] -- 0:01:35
21000 -- (-668.288) [-672.091] (-668.879) (-676.764) * (-668.468) [-672.381] (-674.562) (-675.523) -- 0:01:33
21500 -- (-670.157) (-679.636) (-668.926) [-676.249] * (-668.538) [-670.879] (-668.837) (-670.562) -- 0:01:31
22000 -- [-668.511] (-674.159) (-671.485) (-682.297) * (-668.265) [-680.965] (-673.960) (-672.006) -- 0:01:28
22500 -- (-668.548) (-684.845) (-667.959) [-678.049] * (-668.036) [-676.273] (-669.969) (-672.477) -- 0:01:26
23000 -- (-672.603) (-686.633) (-669.836) [-676.143] * (-670.883) (-679.919) (-669.409) [-680.049] -- 0:01:24
23500 -- (-674.585) [-671.255] (-672.020) (-678.975) * (-674.953) [-673.685] (-670.492) (-677.816) -- 0:01:23
24000 -- (-674.881) (-674.789) [-670.346] (-693.847) * (-668.881) [-674.235] (-672.907) (-681.521) -- 0:01:21
24500 -- (-678.530) (-680.662) [-668.552] (-677.142) * (-668.973) [-671.455] (-671.763) (-672.985) -- 0:01:19
25000 -- (-676.641) [-671.162] (-675.043) (-685.903) * (-671.665) (-678.124) [-672.028] (-680.766) -- 0:01:18
Average standard deviation of split frequencies: 0.040383
25500 -- (-677.105) [-673.561] (-677.176) (-677.264) * (-670.673) (-673.493) (-671.767) [-672.786] -- 0:01:16
26000 -- (-674.133) (-674.053) (-675.284) [-678.491] * (-669.462) (-679.394) [-670.998] (-674.178) -- 0:01:14
26500 -- (-668.789) (-676.404) (-672.906) [-672.069] * [-671.427] (-677.760) (-671.339) (-672.509) -- 0:01:13
27000 -- (-668.209) (-675.657) (-672.093) [-673.485] * [-668.890] (-675.964) (-670.731) (-678.209) -- 0:01:12
27500 -- [-668.642] (-672.457) (-673.167) (-681.719) * (-671.083) (-677.560) (-672.582) [-675.405] -- 0:01:10
28000 -- (-669.722) [-669.142] (-669.847) (-679.407) * (-673.108) (-673.658) [-669.231] (-676.271) -- 0:01:09
28500 -- [-672.174] (-673.095) (-668.870) (-689.223) * [-668.119] (-678.272) (-677.264) (-676.971) -- 0:01:08
29000 -- (-668.235) [-676.682] (-669.760) (-674.402) * (-669.842) (-678.246) [-672.984] (-679.682) -- 0:01:06
29500 -- (-668.726) (-675.557) (-670.241) [-673.051] * (-670.122) (-681.963) [-670.383] (-676.186) -- 0:01:05
30000 -- [-670.989] (-677.470) (-669.211) (-673.677) * [-671.224] (-681.676) (-670.714) (-672.761) -- 0:01:04
Average standard deviation of split frequencies: 0.045262
30500 -- (-672.312) [-673.888] (-668.156) (-670.272) * (-671.686) [-670.929] (-672.793) (-683.752) -- 0:01:03
31000 -- (-670.004) (-682.823) [-671.784] (-669.586) * (-669.306) (-684.120) [-673.428] (-671.599) -- 0:01:02
31500 -- (-672.223) (-671.927) (-668.994) [-668.417] * [-671.039] (-669.992) (-672.389) (-674.994) -- 0:01:01
32000 -- (-672.971) (-673.256) [-668.244] (-668.738) * [-667.927] (-675.198) (-667.764) (-671.250) -- 0:01:00
32500 -- (-673.470) [-672.214] (-671.341) (-669.494) * (-669.384) (-678.753) [-673.250] (-669.994) -- 0:00:59
33000 -- (-672.597) (-672.908) [-670.593] (-669.452) * (-668.626) (-674.519) (-669.449) [-670.103] -- 0:00:58
33500 -- [-671.260] (-672.300) (-671.654) (-669.672) * [-670.801] (-675.964) (-671.339) (-669.500) -- 0:00:57
34000 -- (-671.782) (-669.301) (-671.912) [-670.514] * (-669.537) [-674.753] (-668.590) (-669.960) -- 0:00:56
34500 -- (-674.492) (-670.496) [-669.139] (-672.119) * (-671.610) [-671.532] (-671.070) (-670.332) -- 0:00:55
35000 -- (-671.764) [-669.713] (-671.262) (-671.027) * (-670.630) (-675.757) [-668.768] (-669.094) -- 0:01:22
Average standard deviation of split frequencies: 0.045831
35500 -- (-674.394) [-672.107] (-669.587) (-672.487) * (-670.480) [-677.830] (-672.297) (-671.123) -- 0:01:21
36000 -- [-669.525] (-670.786) (-675.204) (-671.807) * (-669.991) (-672.919) (-671.208) [-667.599] -- 0:01:20
36500 -- (-669.001) (-668.855) (-669.999) [-669.350] * (-669.911) (-680.564) [-673.392] (-671.633) -- 0:01:19
37000 -- (-670.852) [-668.818] (-669.711) (-671.026) * (-670.469) (-674.022) [-671.879] (-675.629) -- 0:01:18
37500 -- (-677.437) (-669.632) [-671.033] (-671.234) * (-675.024) (-679.911) [-670.430] (-669.040) -- 0:01:17
38000 -- (-671.825) (-669.055) [-670.736] (-671.751) * (-674.065) [-676.204] (-670.650) (-673.162) -- 0:01:15
38500 -- (-669.013) [-669.514] (-675.285) (-674.020) * [-672.308] (-670.390) (-668.888) (-668.986) -- 0:01:14
39000 -- [-673.850] (-675.567) (-672.004) (-671.666) * (-672.277) [-672.217] (-667.233) (-668.420) -- 0:01:13
39500 -- (-670.189) [-668.757] (-672.136) (-672.271) * (-670.082) (-682.052) (-670.519) [-671.562] -- 0:01:12
40000 -- (-673.242) [-669.594] (-667.325) (-669.795) * [-672.471] (-678.046) (-671.517) (-671.269) -- 0:01:12
Average standard deviation of split frequencies: 0.036708
40500 -- (-672.496) (-670.059) [-668.273] (-670.283) * (-671.698) [-671.770] (-673.390) (-671.506) -- 0:01:11
41000 -- (-674.408) (-670.338) (-669.247) [-669.938] * (-670.492) (-674.436) [-669.211] (-671.480) -- 0:01:10
41500 -- (-669.470) (-669.281) (-670.447) [-670.146] * (-670.967) (-670.589) [-669.691] (-671.209) -- 0:01:09
42000 -- (-672.025) (-670.697) [-668.918] (-670.789) * (-671.513) [-676.054] (-669.298) (-672.162) -- 0:01:08
42500 -- [-671.811] (-673.601) (-668.675) (-672.076) * (-677.150) [-670.920] (-667.844) (-670.360) -- 0:01:07
43000 -- (-671.198) (-672.912) (-668.839) [-671.332] * (-671.526) [-679.363] (-670.258) (-671.219) -- 0:01:06
43500 -- (-671.588) (-671.993) [-668.647] (-675.166) * (-670.297) [-674.642] (-670.058) (-670.568) -- 0:01:05
44000 -- [-670.705] (-677.339) (-669.611) (-670.875) * (-671.856) (-673.104) [-669.627] (-670.014) -- 0:01:05
44500 -- (-671.236) (-677.772) (-672.082) [-673.306] * (-671.044) (-678.949) (-670.923) [-670.998] -- 0:01:04
45000 -- (-672.146) (-675.535) (-670.010) [-674.319] * (-669.432) (-677.964) (-670.766) [-672.422] -- 0:01:03
Average standard deviation of split frequencies: 0.036380
45500 -- (-668.616) (-675.646) (-670.229) [-671.143] * (-669.577) [-673.245] (-673.884) (-671.115) -- 0:01:02
46000 -- (-675.652) (-676.313) [-669.664] (-672.215) * [-672.364] (-671.297) (-669.643) (-669.411) -- 0:01:02
46500 -- (-671.127) [-670.595] (-671.271) (-670.773) * (-675.256) (-674.922) (-670.897) [-669.634] -- 0:01:01
47000 -- (-670.393) (-671.596) (-669.264) [-672.660] * (-668.914) (-675.286) [-670.970] (-670.253) -- 0:01:00
47500 -- [-672.088] (-671.346) (-672.030) (-671.410) * (-670.209) (-672.410) (-669.142) [-671.592] -- 0:01:00
48000 -- (-671.719) (-671.584) (-671.188) [-668.425] * (-671.990) [-678.339] (-669.889) (-669.067) -- 0:00:59
48500 -- (-672.305) (-672.033) [-669.927] (-672.354) * (-669.535) [-676.941] (-668.774) (-667.528) -- 0:00:58
49000 -- (-674.211) [-673.621] (-668.708) (-674.550) * (-670.516) (-683.609) (-670.134) [-668.961] -- 0:00:58
49500 -- (-673.944) (-672.399) (-671.071) [-671.987] * [-668.624] (-674.346) (-672.422) (-671.548) -- 0:00:57
50000 -- (-673.320) [-672.977] (-674.778) (-675.341) * (-668.236) [-673.274] (-669.095) (-673.161) -- 0:00:57
Average standard deviation of split frequencies: 0.036370
50500 -- [-671.346] (-671.076) (-668.068) (-672.309) * [-670.891] (-676.340) (-674.529) (-674.580) -- 0:01:15
51000 -- [-671.877] (-669.535) (-669.034) (-673.151) * [-670.709] (-675.075) (-668.226) (-672.394) -- 0:01:14
51500 -- [-670.035] (-669.493) (-667.843) (-671.109) * (-669.693) [-670.684] (-668.803) (-673.451) -- 0:01:13
52000 -- (-670.067) (-672.064) [-668.221] (-673.173) * [-672.211] (-670.138) (-676.281) (-670.729) -- 0:01:12
52500 -- (-675.534) (-668.678) (-668.734) [-671.507] * (-669.288) (-676.334) (-669.787) [-670.741] -- 0:01:12
53000 -- [-670.278] (-672.475) (-668.507) (-671.837) * [-669.027] (-688.149) (-669.063) (-670.819) -- 0:01:11
53500 -- [-669.313] (-670.944) (-670.361) (-670.597) * (-671.807) [-675.289] (-668.852) (-673.308) -- 0:01:10
54000 -- (-668.932) (-674.312) (-671.263) [-671.311] * (-668.459) [-675.143] (-671.069) (-671.760) -- 0:01:10
54500 -- (-671.970) [-668.946] (-671.478) (-673.146) * [-671.755] (-672.674) (-670.808) (-673.448) -- 0:01:09
55000 -- (-673.220) (-669.452) [-669.339] (-672.581) * (-669.444) [-673.256] (-671.990) (-668.338) -- 0:01:08
Average standard deviation of split frequencies: 0.031900
55500 -- (-670.518) [-670.873] (-669.912) (-672.479) * (-667.900) [-678.090] (-674.670) (-672.229) -- 0:01:08
56000 -- (-668.536) [-670.044] (-668.336) (-672.890) * [-669.977] (-692.439) (-669.705) (-672.325) -- 0:01:07
56500 -- (-671.934) [-669.083] (-670.068) (-670.868) * (-668.538) (-683.406) (-670.707) [-669.636] -- 0:01:06
57000 -- [-669.141] (-671.181) (-669.780) (-674.340) * (-668.273) (-673.134) (-671.604) [-673.427] -- 0:01:06
57500 -- (-669.776) (-670.890) [-671.302] (-670.819) * [-669.762] (-669.845) (-668.983) (-673.039) -- 0:01:05
58000 -- (-672.439) (-671.441) (-670.435) [-668.993] * [-670.270] (-670.642) (-669.381) (-674.389) -- 0:01:04
58500 -- (-673.020) (-671.378) [-669.888] (-668.562) * (-670.252) (-668.353) (-667.910) [-668.230] -- 0:01:04
59000 -- (-670.804) [-671.279] (-670.355) (-672.187) * (-670.645) (-669.665) (-678.021) [-668.895] -- 0:01:03
59500 -- (-670.827) [-670.232] (-669.719) (-668.838) * [-669.653] (-674.660) (-667.847) (-670.656) -- 0:01:03
60000 -- (-669.474) (-672.227) (-670.413) [-668.962] * [-670.017] (-672.363) (-670.717) (-670.527) -- 0:01:02
Average standard deviation of split frequencies: 0.032377
60500 -- (-673.076) [-671.536] (-668.463) (-674.275) * (-670.677) (-670.366) (-668.308) [-670.013] -- 0:01:02
61000 -- (-668.541) (-671.322) (-667.816) [-673.146] * [-668.746] (-671.820) (-670.411) (-670.237) -- 0:01:01
61500 -- [-669.861] (-671.784) (-669.573) (-671.844) * (-671.707) (-672.184) (-670.729) [-670.734] -- 0:01:01
62000 -- (-670.343) [-668.902] (-670.844) (-669.498) * (-671.423) (-675.512) [-668.641] (-671.421) -- 0:01:00
62500 -- (-671.003) (-670.997) (-670.503) [-672.106] * (-671.102) (-671.363) (-670.726) [-668.344] -- 0:01:00
63000 -- [-672.869] (-670.394) (-674.904) (-669.788) * (-670.825) [-668.115] (-669.937) (-669.562) -- 0:00:59
63500 -- (-675.014) (-669.984) (-671.702) [-671.477] * (-668.328) (-672.047) (-671.009) [-673.378] -- 0:00:58
64000 -- (-673.826) [-670.132] (-671.929) (-671.591) * (-670.466) (-669.797) (-672.296) [-671.283] -- 0:00:58
64500 -- (-669.422) (-669.056) [-669.133] (-672.729) * (-670.775) (-673.005) (-670.392) [-672.216] -- 0:00:58
65000 -- [-670.154] (-672.153) (-671.213) (-672.650) * (-671.662) (-670.725) [-669.295] (-675.880) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
65500 -- (-667.955) (-669.473) (-672.742) [-672.749] * [-669.162] (-669.604) (-673.522) (-672.513) -- 0:01:11
66000 -- (-669.330) [-668.796] (-676.594) (-672.063) * (-671.079) [-669.732] (-670.458) (-671.749) -- 0:01:10
66500 -- (-670.549) (-670.091) (-671.998) [-670.823] * [-669.839] (-672.229) (-670.671) (-671.958) -- 0:01:10
67000 -- (-673.400) (-673.451) [-671.853] (-672.532) * [-670.953] (-670.258) (-669.337) (-670.371) -- 0:01:09
67500 -- (-669.407) [-669.103] (-670.763) (-671.983) * (-670.197) (-668.813) [-672.717] (-671.750) -- 0:01:09
68000 -- (-674.865) (-668.320) (-671.417) [-671.162] * (-670.389) (-671.071) [-671.241] (-671.257) -- 0:01:08
68500 -- (-674.521) (-669.977) [-672.013] (-672.260) * (-671.490) (-670.917) (-669.420) [-679.562] -- 0:01:07
69000 -- (-673.101) (-670.744) [-666.671] (-671.163) * [-673.051] (-669.500) (-668.850) (-676.170) -- 0:01:07
69500 -- [-671.598] (-669.861) (-674.252) (-670.470) * (-672.419) [-668.355] (-675.263) (-669.431) -- 0:01:06
70000 -- [-672.683] (-669.419) (-671.169) (-670.313) * (-670.898) [-667.948] (-674.609) (-668.091) -- 0:01:06
Average standard deviation of split frequencies: 0.033354
70500 -- (-669.113) (-669.912) (-671.739) [-670.422] * (-672.115) (-670.220) [-669.202] (-672.510) -- 0:01:05
71000 -- (-669.711) (-670.999) [-671.287] (-670.467) * (-674.169) [-670.670] (-670.315) (-670.646) -- 0:01:05
71500 -- (-670.569) [-670.311] (-672.289) (-672.789) * (-680.526) (-669.918) [-670.426] (-670.564) -- 0:01:04
72000 -- (-672.643) (-673.457) [-673.235] (-671.345) * [-673.777] (-671.602) (-669.154) (-668.981) -- 0:01:04
72500 -- (-673.470) (-670.335) (-675.673) [-671.462] * (-674.583) (-674.964) (-668.568) [-668.588] -- 0:01:03
73000 -- (-673.398) [-670.056] (-675.424) (-670.290) * (-672.145) (-669.983) (-671.233) [-670.439] -- 0:01:03
73500 -- (-672.771) (-670.636) (-673.295) [-670.889] * (-671.393) (-672.830) [-670.446] (-669.720) -- 0:01:03
74000 -- (-672.170) (-670.121) (-673.222) [-671.785] * (-670.765) (-668.629) [-671.461] (-670.671) -- 0:01:02
74500 -- (-672.013) (-670.009) [-676.359] (-670.679) * (-674.419) (-668.259) [-667.606] (-668.523) -- 0:01:02
75000 -- (-671.676) [-674.583] (-669.548) (-670.327) * (-671.023) (-669.470) [-672.113] (-668.569) -- 0:01:01
Average standard deviation of split frequencies: 0.030324
75500 -- (-672.317) (-673.408) (-667.898) [-672.868] * (-670.357) (-671.590) (-669.683) [-672.519] -- 0:01:01
76000 -- (-672.333) (-670.670) [-669.414] (-668.722) * (-672.633) (-670.155) [-667.993] (-671.891) -- 0:01:00
76500 -- (-671.918) (-674.120) [-670.137] (-669.826) * (-672.632) (-671.928) (-670.113) [-670.789] -- 0:01:00
77000 -- (-672.573) (-673.743) (-668.615) [-670.264] * (-670.951) [-669.658] (-667.736) (-671.098) -- 0:00:59
77500 -- (-671.910) (-671.936) [-672.287] (-668.336) * (-672.078) [-669.052] (-669.494) (-669.528) -- 0:00:59
78000 -- (-672.439) (-669.831) [-669.814] (-668.339) * [-671.902] (-672.300) (-670.747) (-669.086) -- 0:00:59
78500 -- (-673.591) (-673.320) [-671.881] (-671.095) * (-671.421) [-669.584] (-667.067) (-675.929) -- 0:00:58
79000 -- (-674.417) [-671.148] (-670.144) (-668.694) * (-669.651) (-669.576) (-671.038) [-668.446] -- 0:00:58
79500 -- (-671.368) (-670.640) [-668.885] (-675.441) * (-670.428) (-670.829) [-670.641] (-673.322) -- 0:00:57
80000 -- [-672.265] (-670.244) (-668.613) (-669.595) * [-670.692] (-671.620) (-672.249) (-669.672) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-673.684) (-669.555) (-670.441) [-670.354] * (-668.367) (-673.411) [-669.500] (-669.757) -- 0:00:57
81000 -- (-672.920) (-673.542) (-673.604) [-670.108] * (-668.701) (-673.181) (-672.668) [-669.426] -- 0:00:56
81500 -- [-676.646] (-671.544) (-671.849) (-669.619) * (-667.326) [-672.843] (-669.005) (-678.466) -- 0:01:07
82000 -- (-668.268) (-671.379) [-669.593] (-670.007) * [-669.718] (-672.903) (-667.937) (-681.465) -- 0:01:07
82500 -- (-667.945) (-675.413) (-673.518) [-668.416] * (-669.566) [-668.330] (-669.946) (-671.173) -- 0:01:06
83000 -- (-671.454) (-674.969) (-673.788) [-668.612] * (-670.629) [-669.152] (-668.290) (-669.747) -- 0:01:06
83500 -- (-672.681) (-673.391) (-668.808) [-667.413] * (-672.961) (-670.251) [-668.656] (-668.822) -- 0:01:05
84000 -- (-669.370) [-672.825] (-679.340) (-667.834) * (-671.490) [-669.445] (-668.879) (-667.910) -- 0:01:05
84500 -- [-668.196] (-672.311) (-673.608) (-668.052) * (-670.885) (-674.667) (-672.258) [-670.624] -- 0:01:05
85000 -- (-670.408) (-672.388) (-672.766) [-669.278] * [-673.317] (-678.661) (-670.936) (-671.572) -- 0:01:04
Average standard deviation of split frequencies: 0.023080
85500 -- (-669.451) [-670.609] (-677.011) (-672.282) * (-673.311) (-679.339) (-673.347) [-669.445] -- 0:01:04
86000 -- (-672.587) (-671.579) [-669.777] (-671.860) * (-669.705) (-671.507) (-677.330) [-668.785] -- 0:01:03
86500 -- (-666.894) (-674.120) (-668.410) [-670.496] * (-672.281) (-675.934) (-674.410) [-668.824] -- 0:01:03
87000 -- (-672.151) (-671.805) [-667.993] (-667.636) * [-669.490] (-671.565) (-671.095) (-675.327) -- 0:01:02
87500 -- (-669.396) (-670.659) (-671.681) [-668.679] * (-669.154) [-670.867] (-676.362) (-669.476) -- 0:01:02
88000 -- (-667.745) (-672.173) [-671.218] (-669.895) * [-670.916] (-670.926) (-677.292) (-670.205) -- 0:01:02
88500 -- (-667.183) [-668.326] (-668.723) (-674.365) * (-669.790) (-671.834) (-669.923) [-669.857] -- 0:01:01
89000 -- (-667.150) [-668.261] (-667.556) (-669.212) * (-670.524) (-670.376) [-672.157] (-667.587) -- 0:01:01
89500 -- (-669.739) (-670.502) [-671.067] (-669.801) * (-670.164) [-670.235] (-673.671) (-668.119) -- 0:01:01
90000 -- [-667.522] (-670.549) (-671.151) (-668.238) * (-668.568) (-670.061) [-673.183] (-669.764) -- 0:01:00
Average standard deviation of split frequencies: 0.024628
90500 -- [-668.747] (-669.033) (-670.055) (-670.992) * (-672.849) [-669.765] (-671.697) (-670.333) -- 0:01:00
91000 -- (-668.532) (-671.644) [-668.522] (-672.244) * (-672.402) (-672.185) [-671.604] (-674.795) -- 0:00:59
91500 -- [-668.744] (-670.767) (-669.147) (-669.108) * [-672.250] (-669.157) (-672.939) (-671.240) -- 0:00:59
92000 -- (-669.545) (-677.098) [-672.685] (-669.455) * [-669.374] (-669.248) (-669.817) (-672.233) -- 0:00:59
92500 -- [-670.429] (-668.571) (-669.936) (-671.476) * (-671.247) (-672.876) [-669.212] (-669.798) -- 0:00:58
93000 -- (-671.901) [-669.331] (-679.359) (-672.688) * [-671.606] (-672.830) (-668.241) (-671.431) -- 0:00:58
93500 -- (-669.938) [-672.516] (-670.596) (-671.809) * (-672.576) (-673.070) (-667.643) [-669.454] -- 0:00:58
94000 -- (-669.029) [-671.442] (-669.935) (-669.778) * (-669.514) (-671.857) (-668.897) [-667.351] -- 0:00:57
94500 -- [-667.644] (-672.981) (-668.698) (-670.471) * (-670.247) [-669.542] (-669.834) (-668.432) -- 0:00:57
95000 -- (-668.748) (-670.117) (-668.470) [-675.251] * (-667.167) (-670.037) [-668.963] (-673.704) -- 0:00:57
Average standard deviation of split frequencies: 0.021361
95500 -- [-669.588] (-670.423) (-670.118) (-670.566) * (-674.075) (-670.103) [-668.318] (-670.801) -- 0:00:56
96000 -- (-671.650) (-672.548) (-670.120) [-670.622] * [-671.985] (-670.089) (-668.177) (-669.282) -- 0:00:56
96500 -- (-670.094) (-671.238) (-671.213) [-670.524] * [-670.137] (-671.429) (-669.843) (-669.612) -- 0:00:56
97000 -- [-670.048] (-671.172) (-668.176) (-671.812) * [-670.603] (-671.462) (-671.468) (-670.299) -- 0:01:05
97500 -- [-668.628] (-671.979) (-671.836) (-671.386) * (-670.536) [-675.056] (-672.181) (-670.417) -- 0:01:04
98000 -- (-669.752) (-673.205) [-669.721] (-670.976) * [-672.611] (-675.446) (-673.246) (-668.992) -- 0:01:04
98500 -- (-671.422) (-673.961) [-672.607] (-670.681) * [-669.616] (-674.719) (-669.312) (-668.574) -- 0:01:04
99000 -- (-672.723) [-672.163] (-671.088) (-669.928) * (-676.075) (-670.323) (-671.671) [-668.888] -- 0:01:03
99500 -- (-672.442) [-671.585] (-673.189) (-670.947) * [-674.277] (-671.074) (-672.746) (-670.952) -- 0:01:03
100000 -- (-672.642) [-670.549] (-670.170) (-669.203) * (-670.423) (-667.862) [-668.067] (-668.885) -- 0:01:02
Average standard deviation of split frequencies: 0.019224
100500 -- (-671.374) (-670.706) (-670.147) [-673.328] * (-668.307) (-669.458) [-668.887] (-669.587) -- 0:01:02
101000 -- [-669.674] (-670.740) (-672.627) (-671.148) * (-668.121) (-670.961) [-670.549] (-674.891) -- 0:01:02
101500 -- (-668.585) [-672.768] (-669.440) (-670.481) * [-669.119] (-671.317) (-668.661) (-671.201) -- 0:01:01
102000 -- (-672.311) (-673.203) [-668.269] (-668.753) * [-670.364] (-672.198) (-670.905) (-668.676) -- 0:01:01
102500 -- (-672.265) (-674.020) (-669.311) [-669.194] * [-672.132] (-669.264) (-669.693) (-669.238) -- 0:01:01
103000 -- [-670.860] (-671.231) (-668.064) (-670.990) * (-671.866) [-669.828] (-671.352) (-669.285) -- 0:01:00
103500 -- (-669.652) [-668.631] (-668.038) (-671.602) * [-668.410] (-671.848) (-669.958) (-669.381) -- 0:01:00
104000 -- (-671.315) (-671.966) [-669.974] (-670.647) * [-666.030] (-668.776) (-671.529) (-668.968) -- 0:01:00
104500 -- [-668.794] (-672.360) (-670.564) (-670.679) * (-673.125) (-670.795) (-670.049) [-673.059] -- 0:00:59
105000 -- (-670.350) (-671.396) [-667.978] (-673.554) * (-669.589) (-668.511) [-669.040] (-671.688) -- 0:00:59
Average standard deviation of split frequencies: 0.020832
105500 -- (-669.473) (-674.229) (-669.595) [-670.615] * (-674.240) (-668.140) [-671.924] (-674.795) -- 0:00:59
106000 -- (-671.335) (-671.316) [-669.639] (-672.849) * (-670.032) (-670.687) [-667.527] (-677.271) -- 0:00:59
106500 -- (-671.412) [-672.006] (-669.828) (-670.715) * [-671.111] (-669.284) (-667.962) (-672.200) -- 0:00:58
107000 -- [-670.146] (-672.327) (-670.733) (-671.818) * (-666.807) (-668.681) [-668.862] (-669.098) -- 0:00:58
107500 -- (-669.426) [-672.068] (-671.523) (-669.134) * (-669.914) [-671.014] (-667.122) (-670.685) -- 0:00:58
108000 -- [-674.499] (-672.013) (-667.420) (-670.555) * (-667.651) [-671.115] (-668.559) (-671.154) -- 0:00:57
108500 -- (-674.636) (-676.459) (-670.236) [-669.429] * (-667.644) (-670.171) [-668.243] (-670.727) -- 0:00:57
109000 -- [-673.226] (-674.325) (-670.354) (-669.839) * (-670.879) [-668.832] (-671.221) (-669.096) -- 0:00:57
109500 -- (-672.933) [-671.609] (-669.116) (-672.581) * (-670.733) (-669.047) (-668.001) [-669.053] -- 0:00:56
110000 -- (-669.592) (-672.156) [-668.155] (-668.976) * (-670.871) (-671.904) [-668.787] (-669.229) -- 0:00:56
Average standard deviation of split frequencies: 0.021511
110500 -- [-667.814] (-672.822) (-670.070) (-672.340) * (-669.109) [-669.422] (-675.418) (-669.750) -- 0:00:56
111000 -- (-668.648) (-672.072) [-669.142] (-674.700) * (-671.976) (-671.095) [-671.306] (-673.965) -- 0:00:56
111500 -- (-668.247) (-671.229) (-669.956) [-669.672] * (-672.170) (-672.570) [-674.123] (-667.864) -- 0:00:55
112000 -- (-670.148) (-671.567) (-670.496) [-670.532] * (-670.772) (-676.415) (-672.208) [-672.504] -- 0:00:55
112500 -- [-671.324] (-670.329) (-668.620) (-671.510) * (-669.482) [-672.348] (-673.077) (-672.384) -- 0:01:03
113000 -- (-671.876) (-672.770) (-671.249) [-675.461] * [-668.052] (-673.054) (-672.861) (-670.404) -- 0:01:02
113500 -- (-672.547) [-669.548] (-668.953) (-673.785) * (-667.816) (-668.409) (-671.405) [-673.226] -- 0:01:02
114000 -- (-668.776) [-668.963] (-668.791) (-671.936) * (-666.638) (-668.465) [-677.667] (-670.318) -- 0:01:02
114500 -- (-676.558) (-674.749) [-669.671] (-670.502) * [-668.428] (-672.567) (-675.746) (-668.594) -- 0:01:01
115000 -- (-670.495) [-670.666] (-669.581) (-670.880) * (-669.840) (-670.988) [-672.165] (-670.837) -- 0:01:01
Average standard deviation of split frequencies: 0.018084
115500 -- (-674.759) (-671.273) (-669.833) [-670.414] * (-669.781) [-667.749] (-670.510) (-672.350) -- 0:01:01
116000 -- (-670.900) [-673.550] (-669.729) (-670.851) * (-670.610) [-671.351] (-668.691) (-673.488) -- 0:01:00
116500 -- (-671.354) [-672.675] (-670.250) (-671.975) * (-673.192) [-669.662] (-671.114) (-672.305) -- 0:01:00
117000 -- (-669.996) (-674.859) [-668.625] (-671.375) * [-670.378] (-668.803) (-668.705) (-670.485) -- 0:01:00
117500 -- (-669.034) (-671.693) [-670.945] (-675.057) * (-671.970) (-669.508) (-669.810) [-671.211] -- 0:01:00
118000 -- [-671.886] (-671.404) (-670.763) (-669.825) * [-668.005] (-666.920) (-671.984) (-671.921) -- 0:00:59
118500 -- (-667.976) (-669.479) [-671.790] (-670.487) * (-668.691) (-668.634) (-668.917) [-672.130] -- 0:00:59
119000 -- [-669.905] (-670.350) (-668.942) (-670.686) * (-670.212) [-667.825] (-668.453) (-671.866) -- 0:00:59
119500 -- (-671.807) (-676.706) [-675.187] (-671.746) * [-668.393] (-669.777) (-670.564) (-670.092) -- 0:00:58
120000 -- (-669.749) (-670.911) [-672.215] (-672.300) * (-669.889) (-668.383) (-670.575) [-673.622] -- 0:00:58
Average standard deviation of split frequencies: 0.017477
120500 -- [-671.365] (-669.716) (-671.501) (-671.675) * [-668.045] (-668.230) (-669.334) (-672.561) -- 0:00:58
121000 -- (-671.039) (-673.321) (-670.524) [-670.295] * (-668.301) (-671.746) (-671.935) [-671.845] -- 0:00:58
121500 -- [-671.688] (-671.478) (-670.217) (-671.085) * (-668.685) (-671.681) (-669.495) [-672.596] -- 0:00:57
122000 -- (-671.993) [-669.139] (-672.943) (-669.056) * (-670.598) (-669.166) [-670.171] (-670.107) -- 0:00:57
122500 -- [-674.135] (-670.285) (-671.770) (-671.114) * (-669.079) (-669.676) [-674.334] (-670.943) -- 0:00:57
123000 -- (-672.164) [-670.569] (-670.571) (-671.437) * (-670.394) (-674.723) (-671.193) [-669.692] -- 0:00:57
123500 -- (-668.845) (-673.141) (-671.500) [-668.226] * (-669.694) (-667.958) (-669.841) [-670.330] -- 0:00:56
124000 -- (-670.303) [-668.430] (-670.418) (-669.346) * (-671.784) (-670.231) (-670.638) [-668.185] -- 0:00:56
124500 -- (-672.709) [-668.813] (-671.741) (-670.129) * [-667.486] (-675.534) (-670.250) (-672.231) -- 0:00:56
125000 -- [-668.432] (-669.274) (-670.404) (-668.888) * (-673.068) (-667.970) [-671.853] (-669.521) -- 0:00:56
Average standard deviation of split frequencies: 0.017958
125500 -- (-669.548) [-668.629] (-672.763) (-669.487) * (-672.691) (-671.890) [-670.876] (-673.912) -- 0:00:55
126000 -- (-669.116) [-672.374] (-674.858) (-673.299) * (-672.579) (-674.542) (-670.888) [-672.041] -- 0:00:55
126500 -- (-671.064) [-669.812] (-671.623) (-669.371) * (-674.142) [-669.650] (-681.976) (-671.794) -- 0:00:55
127000 -- (-671.468) (-671.334) [-670.316] (-671.990) * (-669.694) (-668.896) (-672.523) [-671.378] -- 0:00:54
127500 -- [-668.772] (-669.749) (-671.911) (-670.721) * (-676.420) [-671.828] (-672.076) (-668.739) -- 0:01:01
128000 -- [-669.030] (-670.322) (-672.247) (-670.896) * (-672.727) (-671.076) [-674.512] (-669.588) -- 0:01:01
128500 -- (-671.331) [-669.403] (-675.918) (-672.903) * (-669.672) (-671.886) (-673.692) [-669.224] -- 0:01:01
129000 -- [-670.006] (-670.324) (-670.174) (-673.638) * (-671.706) [-669.122] (-672.838) (-672.313) -- 0:01:00
129500 -- (-667.687) [-668.402] (-671.378) (-671.487) * (-671.823) (-672.871) [-672.113] (-670.700) -- 0:01:00
130000 -- [-670.715] (-670.238) (-670.763) (-671.957) * (-672.747) (-676.339) (-671.723) [-667.747] -- 0:01:00
Average standard deviation of split frequencies: 0.017497
130500 -- (-672.428) (-671.655) (-670.173) [-671.376] * (-671.545) (-669.945) (-675.282) [-668.951] -- 0:00:59
131000 -- (-670.445) (-669.782) (-673.910) [-669.651] * [-671.930] (-668.581) (-671.871) (-671.727) -- 0:00:59
131500 -- (-668.165) (-672.433) (-673.648) [-668.948] * (-669.380) (-671.374) [-672.580] (-672.091) -- 0:00:59
132000 -- (-668.190) (-669.370) (-672.814) [-667.886] * (-671.841) [-671.473] (-672.950) (-675.009) -- 0:00:59
132500 -- (-668.470) (-670.061) (-671.498) [-671.667] * (-667.916) (-670.566) [-671.139] (-673.149) -- 0:00:58
133000 -- (-672.833) [-670.495] (-672.819) (-672.696) * (-671.142) (-670.736) [-672.070] (-672.062) -- 0:00:58
133500 -- (-671.032) [-671.169] (-673.762) (-673.897) * (-671.444) [-671.646] (-670.428) (-670.747) -- 0:00:58
134000 -- [-671.652] (-669.663) (-672.666) (-672.244) * (-670.291) (-669.999) (-669.788) [-670.615] -- 0:00:58
134500 -- (-671.153) (-671.273) (-670.843) [-674.172] * (-670.881) [-672.102] (-670.381) (-668.979) -- 0:00:57
135000 -- [-672.745] (-669.146) (-672.195) (-672.567) * (-669.400) (-670.267) (-671.024) [-668.168] -- 0:00:57
Average standard deviation of split frequencies: 0.016054
135500 -- [-671.655] (-669.561) (-673.763) (-672.677) * [-671.399] (-672.839) (-671.571) (-672.574) -- 0:00:57
136000 -- (-670.924) (-670.529) (-671.831) [-671.793] * (-671.876) (-673.422) [-673.389] (-669.738) -- 0:00:57
136500 -- (-672.568) (-670.430) (-672.472) [-669.216] * (-670.933) (-674.615) [-669.575] (-670.066) -- 0:00:56
137000 -- (-670.095) [-669.830] (-671.228) (-669.300) * (-672.777) (-673.715) [-669.641] (-670.910) -- 0:00:56
137500 -- (-673.953) (-672.349) (-674.362) [-671.786] * [-670.901] (-669.059) (-671.719) (-668.759) -- 0:00:56
138000 -- [-668.938] (-671.802) (-677.575) (-671.095) * [-671.711] (-672.439) (-669.838) (-670.663) -- 0:00:56
138500 -- (-673.555) [-669.406] (-674.702) (-670.686) * (-669.538) (-671.667) [-673.350] (-668.901) -- 0:00:55
139000 -- (-671.926) (-671.056) (-674.273) [-670.569] * [-672.559] (-670.464) (-673.346) (-669.679) -- 0:00:55
139500 -- (-672.052) (-671.913) (-677.838) [-672.511] * (-672.714) (-671.178) [-671.743] (-668.190) -- 0:00:55
140000 -- (-673.385) (-671.830) (-672.044) [-670.669] * (-671.818) (-667.516) [-668.415] (-669.335) -- 0:00:55
Average standard deviation of split frequencies: 0.018246
140500 -- (-671.951) [-670.706] (-669.987) (-670.653) * (-670.305) (-671.058) (-673.358) [-672.511] -- 0:00:55
141000 -- (-671.822) [-667.060] (-673.828) (-670.685) * (-674.353) (-670.746) [-672.998] (-672.693) -- 0:00:54
141500 -- (-669.819) (-670.432) (-671.166) [-671.273] * (-670.006) (-673.419) (-669.531) [-669.359] -- 0:00:54
142000 -- [-669.906] (-672.273) (-676.893) (-673.413) * (-670.845) (-669.188) [-670.472] (-672.326) -- 0:00:54
142500 -- [-668.892] (-672.396) (-670.901) (-675.006) * (-669.979) [-669.656] (-670.116) (-671.384) -- 0:00:54
143000 -- (-672.925) [-672.042] (-673.537) (-677.455) * (-673.869) [-668.022] (-668.375) (-668.635) -- 0:00:59
143500 -- [-670.927] (-669.902) (-675.505) (-673.904) * (-672.390) (-671.531) (-671.420) [-668.815] -- 0:00:59
144000 -- (-670.208) (-670.486) (-672.630) [-675.700] * [-668.027] (-668.441) (-670.046) (-670.147) -- 0:00:59
144500 -- (-670.659) [-670.665] (-670.574) (-671.428) * (-673.681) (-670.364) (-670.828) [-671.087] -- 0:00:59
145000 -- (-670.297) (-668.673) (-672.289) [-669.514] * [-672.249] (-671.562) (-667.348) (-674.769) -- 0:00:58
Average standard deviation of split frequencies: 0.017597
145500 -- (-668.292) (-670.481) (-669.821) [-669.472] * [-669.695] (-674.061) (-669.808) (-674.042) -- 0:00:58
146000 -- (-671.445) (-670.741) [-669.971] (-677.500) * (-674.282) (-675.213) [-671.904] (-668.608) -- 0:00:58
146500 -- [-671.880] (-669.967) (-669.170) (-671.922) * (-670.625) (-669.371) (-671.084) [-672.188] -- 0:00:58
147000 -- [-668.401] (-671.468) (-675.326) (-671.476) * (-670.910) [-671.053] (-670.901) (-671.603) -- 0:00:58
147500 -- (-669.147) [-671.144] (-671.940) (-668.817) * [-671.621] (-671.063) (-671.799) (-670.930) -- 0:00:57
148000 -- (-669.828) [-671.573] (-672.647) (-671.770) * (-670.644) (-671.557) [-668.530] (-671.090) -- 0:00:57
148500 -- [-668.918] (-676.539) (-670.509) (-672.648) * [-672.185] (-669.979) (-668.038) (-672.797) -- 0:00:57
149000 -- [-669.011] (-673.663) (-670.102) (-674.967) * (-670.681) (-668.951) [-667.611] (-673.832) -- 0:00:57
149500 -- (-668.935) (-672.819) [-668.412] (-670.750) * (-670.077) (-670.875) (-671.941) [-670.994] -- 0:00:56
150000 -- (-670.181) (-677.562) (-671.252) [-668.214] * [-668.744] (-672.737) (-670.192) (-671.015) -- 0:00:56
Average standard deviation of split frequencies: 0.015315
150500 -- (-671.560) (-678.254) [-671.913] (-675.054) * (-670.922) (-670.016) [-669.039] (-674.397) -- 0:00:56
151000 -- [-669.221] (-670.898) (-671.074) (-670.065) * [-672.208] (-671.540) (-668.624) (-672.783) -- 0:00:56
151500 -- [-669.188] (-669.702) (-672.910) (-669.071) * (-671.322) (-669.885) (-670.075) [-676.481] -- 0:00:56
152000 -- [-669.515] (-666.892) (-669.277) (-669.512) * [-672.868] (-669.852) (-670.582) (-669.507) -- 0:00:55
152500 -- [-669.600] (-671.365) (-671.015) (-670.836) * (-673.657) (-671.473) (-670.155) [-671.528] -- 0:00:55
153000 -- (-669.173) (-674.406) (-670.593) [-670.870] * (-669.395) [-669.101] (-671.523) (-671.223) -- 0:00:55
153500 -- (-669.127) (-668.905) [-668.278] (-668.807) * (-670.405) (-669.711) [-668.841] (-671.691) -- 0:00:55
154000 -- (-669.336) (-669.825) (-671.300) [-670.308] * [-674.704] (-670.455) (-670.284) (-669.145) -- 0:00:54
154500 -- [-668.627] (-674.318) (-669.273) (-671.304) * (-673.549) [-671.095] (-670.151) (-669.931) -- 0:00:54
155000 -- (-670.186) (-671.703) (-669.740) [-666.840] * (-674.796) (-671.356) (-670.309) [-673.239] -- 0:00:54
Average standard deviation of split frequencies: 0.015109
155500 -- [-668.034] (-672.911) (-671.822) (-668.824) * (-668.091) (-671.110) [-668.449] (-670.605) -- 0:00:54
156000 -- (-670.047) (-673.719) (-669.206) [-670.127] * (-670.239) (-670.835) [-669.418] (-670.889) -- 0:00:54
156500 -- (-673.793) [-672.310] (-670.070) (-667.304) * (-669.838) (-671.391) (-672.517) [-668.635] -- 0:00:53
157000 -- (-671.195) (-669.522) (-674.976) [-670.987] * [-668.839] (-672.124) (-673.298) (-668.760) -- 0:00:53
157500 -- (-674.285) [-668.773] (-674.458) (-669.474) * [-671.286] (-669.698) (-671.267) (-670.301) -- 0:00:53
158000 -- [-673.865] (-674.452) (-673.134) (-672.044) * [-667.870] (-671.264) (-671.282) (-669.474) -- 0:00:53
158500 -- (-675.215) [-673.202] (-670.341) (-670.509) * (-672.578) (-671.493) [-669.700] (-668.062) -- 0:00:58
159000 -- (-676.586) (-673.007) [-673.768] (-670.724) * (-671.530) (-669.204) [-672.136] (-670.945) -- 0:00:58
159500 -- (-675.755) [-671.722] (-671.018) (-671.262) * (-669.874) (-674.929) (-671.086) [-670.111] -- 0:00:57
160000 -- (-668.373) (-669.579) [-670.661] (-667.693) * [-671.985] (-670.538) (-671.697) (-671.319) -- 0:00:57
Average standard deviation of split frequencies: 0.017604
160500 -- [-669.546] (-671.450) (-669.805) (-670.922) * (-668.739) (-670.215) [-669.644] (-671.267) -- 0:00:57
161000 -- (-668.751) (-673.134) [-669.368] (-671.431) * [-673.565] (-671.574) (-674.677) (-671.094) -- 0:00:57
161500 -- (-672.779) (-670.767) [-672.958] (-671.492) * (-671.458) [-668.540] (-671.369) (-672.227) -- 0:00:57
162000 -- [-669.259] (-669.247) (-673.975) (-671.668) * [-671.078] (-669.512) (-668.558) (-670.236) -- 0:00:56
162500 -- [-668.667] (-670.797) (-676.791) (-669.853) * [-671.748] (-670.572) (-670.206) (-668.477) -- 0:00:56
163000 -- (-672.250) (-668.987) (-675.038) [-667.039] * (-671.861) [-670.075] (-668.402) (-671.689) -- 0:00:56
163500 -- (-671.075) (-670.614) (-677.601) [-668.646] * (-668.578) [-669.468] (-670.332) (-671.352) -- 0:00:56
164000 -- (-668.747) [-672.862] (-676.141) (-670.048) * (-669.915) (-671.168) [-670.552] (-672.401) -- 0:00:56
164500 -- (-668.352) (-669.630) (-677.442) [-670.421] * [-670.320] (-672.131) (-669.964) (-670.714) -- 0:00:55
165000 -- (-671.805) [-671.230] (-670.013) (-670.973) * (-669.040) [-669.266] (-672.478) (-670.309) -- 0:00:55
Average standard deviation of split frequencies: 0.017039
165500 -- (-671.113) (-676.395) [-669.474] (-669.612) * (-671.567) (-671.356) [-671.553] (-669.168) -- 0:00:55
166000 -- (-671.076) (-672.993) (-669.381) [-670.141] * (-672.638) (-671.654) (-670.266) [-672.544] -- 0:00:55
166500 -- (-671.508) (-672.311) [-670.321] (-668.985) * (-673.463) (-673.487) [-671.506] (-670.041) -- 0:00:55
167000 -- [-671.745] (-673.729) (-672.300) (-671.437) * (-669.280) (-675.666) [-669.443] (-672.616) -- 0:00:54
167500 -- (-672.549) [-671.847] (-672.467) (-671.116) * (-670.586) [-673.239] (-674.789) (-672.075) -- 0:00:54
168000 -- (-670.241) (-670.256) [-671.993] (-673.766) * (-670.693) [-671.693] (-670.750) (-668.489) -- 0:00:54
168500 -- (-671.407) (-669.801) (-671.096) [-670.563] * (-673.959) (-672.014) (-670.471) [-671.164] -- 0:00:54
169000 -- (-672.001) [-669.691] (-670.391) (-667.808) * (-670.999) (-673.948) [-668.408] (-672.725) -- 0:00:54
169500 -- (-668.799) (-670.122) (-671.463) [-667.925] * (-671.460) (-674.450) [-667.938] (-670.805) -- 0:00:53
170000 -- (-671.146) [-671.657] (-669.290) (-670.408) * [-672.818] (-670.180) (-668.819) (-669.490) -- 0:00:53
Average standard deviation of split frequencies: 0.016419
170500 -- (-671.229) [-671.414] (-671.456) (-673.016) * (-673.052) (-671.615) [-671.057] (-668.256) -- 0:00:53
171000 -- [-668.910] (-671.551) (-669.060) (-672.672) * (-671.697) (-669.389) (-674.513) [-671.814] -- 0:00:53
171500 -- (-669.113) (-674.996) [-668.964] (-669.042) * (-670.593) (-676.570) (-673.140) [-671.577] -- 0:00:53
172000 -- [-670.442] (-669.339) (-669.557) (-669.719) * (-667.808) [-674.757] (-672.206) (-669.172) -- 0:00:52
172500 -- (-666.805) (-671.407) (-671.662) [-667.512] * (-671.872) (-672.596) [-673.274] (-669.057) -- 0:00:52
173000 -- [-667.659] (-671.434) (-669.692) (-669.642) * (-670.724) (-670.836) [-670.730] (-669.437) -- 0:00:52
173500 -- (-670.645) (-672.851) [-669.056] (-669.526) * [-671.440] (-672.493) (-671.129) (-673.022) -- 0:00:52
174000 -- (-669.724) [-669.265] (-669.283) (-668.063) * (-670.982) (-673.708) (-671.530) [-669.500] -- 0:00:56
174500 -- (-669.339) (-671.549) [-667.466] (-668.598) * [-674.535] (-676.424) (-674.135) (-669.724) -- 0:00:56
175000 -- (-669.591) (-671.300) [-667.943] (-670.204) * (-671.510) (-671.785) [-668.392] (-671.722) -- 0:00:56
Average standard deviation of split frequencies: 0.017678
175500 -- (-674.518) (-670.750) [-667.478] (-669.232) * [-672.934] (-672.093) (-674.819) (-672.236) -- 0:00:56
176000 -- (-671.301) (-675.175) [-669.562] (-671.168) * (-672.137) (-669.535) [-671.508] (-669.992) -- 0:00:56
176500 -- (-670.794) [-672.191] (-669.481) (-679.737) * (-671.476) [-674.271] (-671.598) (-670.535) -- 0:00:55
177000 -- [-671.055] (-671.648) (-669.825) (-671.789) * (-670.735) (-672.067) (-671.025) [-670.851] -- 0:00:55
177500 -- [-669.378] (-672.497) (-669.749) (-671.430) * (-672.071) (-672.838) [-669.028] (-668.147) -- 0:00:55
178000 -- (-669.967) [-672.554] (-668.478) (-671.797) * (-672.265) (-672.239) (-671.251) [-671.258] -- 0:00:55
178500 -- (-668.129) [-670.324] (-669.503) (-672.400) * (-670.421) (-675.213) [-671.823] (-672.413) -- 0:00:55
179000 -- (-673.072) [-671.439] (-669.521) (-670.745) * (-676.475) (-673.435) [-671.651] (-674.040) -- 0:00:55
179500 -- [-671.882] (-669.729) (-669.983) (-672.912) * (-671.622) [-671.497] (-672.855) (-676.062) -- 0:00:54
180000 -- (-670.363) (-671.177) [-669.006] (-670.810) * (-674.483) (-673.053) [-671.329] (-672.404) -- 0:00:54
Average standard deviation of split frequencies: 0.016205
180500 -- (-667.736) (-669.820) (-670.689) [-668.634] * (-671.131) (-677.606) (-671.328) [-668.204] -- 0:00:54
181000 -- (-670.591) (-676.318) [-678.084] (-669.947) * (-671.748) (-671.240) [-669.239] (-667.830) -- 0:00:54
181500 -- [-667.952] (-671.999) (-677.226) (-669.667) * (-672.812) (-672.242) (-670.247) [-669.948] -- 0:00:54
182000 -- (-670.866) [-673.171] (-670.356) (-672.654) * (-671.254) [-672.533] (-670.042) (-668.391) -- 0:00:53
182500 -- (-670.790) (-676.232) [-672.268] (-673.283) * (-672.119) [-673.331] (-668.737) (-670.890) -- 0:00:53
183000 -- (-670.108) [-673.268] (-669.697) (-672.038) * (-671.688) [-670.660] (-669.538) (-669.540) -- 0:00:53
183500 -- (-669.230) [-671.777] (-671.969) (-670.241) * (-674.252) (-672.040) [-669.714] (-670.150) -- 0:00:53
184000 -- (-672.884) (-671.969) (-674.028) [-670.246] * (-670.649) (-670.879) (-670.378) [-669.397] -- 0:00:53
184500 -- (-673.275) [-672.164] (-671.842) (-669.596) * (-672.323) (-670.714) (-670.885) [-668.306] -- 0:00:53
185000 -- (-674.576) [-671.282] (-672.742) (-673.249) * (-670.775) (-673.621) [-670.083] (-668.503) -- 0:00:52
Average standard deviation of split frequencies: 0.013339
185500 -- (-669.620) (-671.417) [-669.235] (-672.463) * (-674.926) (-669.660) [-669.452] (-671.280) -- 0:00:52
186000 -- (-672.043) (-671.699) [-669.738] (-669.753) * (-676.330) (-670.963) [-670.340] (-671.669) -- 0:00:52
186500 -- (-670.874) [-671.101] (-670.910) (-670.396) * (-673.176) [-671.848] (-670.698) (-670.259) -- 0:00:52
187000 -- (-670.291) (-673.348) (-670.782) [-668.621] * (-673.296) (-670.756) [-670.800] (-670.493) -- 0:00:52
187500 -- [-668.005] (-672.203) (-672.309) (-673.498) * (-677.896) [-669.034] (-669.993) (-667.929) -- 0:00:52
188000 -- (-671.163) [-670.836] (-672.228) (-678.010) * (-672.487) [-670.127] (-670.496) (-672.314) -- 0:00:51
188500 -- (-673.391) (-671.281) [-670.098] (-677.596) * (-674.052) [-670.534] (-671.246) (-674.239) -- 0:00:51
189000 -- (-672.086) [-671.932] (-672.525) (-671.743) * (-673.764) [-671.134] (-672.989) (-667.902) -- 0:00:51
189500 -- (-672.838) (-671.195) (-670.109) [-672.485] * (-671.663) [-670.660] (-672.086) (-669.559) -- 0:00:55
190000 -- (-670.206) [-669.208] (-670.365) (-671.438) * [-669.402] (-669.118) (-669.446) (-672.110) -- 0:00:55
Average standard deviation of split frequencies: 0.014980
190500 -- (-671.221) [-668.213] (-672.065) (-673.311) * (-673.381) (-669.991) (-670.111) [-669.590] -- 0:00:55
191000 -- (-671.972) (-669.743) [-670.684] (-670.997) * (-670.980) [-674.458] (-669.811) (-671.984) -- 0:00:55
191500 -- (-671.098) (-677.452) (-674.130) [-670.852] * (-670.200) (-676.807) [-670.219] (-673.739) -- 0:00:54
192000 -- [-669.431] (-674.219) (-676.005) (-672.020) * (-667.952) (-675.855) (-671.455) [-672.074] -- 0:00:54
192500 -- [-670.473] (-671.009) (-671.880) (-671.746) * [-670.525] (-672.892) (-670.193) (-673.716) -- 0:00:54
193000 -- (-671.438) (-670.803) [-671.282] (-671.578) * [-669.846] (-671.122) (-674.249) (-670.601) -- 0:00:54
193500 -- [-672.269] (-671.616) (-673.084) (-672.797) * (-672.707) (-674.751) [-672.249] (-670.919) -- 0:00:54
194000 -- (-673.112) (-668.652) [-671.954] (-671.287) * (-670.011) (-673.931) (-672.020) [-670.562] -- 0:00:54
194500 -- (-672.353) (-672.641) [-669.508] (-672.906) * [-669.584] (-673.439) (-670.448) (-669.199) -- 0:00:53
195000 -- [-669.788] (-672.584) (-669.959) (-672.679) * (-673.410) [-670.000] (-670.959) (-671.064) -- 0:00:53
Average standard deviation of split frequencies: 0.013829
195500 -- [-669.260] (-673.730) (-670.540) (-675.203) * (-669.584) [-669.931] (-673.052) (-675.005) -- 0:00:53
196000 -- [-673.383] (-672.229) (-669.255) (-673.204) * [-672.092] (-668.221) (-669.781) (-670.371) -- 0:00:53
196500 -- (-681.201) [-668.317] (-670.876) (-671.256) * (-671.690) (-670.279) [-668.767] (-671.289) -- 0:00:53
197000 -- [-672.029] (-670.118) (-670.680) (-671.571) * [-673.293] (-668.525) (-672.848) (-675.430) -- 0:00:52
197500 -- (-671.836) (-669.913) [-672.632] (-671.319) * (-671.962) (-668.130) (-668.853) [-677.352] -- 0:00:52
198000 -- [-670.150] (-670.820) (-675.803) (-673.281) * [-669.008] (-670.767) (-672.470) (-670.279) -- 0:00:52
198500 -- (-672.533) [-671.342] (-672.369) (-672.970) * (-672.598) (-671.302) [-670.256] (-670.714) -- 0:00:52
199000 -- (-671.015) (-669.645) [-671.159] (-670.374) * (-671.526) [-670.161] (-671.206) (-668.707) -- 0:00:52
199500 -- (-670.424) (-670.547) (-671.735) [-673.174] * (-669.984) (-671.969) [-668.352] (-670.093) -- 0:00:52
200000 -- (-670.105) [-670.641] (-669.944) (-668.972) * [-667.806] (-668.016) (-670.362) (-670.909) -- 0:00:51
Average standard deviation of split frequencies: 0.013312
200500 -- (-672.166) (-669.769) (-670.592) [-668.373] * (-671.821) [-672.995] (-671.991) (-673.019) -- 0:00:51
201000 -- (-672.395) [-671.837] (-672.660) (-668.740) * (-673.880) [-667.957] (-669.010) (-670.146) -- 0:00:51
201500 -- (-672.591) (-670.877) [-670.381] (-672.631) * (-673.184) (-672.778) [-670.339] (-670.504) -- 0:00:51
202000 -- (-672.985) [-673.627] (-670.969) (-671.610) * (-673.781) [-668.111] (-677.849) (-671.226) -- 0:00:51
202500 -- [-668.835] (-673.493) (-671.317) (-669.848) * (-671.237) [-668.909] (-672.693) (-670.759) -- 0:00:51
203000 -- (-674.567) [-673.549] (-672.911) (-668.322) * (-669.213) (-672.719) (-673.345) [-669.734] -- 0:00:51
203500 -- (-672.803) [-669.525] (-672.960) (-668.626) * (-670.321) (-670.653) [-667.830] (-669.675) -- 0:00:50
204000 -- (-673.193) [-669.158] (-672.462) (-672.039) * (-670.386) (-671.128) [-669.499] (-671.418) -- 0:00:50
204500 -- [-670.404] (-671.939) (-676.496) (-671.193) * [-671.660] (-671.538) (-670.940) (-672.952) -- 0:00:50
205000 -- (-673.014) (-679.604) [-679.272] (-670.338) * [-670.847] (-668.652) (-669.695) (-672.876) -- 0:00:54
Average standard deviation of split frequencies: 0.013192
205500 -- (-671.696) (-674.291) (-672.575) [-670.546] * (-673.366) (-670.184) [-669.366] (-672.583) -- 0:00:54
206000 -- (-670.100) (-670.344) [-672.619] (-669.439) * (-676.787) [-667.908] (-670.146) (-670.903) -- 0:00:53
206500 -- (-672.167) (-671.673) [-673.257] (-671.762) * (-670.102) (-670.178) [-669.063] (-669.299) -- 0:00:53
207000 -- (-667.993) (-669.038) (-673.728) [-672.123] * (-670.055) (-671.708) [-669.469] (-669.535) -- 0:00:53
207500 -- [-669.292] (-668.215) (-671.047) (-671.189) * [-671.999] (-671.094) (-675.646) (-670.048) -- 0:00:53
208000 -- (-672.237) (-670.172) (-673.351) [-669.780] * [-670.920] (-674.515) (-668.412) (-673.416) -- 0:00:53
208500 -- (-671.512) (-668.492) [-669.672] (-670.281) * (-668.626) [-670.377] (-669.190) (-672.722) -- 0:00:53
209000 -- (-671.767) [-671.398] (-672.590) (-670.243) * (-670.770) [-669.271] (-668.819) (-670.416) -- 0:00:52
209500 -- [-668.972] (-671.505) (-669.477) (-668.518) * [-669.251] (-668.684) (-671.941) (-671.489) -- 0:00:52
210000 -- (-668.324) (-674.253) [-669.736] (-668.372) * (-672.843) (-667.787) (-668.258) [-672.178] -- 0:00:52
Average standard deviation of split frequencies: 0.013163
210500 -- (-672.278) (-670.049) [-670.359] (-672.633) * (-669.836) [-669.361] (-669.578) (-673.389) -- 0:00:52
211000 -- (-668.469) (-668.482) [-669.994] (-674.003) * (-668.955) (-674.242) (-667.268) [-672.431] -- 0:00:52
211500 -- (-668.814) (-672.335) (-672.661) [-669.363] * (-669.818) (-671.143) [-666.583] (-669.480) -- 0:00:52
212000 -- [-671.843] (-669.864) (-670.935) (-671.572) * (-670.763) (-670.375) (-668.496) [-668.078] -- 0:00:52
212500 -- (-670.771) (-671.450) [-670.190] (-674.781) * (-669.061) (-669.299) [-669.626] (-671.524) -- 0:00:51
213000 -- (-671.713) (-671.528) [-670.006] (-674.598) * (-672.252) [-670.913] (-672.054) (-681.547) -- 0:00:51
213500 -- (-669.616) (-671.955) [-668.562] (-677.513) * (-669.295) (-677.921) (-670.076) [-672.817] -- 0:00:51
214000 -- [-671.980] (-669.488) (-670.122) (-671.367) * (-669.603) (-681.078) (-669.774) [-671.818] -- 0:00:51
214500 -- [-671.416] (-672.757) (-670.856) (-671.418) * (-668.418) (-671.818) [-669.342] (-671.393) -- 0:00:51
215000 -- (-668.644) (-671.061) [-670.081] (-671.154) * (-670.899) (-672.680) [-670.604] (-670.381) -- 0:00:51
Average standard deviation of split frequencies: 0.013640
215500 -- [-671.123] (-671.935) (-670.710) (-669.699) * (-670.363) [-671.805] (-674.023) (-674.558) -- 0:00:50
216000 -- [-669.429] (-671.171) (-668.976) (-671.433) * (-669.999) [-672.642] (-673.229) (-670.345) -- 0:00:50
216500 -- (-670.029) (-670.423) [-669.592] (-673.836) * [-669.876] (-669.890) (-670.141) (-676.168) -- 0:00:50
217000 -- (-671.206) (-676.326) [-668.525] (-672.940) * (-669.918) (-672.008) [-668.702] (-678.832) -- 0:00:50
217500 -- [-670.564] (-672.023) (-670.322) (-671.989) * (-669.332) (-669.950) [-670.734] (-673.279) -- 0:00:50
218000 -- (-670.686) (-675.432) [-670.738] (-672.644) * (-669.047) [-671.869] (-670.833) (-672.407) -- 0:00:50
218500 -- [-671.124] (-669.018) (-671.572) (-672.150) * (-669.023) (-671.267) [-669.267] (-670.603) -- 0:00:50
219000 -- (-673.258) [-671.069] (-671.920) (-669.353) * [-669.530] (-669.916) (-672.249) (-669.786) -- 0:00:49
219500 -- [-672.598] (-674.995) (-670.892) (-671.711) * (-670.824) [-667.523] (-672.199) (-670.524) -- 0:00:49
220000 -- (-671.482) (-674.974) [-670.929] (-670.029) * [-671.687] (-670.905) (-670.803) (-669.365) -- 0:00:49
Average standard deviation of split frequencies: 0.013752
220500 -- [-670.139] (-673.014) (-673.366) (-669.983) * (-669.060) (-669.042) [-667.313] (-668.624) -- 0:00:53
221000 -- (-671.630) [-670.417] (-673.118) (-672.717) * (-668.457) (-668.073) [-668.713] (-668.034) -- 0:00:52
221500 -- [-670.407] (-669.989) (-674.240) (-671.683) * (-675.185) [-670.044] (-669.981) (-669.575) -- 0:00:52
222000 -- (-672.204) (-669.040) (-669.365) [-673.929] * (-673.479) (-669.182) (-669.591) [-671.260] -- 0:00:52
222500 -- [-674.274] (-673.243) (-674.094) (-671.015) * [-668.213] (-668.894) (-669.829) (-668.577) -- 0:00:52
223000 -- [-672.758] (-672.931) (-673.855) (-670.060) * (-668.577) (-670.224) [-668.512] (-668.415) -- 0:00:52
223500 -- (-671.908) (-673.964) (-671.092) [-670.631] * [-674.032] (-672.538) (-669.019) (-669.106) -- 0:00:52
224000 -- [-669.158] (-674.905) (-670.543) (-669.779) * [-670.067] (-672.933) (-669.414) (-672.475) -- 0:00:51
224500 -- [-673.233] (-673.192) (-670.781) (-670.466) * (-672.108) (-671.542) (-668.989) [-668.782] -- 0:00:51
225000 -- (-670.668) [-670.966] (-670.329) (-672.685) * [-670.166] (-668.735) (-669.682) (-670.327) -- 0:00:51
Average standard deviation of split frequencies: 0.012515
225500 -- (-674.511) [-672.368] (-671.464) (-671.607) * (-677.031) (-668.522) [-667.922] (-672.791) -- 0:00:51
226000 -- [-669.927] (-671.247) (-672.041) (-672.672) * (-668.196) (-668.771) [-671.058] (-669.655) -- 0:00:51
226500 -- (-669.395) [-669.841] (-671.613) (-672.259) * [-667.192] (-670.569) (-668.573) (-671.557) -- 0:00:51
227000 -- (-670.724) [-667.449] (-677.474) (-672.372) * [-669.229] (-669.524) (-672.116) (-672.943) -- 0:00:51
227500 -- (-671.431) (-669.590) (-670.634) [-670.627] * (-670.352) [-669.928] (-670.851) (-670.048) -- 0:00:50
228000 -- (-670.382) [-672.355] (-670.437) (-671.111) * (-673.488) (-669.858) (-672.131) [-668.863] -- 0:00:50
228500 -- (-671.469) [-668.242] (-671.638) (-671.793) * (-673.330) (-670.125) [-668.133] (-669.138) -- 0:00:50
229000 -- [-670.109] (-670.160) (-671.876) (-671.937) * (-667.113) (-671.552) (-671.226) [-669.244] -- 0:00:50
229500 -- [-670.172] (-669.278) (-674.057) (-670.981) * [-668.516] (-668.705) (-667.547) (-667.924) -- 0:00:50
230000 -- [-670.032] (-670.075) (-672.571) (-671.185) * (-667.638) [-668.206] (-669.437) (-668.412) -- 0:00:50
Average standard deviation of split frequencies: 0.012382
230500 -- (-668.968) (-673.779) (-667.639) [-668.874] * (-668.818) (-668.738) [-667.694] (-670.370) -- 0:00:50
231000 -- [-672.493] (-671.852) (-670.854) (-669.188) * (-670.380) (-671.170) [-669.088] (-669.829) -- 0:00:49
231500 -- (-669.289) (-670.859) (-671.036) [-667.719] * [-668.596] (-669.926) (-669.705) (-670.383) -- 0:00:49
232000 -- (-671.967) (-672.494) [-668.514] (-670.405) * (-669.532) [-670.941] (-671.629) (-669.538) -- 0:00:49
232500 -- (-671.667) (-670.650) [-669.009] (-669.411) * [-670.305] (-668.449) (-671.702) (-670.811) -- 0:00:49
233000 -- (-671.496) (-671.922) (-669.530) [-671.520] * (-668.981) (-669.115) (-670.245) [-670.903] -- 0:00:49
233500 -- [-669.726] (-672.985) (-668.456) (-677.491) * (-667.850) [-671.835] (-670.339) (-673.794) -- 0:00:49
234000 -- (-670.360) (-677.756) (-669.422) [-670.204] * (-676.223) (-672.109) (-669.651) [-668.385] -- 0:00:49
234500 -- [-670.355] (-670.631) (-671.736) (-674.696) * (-669.366) (-668.943) [-667.710] (-669.255) -- 0:00:48
235000 -- [-669.824] (-672.124) (-675.017) (-670.121) * (-672.770) (-670.504) [-668.724] (-670.557) -- 0:00:48
Average standard deviation of split frequencies: 0.011515
235500 -- (-670.929) [-674.369] (-673.148) (-675.611) * (-669.865) (-672.538) [-670.069] (-669.072) -- 0:00:51
236000 -- (-669.584) [-671.257] (-673.771) (-669.837) * [-666.697] (-670.880) (-673.314) (-668.807) -- 0:00:51
236500 -- (-671.116) (-672.645) [-668.196] (-667.522) * (-670.225) [-671.045] (-671.425) (-668.243) -- 0:00:51
237000 -- (-669.901) (-673.521) (-671.881) [-669.685] * (-671.328) [-670.836] (-671.262) (-671.131) -- 0:00:51
237500 -- [-669.215] (-672.306) (-670.558) (-671.706) * (-671.129) [-671.440] (-673.019) (-668.875) -- 0:00:51
238000 -- (-672.617) (-669.637) (-672.154) [-670.064] * [-669.742] (-670.564) (-673.482) (-670.412) -- 0:00:51
238500 -- (-670.185) [-671.240] (-670.028) (-670.904) * (-669.667) (-674.403) (-674.321) [-668.464] -- 0:00:51
239000 -- (-674.060) [-670.451] (-670.121) (-670.218) * (-668.376) (-672.873) [-668.932] (-668.956) -- 0:00:50
239500 -- (-675.357) [-671.883] (-670.751) (-668.700) * (-672.089) [-671.282] (-677.603) (-672.197) -- 0:00:50
240000 -- (-673.172) (-668.787) [-671.711] (-670.085) * (-674.691) (-671.838) (-679.386) [-670.590] -- 0:00:50
Average standard deviation of split frequencies: 0.011983
240500 -- (-671.671) (-670.238) [-670.460] (-669.894) * (-673.936) (-670.687) (-669.483) [-671.973] -- 0:00:50
241000 -- (-673.174) (-669.906) [-669.207] (-671.580) * [-669.997] (-671.285) (-668.878) (-670.454) -- 0:00:50
241500 -- (-670.432) [-668.581] (-670.569) (-669.756) * [-667.498] (-672.100) (-669.846) (-670.149) -- 0:00:50
242000 -- [-671.910] (-671.981) (-669.608) (-670.130) * [-670.133] (-672.356) (-669.735) (-671.304) -- 0:00:50
242500 -- (-673.370) [-668.953] (-671.188) (-668.811) * (-672.374) (-672.229) (-667.560) [-669.055] -- 0:00:49
243000 -- (-670.353) [-669.694] (-670.065) (-670.457) * [-670.929] (-672.624) (-670.756) (-668.889) -- 0:00:49
243500 -- (-671.018) [-667.504] (-671.134) (-674.352) * (-673.952) [-670.672] (-670.254) (-668.819) -- 0:00:49
244000 -- (-672.357) [-668.893] (-671.563) (-674.892) * [-671.521] (-671.406) (-668.486) (-667.432) -- 0:00:49
244500 -- [-671.872] (-668.626) (-671.241) (-673.520) * (-669.675) (-675.711) [-667.752] (-669.050) -- 0:00:49
245000 -- (-671.376) [-670.912] (-670.028) (-671.132) * (-669.977) (-670.793) (-667.605) [-668.848] -- 0:00:49
Average standard deviation of split frequencies: 0.010709
245500 -- [-669.806] (-670.339) (-668.602) (-672.382) * [-667.722] (-673.420) (-667.816) (-668.727) -- 0:00:49
246000 -- (-669.888) (-671.801) [-673.486] (-670.945) * [-668.867] (-674.226) (-666.687) (-671.087) -- 0:00:49
246500 -- (-671.691) [-670.951] (-673.949) (-671.200) * (-672.635) (-673.806) [-668.276] (-668.701) -- 0:00:48
247000 -- (-672.781) [-670.990] (-674.225) (-675.035) * (-671.507) [-669.919] (-668.307) (-673.523) -- 0:00:48
247500 -- (-671.736) (-668.288) (-672.403) [-670.386] * [-671.146] (-672.519) (-670.303) (-677.066) -- 0:00:48
248000 -- (-673.462) (-668.328) [-672.107] (-673.338) * (-669.684) (-673.340) [-667.478] (-672.685) -- 0:00:48
248500 -- (-671.725) (-667.294) [-670.148] (-672.473) * (-669.733) (-672.693) [-669.242] (-671.313) -- 0:00:48
249000 -- (-671.167) (-670.101) (-672.956) [-667.692] * (-670.842) (-669.932) (-675.210) [-668.376] -- 0:00:48
249500 -- (-669.413) (-670.578) [-673.631] (-671.575) * (-670.279) (-668.382) [-667.955] (-669.400) -- 0:00:48
250000 -- (-673.139) [-669.546] (-671.860) (-672.392) * (-671.224) (-673.010) (-669.688) [-668.601] -- 0:00:48
Average standard deviation of split frequencies: 0.010761
250500 -- (-668.930) [-668.836] (-672.553) (-672.543) * (-675.775) (-672.068) (-669.529) [-670.791] -- 0:00:47
251000 -- (-667.719) (-667.831) (-671.998) [-669.666] * (-672.111) (-671.999) (-672.914) [-668.515] -- 0:00:50
251500 -- (-669.948) [-668.113] (-670.351) (-675.320) * (-672.395) (-671.407) (-673.889) [-671.397] -- 0:00:50
252000 -- (-673.094) [-670.198] (-670.841) (-672.173) * (-671.711) (-668.476) [-668.028] (-671.131) -- 0:00:50
252500 -- (-673.052) (-670.128) (-672.656) [-672.490] * (-671.103) (-672.242) (-667.387) [-668.942] -- 0:00:50
253000 -- (-669.484) (-668.765) (-675.418) [-672.467] * (-670.895) (-672.034) [-668.205] (-670.923) -- 0:00:50
253500 -- (-674.432) [-668.501] (-673.357) (-674.708) * (-669.313) [-671.027] (-670.736) (-669.399) -- 0:00:50
254000 -- (-669.523) [-673.323] (-671.829) (-673.864) * (-670.538) (-669.765) (-672.456) [-669.947] -- 0:00:49
254500 -- (-671.015) [-668.047] (-671.765) (-674.604) * (-668.915) (-672.896) (-672.720) [-668.488] -- 0:00:49
255000 -- (-671.280) (-670.657) [-672.915] (-671.330) * (-671.350) (-672.053) [-671.613] (-672.826) -- 0:00:49
Average standard deviation of split frequencies: 0.011049
255500 -- [-669.014] (-670.167) (-672.455) (-671.726) * (-670.844) [-667.894] (-671.658) (-673.725) -- 0:00:49
256000 -- [-669.921] (-674.307) (-673.024) (-670.591) * (-669.670) [-671.431] (-670.217) (-677.191) -- 0:00:49
256500 -- (-668.357) (-670.469) [-670.721] (-669.712) * (-674.623) (-667.586) (-669.356) [-668.698] -- 0:00:49
257000 -- [-668.672] (-669.101) (-671.791) (-668.968) * (-669.553) (-671.873) [-669.170] (-672.235) -- 0:00:49
257500 -- (-671.101) (-667.895) [-672.665] (-674.698) * (-672.500) (-673.326) (-669.821) [-670.613] -- 0:00:49
258000 -- (-670.194) (-668.273) [-670.029] (-671.686) * [-672.801] (-670.218) (-669.160) (-670.637) -- 0:00:48
258500 -- [-671.045] (-668.539) (-674.595) (-668.375) * [-672.092] (-669.931) (-672.957) (-669.073) -- 0:00:48
259000 -- [-670.598] (-669.787) (-671.684) (-671.490) * (-670.596) (-669.565) (-672.144) [-670.970] -- 0:00:48
259500 -- (-677.146) (-668.499) [-671.568] (-669.170) * (-669.785) (-673.209) (-670.727) [-668.232] -- 0:00:48
260000 -- (-674.410) (-669.047) (-671.341) [-670.642] * (-671.183) (-671.959) (-675.007) [-670.402] -- 0:00:48
Average standard deviation of split frequencies: 0.011064
260500 -- (-674.648) (-670.365) [-669.245] (-673.065) * (-669.050) (-668.717) (-671.158) [-672.136] -- 0:00:48
261000 -- (-669.865) (-670.388) (-671.342) [-669.810] * (-669.216) [-670.227] (-679.831) (-672.956) -- 0:00:48
261500 -- (-669.662) (-671.117) (-671.430) [-668.401] * (-668.738) (-668.405) [-676.702] (-669.805) -- 0:00:48
262000 -- (-670.454) (-670.428) (-674.564) [-671.649] * (-673.020) (-670.535) [-669.370] (-674.814) -- 0:00:47
262500 -- [-670.411] (-668.504) (-668.788) (-673.715) * [-674.251] (-671.852) (-669.916) (-673.010) -- 0:00:47
263000 -- [-673.635] (-667.092) (-673.176) (-674.757) * (-676.324) (-673.622) [-670.849] (-672.706) -- 0:00:47
263500 -- (-670.456) [-670.846] (-669.388) (-671.894) * (-668.207) [-670.633] (-670.497) (-671.442) -- 0:00:47
264000 -- (-670.700) (-671.243) (-671.231) [-668.707] * (-670.945) (-668.687) [-669.206] (-671.573) -- 0:00:47
264500 -- (-667.859) (-667.759) [-672.223] (-671.813) * (-670.384) (-675.081) [-671.816] (-670.295) -- 0:00:47
265000 -- (-674.240) [-668.273] (-671.275) (-670.328) * (-670.723) (-675.992) [-669.443] (-673.341) -- 0:00:47
Average standard deviation of split frequencies: 0.011676
265500 -- (-670.247) [-667.826] (-675.964) (-669.631) * (-669.142) (-672.160) (-669.471) [-670.316] -- 0:00:47
266000 -- (-667.017) (-668.983) (-672.354) [-669.506] * (-668.152) (-668.809) (-678.934) [-670.466] -- 0:00:46
266500 -- [-668.532] (-669.230) (-669.827) (-671.870) * [-670.758] (-669.993) (-676.508) (-670.281) -- 0:00:49
267000 -- (-671.494) (-669.814) (-674.324) [-671.447] * (-670.410) (-668.147) [-675.485] (-669.579) -- 0:00:49
267500 -- (-673.847) (-671.517) [-669.791] (-668.559) * (-670.738) (-671.018) [-668.299] (-672.375) -- 0:00:49
268000 -- [-671.822] (-669.413) (-670.413) (-670.094) * (-672.860) (-672.476) [-670.589] (-672.543) -- 0:00:49
268500 -- [-670.905] (-671.399) (-668.341) (-668.594) * [-672.029] (-673.416) (-670.507) (-672.031) -- 0:00:49
269000 -- (-668.352) (-676.616) (-670.203) [-668.834] * [-672.291] (-674.077) (-668.659) (-672.952) -- 0:00:48
269500 -- [-666.693] (-675.944) (-672.403) (-673.467) * (-671.916) (-669.676) (-672.395) [-667.654] -- 0:00:48
270000 -- (-672.379) (-667.132) (-670.744) [-669.513] * (-668.479) (-670.138) (-674.797) [-669.915] -- 0:00:48
Average standard deviation of split frequencies: 0.011224
270500 -- (-672.417) (-666.803) (-673.170) [-670.038] * (-675.397) (-670.066) (-668.803) [-667.951] -- 0:00:48
271000 -- (-668.584) [-670.171] (-670.735) (-670.387) * (-672.809) (-671.091) [-672.166] (-672.300) -- 0:00:48
271500 -- [-667.720] (-668.474) (-670.076) (-669.709) * (-678.637) [-668.562] (-672.448) (-672.221) -- 0:00:48
272000 -- (-671.389) (-670.379) (-670.722) [-667.746] * (-670.961) [-670.640] (-670.410) (-671.369) -- 0:00:48
272500 -- (-668.130) (-668.978) [-675.899] (-672.077) * (-672.858) [-668.942] (-671.086) (-672.956) -- 0:00:48
273000 -- [-669.040] (-666.511) (-670.811) (-669.468) * (-669.649) (-669.868) [-671.588] (-670.806) -- 0:00:47
273500 -- [-669.869] (-670.058) (-671.918) (-672.052) * (-669.811) (-668.513) (-671.462) [-677.119] -- 0:00:47
274000 -- (-671.198) [-671.881] (-670.665) (-667.404) * (-671.202) (-670.802) (-672.688) [-674.028] -- 0:00:47
274500 -- [-667.681] (-670.931) (-669.396) (-669.825) * (-671.526) (-676.618) [-670.460] (-670.363) -- 0:00:47
275000 -- (-669.567) [-671.637] (-671.501) (-671.087) * (-670.363) (-680.583) (-673.249) [-671.117] -- 0:00:47
Average standard deviation of split frequencies: 0.011102
275500 -- (-669.769) [-668.882] (-669.339) (-671.065) * (-670.935) [-674.126] (-670.191) (-672.684) -- 0:00:47
276000 -- (-668.471) (-671.016) (-672.911) [-670.365] * (-673.590) (-673.316) [-669.317] (-669.865) -- 0:00:47
276500 -- [-668.243] (-668.066) (-672.670) (-674.830) * (-673.061) [-672.549] (-672.631) (-672.946) -- 0:00:47
277000 -- (-670.060) (-670.199) (-671.699) [-670.280] * [-678.022] (-669.316) (-672.457) (-674.023) -- 0:00:46
277500 -- (-668.751) (-670.830) (-671.290) [-670.305] * (-675.104) [-670.898] (-676.384) (-674.122) -- 0:00:46
278000 -- (-671.095) (-671.969) [-669.763] (-668.778) * (-671.329) [-668.315] (-667.862) (-672.147) -- 0:00:46
278500 -- [-670.739] (-669.097) (-672.358) (-669.262) * (-671.951) (-672.794) [-669.897] (-672.342) -- 0:00:46
279000 -- (-668.612) (-668.591) (-670.635) [-669.150] * (-669.762) [-671.640] (-674.045) (-674.544) -- 0:00:46
279500 -- [-668.473] (-669.135) (-672.709) (-672.883) * (-670.596) (-674.099) [-671.356] (-675.252) -- 0:00:46
280000 -- (-670.683) (-671.429) (-672.069) [-674.067] * (-675.767) [-671.427] (-671.682) (-671.885) -- 0:00:46
Average standard deviation of split frequencies: 0.010078
280500 -- [-668.343] (-670.576) (-672.542) (-677.593) * (-671.069) [-672.702] (-671.105) (-669.826) -- 0:00:46
281000 -- (-670.291) (-671.683) (-669.956) [-671.087] * (-670.310) (-673.297) [-670.827] (-672.455) -- 0:00:46
281500 -- [-667.674] (-671.659) (-670.369) (-672.546) * [-667.221] (-670.477) (-670.276) (-668.794) -- 0:00:45
282000 -- [-670.552] (-668.766) (-670.790) (-675.086) * (-669.506) (-676.011) [-668.848] (-670.172) -- 0:00:45
282500 -- (-671.985) (-672.115) (-668.622) [-672.386] * [-671.248] (-671.472) (-669.133) (-673.150) -- 0:00:48
283000 -- (-673.420) (-670.294) [-668.600] (-671.070) * (-671.002) (-672.389) (-669.069) [-671.592] -- 0:00:48
283500 -- (-670.585) [-671.835] (-670.459) (-671.503) * (-670.463) [-671.398] (-673.911) (-674.064) -- 0:00:48
284000 -- (-668.967) (-668.419) (-670.690) [-671.488] * [-669.556] (-669.992) (-672.401) (-674.295) -- 0:00:47
284500 -- (-670.293) (-669.666) [-671.854] (-669.352) * (-671.216) (-670.625) (-670.564) [-670.617] -- 0:00:47
285000 -- (-673.548) (-670.590) [-673.153] (-670.086) * (-671.182) (-673.237) (-670.962) [-670.715] -- 0:00:47
Average standard deviation of split frequencies: 0.010665
285500 -- [-671.091] (-669.852) (-669.451) (-672.748) * (-671.326) (-671.769) [-671.122] (-670.038) -- 0:00:47
286000 -- [-669.349] (-673.268) (-668.424) (-670.396) * (-672.809) (-671.085) (-669.975) [-671.202] -- 0:00:47
286500 -- (-667.389) [-668.585] (-671.295) (-669.957) * (-672.839) (-673.172) [-670.508] (-674.433) -- 0:00:47
287000 -- (-672.727) (-669.250) (-669.417) [-671.338] * [-670.661] (-674.684) (-671.867) (-671.714) -- 0:00:47
287500 -- (-667.747) [-670.129] (-669.422) (-670.763) * (-670.877) (-671.859) (-669.064) [-669.700] -- 0:00:47
288000 -- (-668.063) [-669.513] (-669.023) (-669.914) * (-670.508) (-671.446) (-670.813) [-670.328] -- 0:00:46
288500 -- (-672.256) (-671.132) (-670.643) [-674.940] * (-672.320) (-673.723) (-673.925) [-670.476] -- 0:00:46
289000 -- (-671.214) [-670.768] (-669.119) (-671.514) * (-670.929) (-674.283) (-673.636) [-672.112] -- 0:00:46
289500 -- [-672.308] (-672.743) (-671.798) (-670.588) * (-671.377) [-672.716] (-671.818) (-673.131) -- 0:00:46
290000 -- (-675.614) [-670.497] (-671.222) (-670.018) * (-674.246) [-670.383] (-672.146) (-671.240) -- 0:00:46
Average standard deviation of split frequencies: 0.008968
290500 -- (-672.154) (-669.465) [-669.413] (-668.551) * (-673.735) (-674.048) (-673.661) [-670.017] -- 0:00:46
291000 -- [-670.075] (-670.040) (-669.863) (-677.031) * (-671.405) [-671.061] (-672.504) (-672.019) -- 0:00:46
291500 -- [-670.639] (-671.846) (-672.092) (-674.933) * [-671.220] (-673.293) (-671.652) (-670.532) -- 0:00:46
292000 -- (-670.570) [-670.162] (-670.863) (-671.069) * (-671.435) [-673.346] (-671.013) (-672.196) -- 0:00:46
292500 -- (-670.519) (-667.670) [-669.721] (-672.487) * (-673.283) (-672.421) [-669.359] (-671.511) -- 0:00:45
293000 -- (-669.123) (-671.944) [-669.232] (-671.363) * (-672.057) (-672.606) (-669.684) [-674.227] -- 0:00:45
293500 -- [-669.649] (-671.413) (-667.205) (-671.318) * (-669.581) (-672.658) [-672.091] (-676.591) -- 0:00:45
294000 -- (-670.927) [-669.072] (-671.216) (-670.549) * (-672.712) (-671.155) [-671.509] (-672.656) -- 0:00:45
294500 -- (-669.854) (-673.740) (-673.475) [-671.858] * [-671.827] (-672.542) (-673.412) (-671.055) -- 0:00:45
295000 -- (-671.935) [-672.738] (-670.720) (-672.495) * (-670.838) [-673.637] (-670.671) (-669.262) -- 0:00:45
Average standard deviation of split frequencies: 0.009257
295500 -- (-672.041) (-673.200) (-670.904) [-671.968] * [-673.051] (-671.938) (-671.586) (-670.470) -- 0:00:45
296000 -- (-673.780) (-669.049) (-672.575) [-670.726] * (-672.740) (-672.440) [-669.673] (-670.882) -- 0:00:45
296500 -- (-672.450) (-672.781) (-670.685) [-668.212] * [-671.037] (-671.828) (-674.864) (-672.112) -- 0:00:45
297000 -- (-669.615) (-671.054) [-667.989] (-670.259) * [-671.861] (-672.428) (-669.993) (-669.642) -- 0:00:44
297500 -- [-670.537] (-671.025) (-670.953) (-672.365) * [-675.218] (-672.774) (-669.104) (-673.913) -- 0:00:44
298000 -- (-671.011) (-670.888) [-671.163] (-669.554) * (-671.403) [-671.357] (-672.481) (-673.606) -- 0:00:47
298500 -- (-669.005) (-672.052) [-669.816] (-671.459) * (-672.582) (-671.887) (-676.175) [-670.544] -- 0:00:47
299000 -- (-668.811) (-676.402) [-671.146] (-673.954) * (-670.520) (-672.258) (-672.864) [-670.567] -- 0:00:46
299500 -- (-670.669) [-670.950] (-669.361) (-674.374) * (-671.017) (-675.389) [-673.014] (-675.589) -- 0:00:46
300000 -- (-671.000) [-672.024] (-671.158) (-671.557) * (-673.687) (-674.170) [-672.007] (-674.567) -- 0:00:46
Average standard deviation of split frequencies: 0.009799
300500 -- (-673.609) [-668.387] (-669.672) (-669.662) * (-673.294) (-670.439) (-674.690) [-671.676] -- 0:00:46
301000 -- [-669.135] (-672.154) (-671.219) (-675.136) * (-671.926) (-672.970) (-672.116) [-670.871] -- 0:00:46
301500 -- [-671.071] (-673.745) (-670.884) (-670.768) * (-674.189) (-669.317) (-671.556) [-669.187] -- 0:00:46
302000 -- [-672.011] (-667.264) (-669.557) (-671.830) * [-671.844] (-671.760) (-672.267) (-670.589) -- 0:00:46
302500 -- (-670.998) [-667.850] (-669.226) (-670.113) * (-672.640) [-675.392] (-674.859) (-671.883) -- 0:00:46
303000 -- (-671.443) (-670.564) [-670.278] (-671.788) * [-670.085] (-676.727) (-674.723) (-671.415) -- 0:00:46
303500 -- [-670.504] (-668.762) (-668.946) (-671.354) * (-671.291) (-671.678) [-670.625] (-672.578) -- 0:00:45
304000 -- [-672.502] (-671.061) (-670.961) (-673.181) * [-671.757] (-670.414) (-669.673) (-674.538) -- 0:00:45
304500 -- (-674.037) [-667.624] (-671.742) (-672.048) * [-671.496] (-670.310) (-674.572) (-672.787) -- 0:00:45
305000 -- [-670.094] (-670.772) (-669.257) (-672.736) * (-670.137) (-673.015) [-670.612] (-673.240) -- 0:00:45
Average standard deviation of split frequencies: 0.010698
305500 -- (-669.965) (-672.891) (-669.304) [-671.589] * [-670.652] (-671.103) (-669.177) (-675.072) -- 0:00:45
306000 -- (-670.106) (-669.987) (-670.973) [-667.630] * (-672.731) (-672.859) (-672.466) [-669.645] -- 0:00:45
306500 -- (-666.602) (-669.876) [-671.467] (-669.420) * [-674.867] (-673.054) (-670.723) (-671.880) -- 0:00:45
307000 -- (-667.568) (-671.279) [-671.733] (-668.351) * (-674.672) (-672.222) [-671.944] (-670.093) -- 0:00:45
307500 -- (-668.907) (-672.386) [-668.705] (-670.055) * (-673.085) [-671.818] (-671.548) (-672.756) -- 0:00:45
308000 -- [-667.810] (-670.163) (-671.567) (-669.282) * (-670.536) (-670.348) (-670.723) [-670.752] -- 0:00:44
308500 -- [-671.556] (-669.732) (-669.387) (-669.881) * (-671.881) (-675.778) (-670.514) [-671.794] -- 0:00:44
309000 -- (-670.758) [-668.804] (-670.346) (-671.721) * [-671.017] (-670.395) (-673.933) (-672.957) -- 0:00:44
309500 -- (-670.501) [-670.692] (-672.728) (-670.188) * (-669.514) [-671.667] (-673.249) (-670.019) -- 0:00:44
310000 -- (-671.011) (-672.156) (-670.441) [-669.482] * [-670.105] (-672.703) (-671.434) (-669.281) -- 0:00:44
Average standard deviation of split frequencies: 0.010200
310500 -- (-668.727) (-669.092) [-667.555] (-672.673) * (-673.086) (-674.256) [-668.582] (-671.373) -- 0:00:44
311000 -- (-669.099) (-671.427) [-667.544] (-671.467) * (-671.118) (-673.621) (-670.348) [-668.766] -- 0:00:44
311500 -- (-671.545) (-669.678) [-676.302] (-671.186) * (-670.073) (-670.449) [-670.220] (-671.625) -- 0:00:44
312000 -- (-669.215) [-672.541] (-674.047) (-672.981) * (-669.550) (-673.160) [-671.719] (-672.294) -- 0:00:44
312500 -- [-670.538] (-670.734) (-671.266) (-680.488) * (-669.264) [-671.126] (-670.872) (-668.415) -- 0:00:44
313000 -- (-673.636) [-672.214] (-669.785) (-674.115) * (-669.750) (-673.007) (-674.134) [-667.310] -- 0:00:43
313500 -- (-672.321) (-670.565) (-669.601) [-671.190] * [-669.906] (-673.385) (-673.861) (-667.815) -- 0:00:45
314000 -- (-673.873) (-668.981) [-671.738] (-672.385) * (-669.080) (-671.064) [-669.126] (-668.492) -- 0:00:45
314500 -- (-668.976) (-668.636) [-672.592] (-674.679) * (-671.274) (-669.471) [-668.183] (-674.005) -- 0:00:45
315000 -- (-670.905) (-672.577) (-669.813) [-676.309] * (-668.444) [-670.284] (-668.027) (-678.067) -- 0:00:45
Average standard deviation of split frequencies: 0.011496
315500 -- (-672.344) (-669.853) (-672.638) [-668.618] * (-668.914) [-669.918] (-670.098) (-670.695) -- 0:00:45
316000 -- (-678.169) [-670.936] (-668.333) (-670.872) * (-670.672) (-669.212) (-670.278) [-669.029] -- 0:00:45
316500 -- (-673.874) (-672.263) [-670.754] (-671.913) * (-671.937) [-668.039] (-671.169) (-670.730) -- 0:00:45
317000 -- (-672.270) (-672.400) (-670.863) [-671.963] * (-671.243) (-669.849) [-669.407] (-670.666) -- 0:00:45
317500 -- (-670.457) (-673.315) [-670.725] (-671.744) * [-668.917] (-669.860) (-671.025) (-670.934) -- 0:00:45
318000 -- (-672.531) (-672.970) (-672.045) [-670.064] * [-668.682] (-669.751) (-676.781) (-669.465) -- 0:00:45
318500 -- (-671.781) [-671.621] (-671.779) (-669.928) * (-677.412) [-672.159] (-677.453) (-668.897) -- 0:00:44
319000 -- (-671.080) (-670.217) (-669.858) [-670.616] * (-671.053) (-674.492) (-674.525) [-667.805] -- 0:00:44
319500 -- (-670.352) (-670.865) [-668.709] (-670.614) * [-670.102] (-674.264) (-672.979) (-671.260) -- 0:00:44
320000 -- (-673.019) [-670.886] (-668.524) (-671.958) * [-670.440] (-670.977) (-670.471) (-671.252) -- 0:00:44
Average standard deviation of split frequencies: 0.010377
320500 -- [-671.065] (-671.056) (-669.785) (-672.801) * (-679.624) (-672.788) [-670.266] (-669.284) -- 0:00:44
321000 -- (-672.457) (-669.724) (-668.769) [-669.787] * (-674.947) (-671.763) [-669.813] (-673.357) -- 0:00:44
321500 -- (-671.638) (-670.835) (-669.337) [-673.465] * (-671.175) [-670.134] (-670.644) (-671.524) -- 0:00:44
322000 -- (-673.190) (-673.866) (-669.295) [-675.541] * (-669.269) (-668.435) [-674.210] (-669.816) -- 0:00:44
322500 -- (-673.114) [-670.895] (-667.512) (-675.341) * [-670.605] (-669.267) (-667.717) (-670.112) -- 0:00:44
323000 -- (-676.609) (-671.903) (-671.158) [-671.819] * (-672.126) (-668.976) (-670.985) [-669.731] -- 0:00:44
323500 -- (-674.351) (-672.408) [-668.992] (-670.173) * (-670.634) (-669.943) (-672.667) [-672.693] -- 0:00:43
324000 -- (-673.831) (-671.516) [-668.746] (-671.403) * (-671.868) (-670.955) [-670.396] (-672.704) -- 0:00:43
324500 -- (-673.417) (-670.465) [-671.128] (-672.499) * (-672.987) (-669.736) [-670.061] (-670.548) -- 0:00:43
325000 -- [-670.162] (-674.828) (-669.091) (-671.166) * (-672.078) (-669.567) [-668.472] (-672.339) -- 0:00:43
Average standard deviation of split frequencies: 0.011649
325500 -- (-672.236) (-671.243) (-672.070) [-670.982] * (-670.225) (-672.149) (-669.212) [-670.930] -- 0:00:43
326000 -- (-674.447) (-671.735) (-671.652) [-669.694] * [-672.230] (-668.939) (-670.314) (-675.586) -- 0:00:43
326500 -- (-670.845) [-668.574] (-672.017) (-669.814) * (-675.059) (-668.399) (-671.315) [-672.366] -- 0:00:43
327000 -- (-680.837) (-671.782) (-669.847) [-670.474] * (-669.860) (-668.868) (-670.690) [-671.747] -- 0:00:43
327500 -- (-668.936) [-670.638] (-668.713) (-672.695) * [-672.401] (-669.048) (-670.900) (-671.125) -- 0:00:43
328000 -- [-670.814] (-670.432) (-670.831) (-675.317) * (-669.663) (-675.677) (-669.486) [-671.760] -- 0:00:43
328500 -- (-672.191) (-671.514) [-668.410] (-672.417) * [-671.238] (-672.771) (-670.562) (-672.140) -- 0:00:42
329000 -- [-670.233] (-668.092) (-667.765) (-672.661) * (-672.244) (-673.103) [-675.668] (-672.249) -- 0:00:44
329500 -- (-670.885) (-673.501) (-669.643) [-671.351] * (-672.353) [-671.399] (-670.322) (-673.173) -- 0:00:44
330000 -- (-675.322) (-671.918) (-669.903) [-670.800] * [-672.415] (-670.667) (-671.191) (-671.419) -- 0:00:44
Average standard deviation of split frequencies: 0.010455
330500 -- (-674.118) (-671.443) [-671.281] (-670.102) * (-673.703) (-668.447) (-671.774) [-673.773] -- 0:00:44
331000 -- (-672.213) (-673.332) (-669.012) [-667.927] * (-672.184) (-668.857) [-668.688] (-673.866) -- 0:00:44
331500 -- (-672.460) (-671.572) [-670.442] (-671.182) * (-674.369) [-669.722] (-671.675) (-671.958) -- 0:00:44
332000 -- [-671.404] (-670.734) (-672.214) (-676.388) * [-674.116] (-672.034) (-670.196) (-672.334) -- 0:00:44
332500 -- [-672.295] (-668.899) (-671.501) (-673.234) * (-671.136) (-668.849) [-671.059] (-670.644) -- 0:00:44
333000 -- (-674.899) (-670.588) [-669.374] (-670.307) * (-670.642) (-670.329) [-670.386] (-670.579) -- 0:00:44
333500 -- (-672.173) (-671.928) (-670.502) [-668.993] * (-672.378) [-670.657] (-672.573) (-670.404) -- 0:00:43
334000 -- (-671.125) (-676.726) (-670.593) [-673.897] * [-671.189] (-672.780) (-672.126) (-669.711) -- 0:00:43
334500 -- (-672.007) [-675.974] (-672.288) (-672.277) * [-669.542] (-670.019) (-672.570) (-674.399) -- 0:00:43
335000 -- (-669.926) (-670.444) (-671.569) [-672.281] * [-668.475] (-668.101) (-671.320) (-671.288) -- 0:00:43
Average standard deviation of split frequencies: 0.011059
335500 -- (-671.260) (-668.657) [-672.379] (-677.930) * (-670.285) (-670.214) [-669.292] (-672.039) -- 0:00:43
336000 -- (-669.924) (-669.723) [-670.175] (-671.544) * (-671.436) [-673.789] (-667.062) (-671.298) -- 0:00:43
336500 -- (-672.802) (-669.705) (-669.442) [-668.140] * (-670.749) [-673.797] (-671.522) (-675.618) -- 0:00:43
337000 -- (-673.908) (-671.127) (-668.260) [-671.114] * (-672.629) [-668.526] (-668.056) (-675.040) -- 0:00:43
337500 -- (-674.912) (-669.094) [-671.299] (-669.825) * (-670.228) (-667.687) (-668.338) [-670.077] -- 0:00:43
338000 -- (-672.182) [-668.940] (-671.400) (-672.611) * (-671.649) (-670.538) [-668.643] (-668.543) -- 0:00:43
338500 -- (-671.380) (-673.041) (-674.678) [-668.056] * (-673.364) (-676.007) [-669.422] (-674.329) -- 0:00:42
339000 -- [-670.870] (-677.544) (-671.075) (-671.495) * [-671.632] (-676.469) (-667.674) (-671.432) -- 0:00:42
339500 -- [-670.605] (-668.824) (-671.090) (-674.582) * (-670.998) (-670.691) [-669.642] (-670.851) -- 0:00:42
340000 -- [-673.459] (-670.020) (-672.587) (-669.455) * (-669.715) [-668.591] (-669.511) (-678.794) -- 0:00:42
Average standard deviation of split frequencies: 0.011330
340500 -- [-672.292] (-669.583) (-670.812) (-669.881) * (-671.281) (-671.908) [-669.402] (-674.835) -- 0:00:42
341000 -- (-671.829) [-670.414] (-672.176) (-670.200) * (-670.874) (-672.034) (-668.255) [-674.787] -- 0:00:42
341500 -- (-671.839) (-671.632) (-670.614) [-670.535] * (-671.338) (-672.139) (-671.714) [-673.792] -- 0:00:42
342000 -- (-672.562) (-672.730) (-675.296) [-670.223] * (-670.470) [-669.342] (-671.050) (-674.116) -- 0:00:42
342500 -- (-671.045) [-671.817] (-672.854) (-672.471) * (-672.690) [-674.078] (-671.720) (-673.998) -- 0:00:42
343000 -- [-672.589] (-672.016) (-671.531) (-669.739) * (-671.745) (-670.700) [-668.217] (-670.471) -- 0:00:42
343500 -- (-670.551) (-671.070) [-669.080] (-672.080) * (-672.746) (-670.241) [-672.827] (-670.927) -- 0:00:42
344000 -- (-669.264) (-670.017) (-673.443) [-671.425] * (-670.619) (-673.424) (-670.819) [-671.075] -- 0:00:41
344500 -- (-670.459) (-671.701) (-670.589) [-666.691] * [-675.731] (-671.038) (-669.355) (-669.619) -- 0:00:43
345000 -- (-671.958) (-671.482) (-669.797) [-667.294] * (-676.480) [-671.098] (-668.138) (-672.702) -- 0:00:43
Average standard deviation of split frequencies: 0.011155
345500 -- (-671.667) (-669.809) (-670.591) [-671.373] * (-669.340) (-671.387) [-668.065] (-674.349) -- 0:00:43
346000 -- (-672.945) [-672.724] (-668.137) (-669.102) * (-670.078) [-667.883] (-671.228) (-674.598) -- 0:00:43
346500 -- (-675.700) (-670.056) [-669.603] (-671.727) * [-671.194] (-670.843) (-672.370) (-674.456) -- 0:00:43
347000 -- [-674.580] (-670.236) (-671.095) (-670.389) * [-670.761] (-671.452) (-668.862) (-672.748) -- 0:00:43
347500 -- (-668.623) [-671.996] (-672.754) (-668.747) * (-674.347) [-670.329] (-668.989) (-676.755) -- 0:00:43
348000 -- (-674.313) (-670.908) [-669.413] (-670.345) * [-668.621] (-671.097) (-672.216) (-669.399) -- 0:00:43
348500 -- [-670.172] (-669.580) (-667.995) (-670.870) * [-669.204] (-675.301) (-669.054) (-670.071) -- 0:00:42
349000 -- (-672.517) (-670.544) [-670.995] (-669.436) * (-669.662) (-671.561) [-668.462] (-671.051) -- 0:00:42
349500 -- [-671.962] (-673.420) (-669.281) (-669.768) * (-669.567) (-672.312) (-668.668) [-672.003] -- 0:00:42
350000 -- (-670.081) (-673.023) [-668.557] (-671.733) * (-672.878) [-671.007] (-668.577) (-670.497) -- 0:00:42
Average standard deviation of split frequencies: 0.012015
350500 -- [-670.320] (-672.498) (-669.809) (-672.656) * (-672.504) (-671.700) [-667.219] (-674.026) -- 0:00:42
351000 -- [-673.432] (-669.743) (-673.241) (-672.831) * (-670.804) (-671.777) [-668.750] (-675.949) -- 0:00:42
351500 -- (-671.959) (-670.306) (-672.464) [-671.166] * (-670.835) (-672.997) [-669.374] (-673.429) -- 0:00:42
352000 -- [-670.768] (-670.707) (-667.844) (-669.858) * [-668.688] (-671.219) (-670.677) (-671.078) -- 0:00:42
352500 -- [-670.458] (-671.839) (-672.929) (-675.888) * (-670.579) (-669.071) (-671.108) [-668.595] -- 0:00:42
353000 -- (-669.020) (-669.670) (-668.462) [-672.270] * (-669.329) (-673.128) [-669.002] (-670.311) -- 0:00:42
353500 -- (-675.154) (-672.274) [-668.574] (-673.752) * [-670.154] (-672.484) (-668.476) (-668.862) -- 0:00:42
354000 -- [-670.958] (-669.114) (-669.215) (-681.436) * (-671.550) (-671.265) (-669.696) [-670.033] -- 0:00:41
354500 -- [-670.649] (-669.742) (-671.771) (-673.958) * (-669.527) (-669.935) [-669.233] (-668.685) -- 0:00:41
355000 -- [-672.950] (-669.649) (-669.170) (-671.006) * (-670.719) (-669.350) (-669.386) [-671.744] -- 0:00:41
Average standard deviation of split frequencies: 0.013065
355500 -- (-672.965) (-669.649) (-671.619) [-667.150] * (-666.937) (-673.338) [-670.152] (-670.618) -- 0:00:41
356000 -- (-671.057) (-669.932) (-671.441) [-668.822] * (-668.646) (-672.017) [-669.120] (-671.394) -- 0:00:41
356500 -- (-670.092) (-673.219) [-672.837] (-667.489) * (-672.356) (-670.363) (-670.768) [-670.851] -- 0:00:41
357000 -- [-669.237] (-669.927) (-673.169) (-668.422) * (-670.553) (-672.952) [-673.936] (-668.773) -- 0:00:41
357500 -- (-675.134) (-672.548) (-672.395) [-668.372] * (-673.727) (-669.973) (-671.499) [-668.891] -- 0:00:41
358000 -- (-669.361) (-675.859) (-670.128) [-669.677] * [-671.763] (-673.891) (-671.507) (-672.220) -- 0:00:41
358500 -- (-669.863) (-673.205) [-672.247] (-668.265) * (-670.901) (-668.324) [-669.020] (-671.492) -- 0:00:41
359000 -- (-669.513) (-673.485) (-671.606) [-669.266] * (-670.511) [-670.785] (-669.080) (-670.287) -- 0:00:41
359500 -- (-670.971) (-670.951) (-672.806) [-669.234] * [-667.993] (-670.178) (-676.128) (-671.041) -- 0:00:40
360000 -- (-671.190) [-672.647] (-672.039) (-668.450) * (-671.368) [-669.086] (-673.627) (-669.734) -- 0:00:42
Average standard deviation of split frequencies: 0.012548
360500 -- (-670.780) [-670.110] (-670.101) (-668.368) * (-667.999) (-668.665) (-672.943) [-670.234] -- 0:00:42
361000 -- (-675.818) [-671.632] (-669.265) (-670.688) * (-671.735) [-669.254] (-672.904) (-673.167) -- 0:00:42
361500 -- (-673.395) (-671.922) (-673.066) [-671.869] * (-668.449) (-670.961) [-673.256] (-670.555) -- 0:00:42
362000 -- (-676.220) [-670.531] (-671.560) (-671.138) * (-669.479) (-670.223) (-670.402) [-669.965] -- 0:00:42
362500 -- [-675.990] (-672.118) (-671.661) (-676.433) * (-668.765) (-668.071) (-670.314) [-669.740] -- 0:00:42
363000 -- [-675.239] (-674.997) (-671.603) (-669.971) * (-672.717) (-673.125) (-670.450) [-668.257] -- 0:00:42
363500 -- (-672.985) [-671.985] (-674.041) (-667.851) * (-673.531) [-668.659] (-673.228) (-667.137) -- 0:00:42
364000 -- (-670.644) (-674.972) [-669.852] (-669.848) * (-670.748) (-673.267) (-674.386) [-668.639] -- 0:00:41
364500 -- (-674.189) (-672.440) [-668.181] (-670.930) * [-670.043] (-674.201) (-669.624) (-668.686) -- 0:00:41
365000 -- [-671.098] (-672.701) (-668.258) (-671.376) * (-671.391) [-668.207] (-670.108) (-667.843) -- 0:00:41
Average standard deviation of split frequencies: 0.013202
365500 -- (-672.369) (-670.054) [-669.656] (-669.610) * (-671.662) (-670.303) (-669.724) [-668.887] -- 0:00:41
366000 -- [-671.374] (-667.970) (-670.089) (-669.916) * (-669.031) (-671.959) [-668.731] (-672.180) -- 0:00:41
366500 -- (-671.947) [-668.702] (-671.744) (-668.232) * (-666.574) (-669.828) (-670.324) [-668.267] -- 0:00:41
367000 -- [-670.057] (-676.344) (-669.549) (-668.756) * [-668.122] (-672.257) (-671.872) (-669.119) -- 0:00:41
367500 -- [-671.195] (-671.120) (-669.294) (-670.295) * (-669.888) (-670.832) [-671.278] (-669.019) -- 0:00:41
368000 -- (-672.443) (-669.906) [-670.702] (-669.703) * [-667.817] (-671.085) (-669.567) (-671.379) -- 0:00:41
368500 -- (-675.785) (-671.248) (-669.909) [-671.720] * (-669.879) (-670.546) (-674.363) [-668.048] -- 0:00:41
369000 -- (-671.133) (-672.300) [-671.948] (-673.822) * (-669.123) [-673.869] (-673.124) (-672.173) -- 0:00:41
369500 -- (-674.055) (-669.160) (-672.530) [-675.759] * [-667.648] (-671.938) (-671.340) (-671.570) -- 0:00:40
370000 -- (-673.363) (-670.754) (-671.838) [-671.684] * (-672.426) (-673.285) [-669.219] (-668.695) -- 0:00:40
Average standard deviation of split frequencies: 0.013036
370500 -- (-674.115) (-670.424) [-674.138] (-671.860) * (-674.560) (-669.848) [-669.459] (-673.499) -- 0:00:40
371000 -- (-671.594) (-674.587) [-670.722] (-670.342) * (-669.173) [-671.806] (-671.201) (-673.755) -- 0:00:40
371500 -- (-670.830) (-671.246) (-669.052) [-671.898] * (-670.550) (-669.526) (-670.635) [-674.294] -- 0:00:40
372000 -- [-668.711] (-670.262) (-669.219) (-673.351) * (-671.861) [-670.062] (-672.574) (-669.545) -- 0:00:40
372500 -- (-669.354) (-673.699) (-673.350) [-669.462] * (-668.221) (-672.734) [-670.543] (-669.975) -- 0:00:40
373000 -- (-672.555) (-669.777) [-671.054] (-670.398) * [-668.352] (-675.486) (-669.562) (-669.732) -- 0:00:40
373500 -- (-671.817) [-670.308] (-673.800) (-672.697) * (-672.503) [-671.380] (-669.618) (-669.136) -- 0:00:40
374000 -- (-670.759) (-670.431) [-672.802] (-671.173) * (-673.315) [-669.247] (-673.454) (-671.695) -- 0:00:40
374500 -- (-671.084) (-672.999) (-671.487) [-670.906] * (-669.042) [-672.693] (-673.683) (-671.474) -- 0:00:40
375000 -- (-668.975) (-671.711) (-668.938) [-669.908] * [-668.510] (-671.094) (-672.735) (-668.649) -- 0:00:40
Average standard deviation of split frequencies: 0.012694
375500 -- (-673.006) (-673.263) [-668.490] (-671.342) * (-668.172) (-672.028) (-671.657) [-675.419] -- 0:00:41
376000 -- (-670.378) (-672.329) (-669.838) [-669.782] * (-676.291) [-668.932] (-670.815) (-673.326) -- 0:00:41
376500 -- (-667.803) (-671.181) [-673.885] (-669.760) * (-670.999) (-673.899) [-671.547] (-673.992) -- 0:00:41
377000 -- (-668.358) (-670.839) [-671.875] (-669.267) * (-671.417) [-675.501] (-672.491) (-673.448) -- 0:00:41
377500 -- (-672.525) (-672.436) (-675.115) [-670.107] * (-676.623) [-668.493] (-671.794) (-668.997) -- 0:00:41
378000 -- [-670.853] (-674.721) (-669.459) (-672.065) * (-671.487) (-673.622) (-669.924) [-670.820] -- 0:00:41
378500 -- (-670.063) (-674.773) (-671.822) [-671.026] * (-672.492) (-670.999) (-671.661) [-669.601] -- 0:00:41
379000 -- [-669.098] (-673.881) (-669.705) (-676.655) * (-669.968) [-672.604] (-672.678) (-669.920) -- 0:00:40
379500 -- [-669.526] (-672.656) (-673.587) (-670.469) * (-673.053) [-669.797] (-673.647) (-669.775) -- 0:00:40
380000 -- (-668.749) (-676.855) (-671.313) [-668.691] * (-669.621) (-669.658) (-671.507) [-671.351] -- 0:00:40
Average standard deviation of split frequencies: 0.013235
380500 -- [-668.165] (-674.092) (-671.987) (-672.835) * (-670.069) (-669.336) (-674.174) [-671.445] -- 0:00:40
381000 -- (-668.547) (-670.338) (-670.448) [-668.814] * (-673.192) [-668.151] (-669.954) (-671.411) -- 0:00:40
381500 -- (-670.890) (-670.582) (-668.784) [-668.583] * (-672.061) (-676.837) [-670.435] (-673.253) -- 0:00:40
382000 -- (-670.876) [-669.278] (-671.367) (-671.389) * (-672.304) (-671.130) [-670.950] (-674.056) -- 0:00:40
382500 -- [-672.047] (-670.958) (-671.116) (-671.554) * (-668.768) (-669.977) [-669.603] (-671.277) -- 0:00:40
383000 -- (-672.450) [-671.539] (-668.925) (-670.257) * (-675.292) (-671.369) [-671.433] (-669.094) -- 0:00:40
383500 -- [-667.347] (-670.446) (-671.707) (-674.037) * (-673.177) (-671.596) [-667.399] (-670.319) -- 0:00:40
384000 -- (-671.360) (-672.712) (-674.241) [-669.373] * (-672.507) (-669.272) [-671.298] (-675.563) -- 0:00:40
384500 -- (-669.864) [-671.922] (-676.126) (-672.900) * (-672.128) (-669.538) [-671.570] (-669.214) -- 0:00:40
385000 -- (-671.582) (-673.635) [-668.735] (-670.101) * (-675.186) (-671.700) (-670.136) [-668.453] -- 0:00:39
Average standard deviation of split frequencies: 0.013290
385500 -- (-672.117) (-674.047) [-670.257] (-673.448) * [-670.856] (-671.949) (-670.055) (-667.937) -- 0:00:39
386000 -- (-672.291) [-669.964] (-670.835) (-667.540) * (-671.159) (-671.038) (-673.034) [-670.498] -- 0:00:39
386500 -- (-671.049) [-677.441] (-670.815) (-671.828) * [-669.807] (-671.849) (-672.574) (-669.944) -- 0:00:39
387000 -- (-670.119) (-670.335) (-669.456) [-672.887] * (-670.866) (-670.974) [-669.983] (-667.386) -- 0:00:39
387500 -- (-666.918) [-673.102] (-669.803) (-673.422) * (-674.147) (-667.851) [-668.628] (-671.999) -- 0:00:39
388000 -- [-667.126] (-673.571) (-670.131) (-673.270) * (-672.097) (-675.012) [-668.225] (-670.129) -- 0:00:39
388500 -- (-668.732) (-672.076) (-668.059) [-669.928] * (-669.184) (-673.118) [-668.885] (-672.244) -- 0:00:39
389000 -- (-672.703) [-672.532] (-671.548) (-672.791) * (-671.905) (-667.931) [-670.193] (-670.708) -- 0:00:39
389500 -- (-671.017) (-674.168) (-671.910) [-671.191] * (-672.379) (-672.498) [-669.433] (-672.337) -- 0:00:39
390000 -- (-672.640) (-672.445) (-670.695) [-668.227] * (-670.644) (-671.118) [-670.565] (-669.609) -- 0:00:39
Average standard deviation of split frequencies: 0.013841
390500 -- (-670.184) (-671.654) [-667.940] (-672.398) * [-672.412] (-669.092) (-669.589) (-669.277) -- 0:00:39
391000 -- (-670.053) (-672.897) [-670.433] (-672.132) * (-671.324) (-670.524) (-667.946) [-670.618] -- 0:00:40
391500 -- [-668.874] (-671.269) (-668.272) (-669.139) * (-671.881) (-669.925) [-669.031] (-671.026) -- 0:00:40
392000 -- (-669.852) (-670.211) (-668.128) [-672.865] * [-672.511] (-669.358) (-671.550) (-672.918) -- 0:00:40
392500 -- (-668.812) (-671.048) (-669.578) [-672.746] * (-672.520) [-667.860] (-671.515) (-670.867) -- 0:00:40
393000 -- (-669.455) (-676.243) (-668.934) [-670.293] * (-674.860) (-674.663) [-668.604] (-669.769) -- 0:00:40
393500 -- (-669.566) (-671.324) (-670.757) [-672.496] * (-672.285) [-672.074] (-670.670) (-670.281) -- 0:00:40
394000 -- [-668.564] (-671.805) (-668.091) (-672.139) * (-671.384) (-672.808) (-671.568) [-669.647] -- 0:00:39
394500 -- (-671.658) [-668.924] (-672.252) (-671.241) * (-671.513) (-674.381) (-669.728) [-667.659] -- 0:00:39
395000 -- (-673.643) (-670.844) (-669.305) [-669.601] * (-672.749) (-669.371) (-671.492) [-669.636] -- 0:00:39
Average standard deviation of split frequencies: 0.014136
395500 -- [-670.060] (-671.023) (-670.767) (-673.705) * (-671.253) (-670.200) (-670.351) [-668.356] -- 0:00:39
396000 -- (-667.487) (-671.772) [-670.846] (-672.487) * (-672.407) [-670.892] (-669.483) (-669.319) -- 0:00:39
396500 -- (-669.607) (-672.917) (-673.741) [-670.524] * (-670.460) [-670.125] (-672.656) (-671.322) -- 0:00:39
397000 -- (-671.593) [-671.910] (-671.576) (-670.031) * (-671.195) (-669.089) [-669.527] (-669.255) -- 0:00:39
397500 -- [-666.678] (-671.106) (-671.515) (-668.188) * (-674.333) (-668.094) (-667.870) [-669.550] -- 0:00:39
398000 -- (-668.799) [-670.780] (-672.280) (-670.653) * (-671.943) [-669.983] (-669.919) (-672.932) -- 0:00:39
398500 -- [-669.549] (-669.062) (-671.921) (-670.220) * [-670.584] (-671.325) (-672.308) (-671.035) -- 0:00:39
399000 -- (-668.181) (-670.986) [-671.032] (-669.395) * (-671.590) [-671.551] (-670.353) (-670.174) -- 0:00:39
399500 -- (-668.647) (-671.630) (-670.158) [-670.470] * (-675.451) (-673.806) (-670.512) [-668.152] -- 0:00:39
400000 -- [-668.963] (-673.282) (-671.629) (-673.345) * (-670.678) (-672.958) (-672.527) [-670.534] -- 0:00:39
Average standard deviation of split frequencies: 0.013236
400500 -- (-672.379) (-672.329) (-670.993) [-670.053] * (-667.143) (-669.669) (-668.593) [-670.464] -- 0:00:38
401000 -- (-671.217) [-671.834] (-672.807) (-668.683) * (-669.045) (-671.650) [-670.398] (-672.141) -- 0:00:38
401500 -- (-669.267) [-673.347] (-671.236) (-670.770) * (-669.842) [-669.835] (-667.537) (-671.469) -- 0:00:38
402000 -- (-673.391) (-669.106) (-676.064) [-670.885] * (-668.594) [-669.817] (-668.282) (-672.238) -- 0:00:38
402500 -- [-669.229] (-669.673) (-669.512) (-669.125) * [-669.550] (-671.355) (-669.520) (-670.974) -- 0:00:38
403000 -- (-669.809) (-670.162) [-670.686] (-669.329) * (-670.632) (-668.195) [-669.176] (-670.752) -- 0:00:38
403500 -- [-671.546] (-673.316) (-671.071) (-674.769) * (-670.373) (-673.466) [-670.290] (-667.909) -- 0:00:38
404000 -- (-675.230) [-669.502] (-672.938) (-670.990) * (-670.898) (-673.576) [-668.110] (-669.769) -- 0:00:38
404500 -- (-672.684) (-667.380) [-670.924] (-671.439) * (-671.592) (-673.033) (-669.247) [-669.275] -- 0:00:38
405000 -- (-667.989) [-669.782] (-669.679) (-669.080) * (-673.430) (-669.251) [-668.655] (-677.648) -- 0:00:38
Average standard deviation of split frequencies: 0.013643
405500 -- (-671.117) (-670.081) [-670.846] (-670.380) * (-670.558) (-670.526) [-676.168] (-670.843) -- 0:00:38
406000 -- (-671.281) (-668.295) [-667.999] (-670.861) * (-671.822) (-670.395) (-668.367) [-670.375] -- 0:00:38
406500 -- (-672.339) (-669.317) (-668.924) [-669.941] * [-671.585] (-670.774) (-669.540) (-669.462) -- 0:00:39
407000 -- (-668.673) (-670.896) (-670.037) [-668.521] * (-670.878) [-668.942] (-669.757) (-673.615) -- 0:00:39
407500 -- (-672.689) (-669.037) (-671.045) [-672.329] * (-672.295) (-671.273) (-668.431) [-670.671] -- 0:00:39
408000 -- (-669.251) (-671.951) (-670.351) [-667.738] * (-672.464) (-673.896) (-670.756) [-670.772] -- 0:00:39
408500 -- (-669.264) [-667.845] (-669.934) (-672.427) * [-672.353] (-672.882) (-674.344) (-669.629) -- 0:00:39
409000 -- (-668.196) (-667.991) [-668.458] (-674.147) * [-670.998] (-669.370) (-670.963) (-669.638) -- 0:00:39
409500 -- (-673.345) [-669.749] (-672.410) (-675.591) * (-669.544) (-669.602) [-668.708] (-670.930) -- 0:00:38
410000 -- [-669.819] (-669.782) (-673.842) (-667.723) * [-669.383] (-675.794) (-670.954) (-670.845) -- 0:00:38
Average standard deviation of split frequencies: 0.012770
410500 -- [-669.765] (-670.016) (-669.901) (-674.098) * (-671.622) (-673.277) [-669.419] (-669.807) -- 0:00:38
411000 -- [-670.150] (-672.300) (-675.326) (-667.856) * (-671.196) (-670.505) [-671.668] (-668.565) -- 0:00:38
411500 -- (-669.780) (-672.541) [-671.074] (-669.650) * (-672.663) (-674.861) (-670.839) [-669.356] -- 0:00:38
412000 -- [-667.453] (-671.529) (-672.151) (-669.101) * (-674.778) (-670.670) [-667.146] (-669.508) -- 0:00:38
412500 -- (-667.885) (-673.179) (-671.224) [-669.158] * (-671.390) [-671.095] (-671.468) (-672.046) -- 0:00:38
413000 -- (-670.997) [-670.273] (-674.708) (-669.141) * [-672.475] (-668.531) (-670.203) (-671.039) -- 0:00:38
413500 -- (-669.789) (-671.059) (-672.400) [-673.571] * (-670.441) (-669.657) [-669.643] (-669.033) -- 0:00:38
414000 -- (-668.713) (-669.431) (-673.065) [-670.597] * (-669.745) [-676.831] (-669.263) (-672.063) -- 0:00:38
414500 -- (-667.497) (-668.541) (-673.715) [-668.486] * [-673.479] (-674.068) (-670.151) (-673.288) -- 0:00:38
415000 -- (-668.321) (-671.534) (-672.815) [-670.674] * (-672.196) [-671.959] (-669.483) (-672.621) -- 0:00:38
Average standard deviation of split frequencies: 0.012323
415500 -- (-667.587) (-667.890) (-672.162) [-667.911] * (-669.417) (-672.491) [-669.683] (-671.918) -- 0:00:37
416000 -- (-670.069) (-671.489) [-669.874] (-669.111) * (-669.704) (-673.549) (-670.863) [-669.848] -- 0:00:37
416500 -- (-669.576) (-672.378) (-675.529) [-671.066] * (-671.778) [-672.913] (-669.340) (-669.778) -- 0:00:37
417000 -- (-668.216) (-667.886) (-670.647) [-669.893] * (-669.117) (-670.833) [-670.189] (-667.495) -- 0:00:37
417500 -- (-668.815) (-668.904) (-670.938) [-669.196] * [-669.203] (-671.335) (-672.214) (-673.907) -- 0:00:37
418000 -- (-668.753) (-669.487) [-667.820] (-670.378) * (-671.400) [-671.026] (-668.317) (-671.210) -- 0:00:37
418500 -- [-669.610] (-669.981) (-670.219) (-670.235) * (-668.950) [-670.853] (-671.232) (-671.318) -- 0:00:37
419000 -- (-667.550) (-667.615) (-676.028) [-670.334] * [-668.409] (-675.229) (-673.925) (-671.355) -- 0:00:37
419500 -- (-671.275) (-669.078) [-675.613] (-672.200) * [-670.367] (-676.548) (-672.080) (-670.631) -- 0:00:37
420000 -- (-670.880) (-668.558) (-671.959) [-670.712] * (-671.214) (-673.270) [-670.062] (-670.809) -- 0:00:37
Average standard deviation of split frequencies: 0.013447
420500 -- [-670.394] (-668.738) (-668.882) (-669.988) * [-673.183] (-675.515) (-670.139) (-672.854) -- 0:00:37
421000 -- (-671.108) (-672.326) (-671.595) [-670.555] * (-670.548) [-672.853] (-669.544) (-671.328) -- 0:00:37
421500 -- (-669.417) [-671.108] (-669.654) (-671.427) * (-671.285) (-671.753) [-668.067] (-671.527) -- 0:00:37
422000 -- (-677.651) (-668.006) (-670.762) [-672.161] * (-670.276) (-671.621) (-670.385) [-670.871] -- 0:00:38
422500 -- (-670.137) (-669.326) (-668.376) [-668.314] * (-673.266) (-670.289) (-669.890) [-672.296] -- 0:00:38
423000 -- (-668.736) (-674.612) (-669.659) [-668.910] * (-672.717) (-668.951) (-669.995) [-672.182] -- 0:00:38
423500 -- (-668.005) [-671.240] (-668.515) (-671.064) * (-670.923) (-669.673) [-670.412] (-668.999) -- 0:00:38
424000 -- (-669.916) (-671.817) (-670.128) [-668.324] * [-668.989] (-671.417) (-670.912) (-670.856) -- 0:00:38
424500 -- (-669.860) [-670.225] (-671.533) (-666.861) * (-672.177) (-672.738) [-667.653] (-672.347) -- 0:00:37
425000 -- (-667.179) (-671.704) [-670.725] (-669.544) * [-670.773] (-672.113) (-673.639) (-671.880) -- 0:00:37
Average standard deviation of split frequencies: 0.011688
425500 -- (-672.292) (-672.443) (-673.135) [-669.766] * (-670.796) (-670.354) [-671.218] (-671.116) -- 0:00:37
426000 -- [-668.743] (-674.719) (-671.086) (-670.721) * [-671.022] (-675.179) (-669.174) (-674.496) -- 0:00:37
426500 -- (-671.201) [-668.245] (-671.753) (-673.142) * (-669.069) [-675.373] (-671.655) (-673.229) -- 0:00:37
427000 -- (-670.881) (-669.092) (-667.745) [-672.544] * [-669.872] (-672.733) (-671.440) (-671.668) -- 0:00:37
427500 -- (-668.889) (-672.526) [-667.206] (-673.079) * (-670.847) (-672.292) [-669.719] (-671.284) -- 0:00:37
428000 -- (-671.044) (-672.233) [-667.798] (-671.291) * (-670.011) (-675.161) [-668.418] (-672.648) -- 0:00:37
428500 -- [-670.961] (-671.292) (-668.737) (-671.303) * (-668.417) (-670.889) [-672.705] (-671.906) -- 0:00:37
429000 -- (-671.328) (-668.934) [-670.153] (-671.053) * (-668.013) [-672.657] (-668.881) (-672.565) -- 0:00:37
429500 -- (-674.014) (-672.662) [-672.249] (-674.638) * (-672.735) (-670.371) (-667.237) [-672.477] -- 0:00:37
430000 -- [-670.156] (-669.264) (-672.341) (-670.753) * (-668.731) (-671.521) (-668.384) [-670.391] -- 0:00:37
Average standard deviation of split frequencies: 0.011165
430500 -- [-669.704] (-670.824) (-671.179) (-668.943) * [-669.219] (-671.802) (-667.624) (-670.607) -- 0:00:37
431000 -- [-669.690] (-672.470) (-670.509) (-670.648) * [-670.833] (-673.353) (-670.395) (-670.594) -- 0:00:36
431500 -- (-672.613) (-672.449) [-671.061] (-674.857) * (-670.532) [-673.430] (-669.882) (-670.338) -- 0:00:36
432000 -- (-667.372) (-669.247) (-671.824) [-670.405] * [-671.460] (-670.266) (-670.552) (-670.215) -- 0:00:36
432500 -- (-667.786) (-671.560) [-669.848] (-674.688) * (-673.999) (-670.642) [-668.388] (-673.711) -- 0:00:36
433000 -- [-669.407] (-669.165) (-670.918) (-671.524) * (-674.473) (-668.574) [-668.956] (-672.193) -- 0:00:36
433500 -- (-669.173) (-670.261) [-674.126] (-672.760) * [-672.152] (-671.282) (-669.842) (-672.490) -- 0:00:36
434000 -- (-668.088) (-669.430) [-670.093] (-673.837) * (-672.687) [-673.579] (-670.089) (-672.368) -- 0:00:36
434500 -- (-668.523) (-670.368) [-674.639] (-672.610) * (-671.590) (-674.141) (-671.032) [-674.724] -- 0:00:36
435000 -- (-668.728) [-670.178] (-668.940) (-670.765) * (-670.858) (-670.611) [-668.167] (-672.565) -- 0:00:36
Average standard deviation of split frequencies: 0.011317
435500 -- (-667.278) (-672.111) (-671.177) [-669.342] * (-669.227) (-669.163) [-668.736] (-671.935) -- 0:00:36
436000 -- [-667.815] (-670.366) (-671.485) (-672.902) * (-672.789) [-670.777] (-669.717) (-670.690) -- 0:00:36
436500 -- (-669.674) (-670.373) [-669.168] (-672.839) * (-671.658) (-671.992) (-670.022) [-671.426] -- 0:00:36
437000 -- [-668.858] (-672.187) (-668.770) (-669.611) * (-671.314) (-671.827) (-668.901) [-670.535] -- 0:00:36
437500 -- (-668.344) (-673.388) [-668.470] (-670.661) * (-669.265) [-669.024] (-670.096) (-670.762) -- 0:00:37
438000 -- (-670.522) (-671.692) (-669.615) [-668.938] * [-669.668] (-668.583) (-670.177) (-669.883) -- 0:00:37
438500 -- [-668.866] (-672.126) (-670.452) (-671.509) * (-672.226) (-668.984) (-671.689) [-669.703] -- 0:00:37
439000 -- [-671.064] (-668.911) (-667.407) (-669.637) * [-669.511] (-667.860) (-675.931) (-670.841) -- 0:00:37
439500 -- (-675.891) [-668.563] (-669.958) (-674.437) * (-669.910) (-670.216) [-670.808] (-672.355) -- 0:00:36
440000 -- (-672.437) (-671.469) (-672.426) [-668.160] * (-668.100) (-673.003) [-671.385] (-674.987) -- 0:00:36
Average standard deviation of split frequencies: 0.011553
440500 -- (-672.325) (-668.034) [-673.100] (-670.768) * (-670.834) [-670.955] (-670.322) (-673.742) -- 0:00:36
441000 -- [-667.912] (-671.321) (-668.118) (-673.049) * [-666.098] (-671.494) (-672.671) (-671.641) -- 0:00:36
441500 -- (-669.589) [-673.396] (-669.862) (-671.929) * (-671.786) (-671.239) (-669.203) [-670.940] -- 0:00:36
442000 -- (-674.351) (-670.111) [-671.358] (-671.289) * [-667.525] (-668.825) (-668.029) (-670.141) -- 0:00:36
442500 -- (-670.770) [-669.473] (-672.636) (-669.040) * (-668.844) [-670.223] (-669.136) (-669.526) -- 0:00:36
443000 -- [-668.549] (-671.222) (-670.319) (-670.384) * (-667.443) [-668.975] (-669.832) (-674.016) -- 0:00:36
443500 -- [-669.536] (-669.740) (-667.344) (-671.079) * (-667.728) (-669.433) (-670.688) [-670.585] -- 0:00:36
444000 -- [-670.544] (-670.792) (-671.059) (-671.356) * (-670.194) [-670.029] (-669.036) (-670.028) -- 0:00:36
444500 -- (-670.710) (-668.214) (-672.867) [-669.474] * [-668.609] (-670.353) (-671.141) (-674.383) -- 0:00:36
445000 -- (-673.394) (-667.922) [-670.333] (-671.839) * [-667.629] (-670.288) (-672.510) (-671.408) -- 0:00:36
Average standard deviation of split frequencies: 0.012261
445500 -- (-670.651) [-667.654] (-666.983) (-671.512) * (-668.196) (-670.477) (-672.035) [-669.462] -- 0:00:36
446000 -- (-669.716) (-667.356) (-668.142) [-670.502] * (-667.300) (-672.135) [-670.243] (-670.981) -- 0:00:36
446500 -- (-673.630) [-666.468] (-671.778) (-670.917) * (-674.372) [-672.185] (-678.649) (-676.014) -- 0:00:35
447000 -- [-673.563] (-671.039) (-669.902) (-673.978) * (-673.335) [-670.087] (-671.401) (-669.234) -- 0:00:35
447500 -- (-670.133) [-666.995] (-669.605) (-675.176) * (-669.542) (-669.247) (-670.120) [-670.646] -- 0:00:35
448000 -- [-672.445] (-671.510) (-673.662) (-670.118) * [-670.567] (-670.686) (-672.032) (-673.090) -- 0:00:35
448500 -- (-672.491) [-668.998] (-671.673) (-669.941) * [-668.220] (-670.337) (-672.884) (-671.337) -- 0:00:35
449000 -- (-672.288) (-670.120) (-670.827) [-671.891] * [-666.876] (-668.694) (-673.427) (-671.270) -- 0:00:35
449500 -- (-669.163) (-673.526) [-670.947] (-670.168) * (-676.498) [-670.035] (-669.563) (-674.255) -- 0:00:35
450000 -- (-668.610) (-671.683) [-670.832] (-672.305) * [-670.295] (-673.456) (-669.883) (-671.551) -- 0:00:35
Average standard deviation of split frequencies: 0.012204
450500 -- (-671.082) (-671.450) [-669.393] (-672.383) * [-671.271] (-670.466) (-670.660) (-670.572) -- 0:00:35
451000 -- [-669.034] (-674.711) (-669.448) (-676.075) * (-667.308) (-670.898) [-668.299] (-669.834) -- 0:00:35
451500 -- [-670.442] (-670.928) (-671.113) (-671.694) * (-669.668) (-670.212) (-669.915) [-671.248] -- 0:00:35
452000 -- (-670.820) (-673.086) [-669.059] (-672.100) * (-668.205) (-673.691) [-670.877] (-671.778) -- 0:00:35
452500 -- (-673.117) (-670.257) (-669.107) [-670.353] * [-669.491] (-672.576) (-667.571) (-671.741) -- 0:00:35
453000 -- [-669.722] (-669.618) (-670.245) (-669.529) * (-668.837) (-673.761) [-669.651] (-672.124) -- 0:00:35
453500 -- (-669.171) (-671.604) (-671.832) [-668.983] * (-669.398) [-672.342] (-672.164) (-672.848) -- 0:00:36
454000 -- (-671.525) (-674.125) [-666.845] (-669.375) * [-671.922] (-672.246) (-668.342) (-671.786) -- 0:00:36
454500 -- (-669.967) (-668.591) (-672.597) [-668.069] * (-671.169) (-672.269) (-672.821) [-669.118] -- 0:00:36
455000 -- [-668.522] (-669.506) (-669.686) (-673.509) * [-670.277] (-670.020) (-671.181) (-669.175) -- 0:00:35
Average standard deviation of split frequencies: 0.012405
455500 -- (-669.096) (-671.282) (-670.112) [-672.386] * (-673.584) (-670.535) [-669.810] (-671.143) -- 0:00:35
456000 -- (-672.946) (-668.508) (-668.337) [-669.858] * (-671.808) (-671.840) [-668.574] (-672.446) -- 0:00:35
456500 -- (-671.195) (-671.623) (-669.568) [-671.796] * (-671.608) (-671.947) [-672.628] (-673.942) -- 0:00:35
457000 -- (-671.000) (-671.994) [-675.923] (-668.779) * [-670.393] (-670.614) (-671.467) (-672.513) -- 0:00:35
457500 -- (-671.161) (-669.158) [-668.888] (-669.813) * (-669.851) (-674.310) [-671.037] (-672.398) -- 0:00:35
458000 -- (-671.063) (-673.535) (-670.844) [-669.570] * [-667.564] (-669.863) (-671.635) (-670.984) -- 0:00:35
458500 -- (-670.293) (-672.515) [-668.409] (-668.557) * (-670.610) (-672.429) (-671.248) [-668.083] -- 0:00:35
459000 -- [-672.112] (-670.697) (-670.928) (-668.568) * (-668.894) (-671.406) [-669.551] (-671.640) -- 0:00:35
459500 -- (-672.428) (-670.403) (-668.353) [-666.952] * (-667.467) [-667.387] (-672.257) (-669.480) -- 0:00:35
460000 -- (-673.560) [-671.942] (-668.904) (-669.749) * (-668.976) (-667.893) [-671.435] (-669.082) -- 0:00:35
Average standard deviation of split frequencies: 0.011802
460500 -- [-674.877] (-674.733) (-671.322) (-670.887) * (-670.231) [-670.068] (-670.684) (-671.770) -- 0:00:35
461000 -- (-670.157) (-673.741) (-667.522) [-669.073] * [-668.124] (-670.918) (-670.079) (-673.222) -- 0:00:35
461500 -- (-673.200) (-671.698) (-671.201) [-669.975] * (-674.559) (-674.270) [-668.898] (-674.261) -- 0:00:35
462000 -- (-678.807) (-673.966) [-669.974] (-667.623) * (-671.665) [-668.585] (-669.727) (-672.449) -- 0:00:34
462500 -- (-678.159) [-669.214] (-668.444) (-670.010) * (-671.024) (-670.317) (-669.402) [-668.426] -- 0:00:34
463000 -- (-669.927) (-673.169) [-667.572] (-670.672) * (-673.363) [-669.308] (-671.664) (-671.486) -- 0:00:34
463500 -- (-669.348) (-668.955) (-670.696) [-670.673] * (-668.622) [-669.196] (-672.214) (-669.461) -- 0:00:34
464000 -- (-671.303) (-668.130) (-670.548) [-669.297] * (-672.910) (-669.216) [-669.590] (-672.270) -- 0:00:34
464500 -- (-675.600) (-669.926) [-669.820] (-671.759) * (-673.224) [-669.498] (-670.623) (-669.888) -- 0:00:34
465000 -- (-672.783) (-672.860) [-668.787] (-672.880) * (-670.042) [-668.059] (-671.042) (-670.306) -- 0:00:34
Average standard deviation of split frequencies: 0.012274
465500 -- (-671.081) (-668.516) (-670.153) [-670.513] * (-673.638) (-668.046) [-670.188] (-676.344) -- 0:00:34
466000 -- (-670.427) (-667.231) (-669.361) [-671.074] * (-673.857) [-671.962] (-675.137) (-675.164) -- 0:00:34
466500 -- (-671.054) [-670.138] (-668.935) (-667.951) * (-670.926) (-669.434) (-669.787) [-669.130] -- 0:00:34
467000 -- (-670.949) [-670.615] (-671.700) (-668.502) * (-669.108) [-670.783] (-668.661) (-668.546) -- 0:00:34
467500 -- (-672.377) [-671.595] (-670.249) (-671.010) * (-671.329) [-669.853] (-669.911) (-669.482) -- 0:00:34
468000 -- (-671.826) [-668.973] (-669.492) (-668.404) * [-670.084] (-670.101) (-674.267) (-672.134) -- 0:00:34
468500 -- (-669.207) [-673.497] (-669.266) (-674.084) * [-670.347] (-670.339) (-669.829) (-673.862) -- 0:00:35
469000 -- (-672.139) [-672.718] (-670.589) (-670.916) * (-673.354) [-671.219] (-671.583) (-671.542) -- 0:00:35
469500 -- (-671.499) (-672.680) [-675.069] (-668.878) * [-669.939] (-671.984) (-673.934) (-669.577) -- 0:00:35
470000 -- (-673.297) [-668.837] (-672.511) (-669.090) * [-674.346] (-671.881) (-669.813) (-670.467) -- 0:00:34
Average standard deviation of split frequencies: 0.011551
470500 -- (-672.732) (-673.966) [-669.660] (-676.209) * (-670.872) [-670.210] (-668.582) (-672.640) -- 0:00:34
471000 -- (-676.534) (-672.509) (-670.445) [-669.413] * [-668.476] (-671.083) (-667.919) (-671.430) -- 0:00:34
471500 -- (-672.769) [-669.677] (-671.884) (-670.087) * (-669.327) (-670.121) (-673.372) [-671.522] -- 0:00:34
472000 -- (-670.057) [-671.608] (-673.464) (-667.918) * [-673.406] (-670.994) (-670.349) (-671.330) -- 0:00:34
472500 -- (-669.704) [-667.720] (-672.128) (-669.948) * (-675.291) [-671.789] (-669.807) (-671.849) -- 0:00:34
473000 -- [-672.566] (-668.490) (-671.899) (-672.393) * (-669.145) [-675.045] (-671.326) (-670.753) -- 0:00:34
473500 -- (-668.268) (-669.803) (-670.887) [-671.241] * (-670.274) (-680.375) [-669.657] (-669.401) -- 0:00:34
474000 -- [-670.110] (-670.242) (-669.531) (-670.072) * (-671.198) (-674.601) [-669.384] (-671.541) -- 0:00:34
474500 -- [-669.096] (-667.146) (-669.787) (-672.586) * [-670.656] (-668.296) (-667.915) (-670.470) -- 0:00:34
475000 -- (-671.576) (-668.322) (-669.539) [-669.862] * [-669.193] (-670.015) (-673.186) (-669.517) -- 0:00:34
Average standard deviation of split frequencies: 0.011422
475500 -- (-674.291) [-669.782] (-669.356) (-671.406) * [-669.765] (-670.898) (-669.851) (-669.087) -- 0:00:34
476000 -- [-679.172] (-669.983) (-669.756) (-669.298) * [-675.880] (-673.131) (-670.587) (-668.305) -- 0:00:34
476500 -- (-672.035) [-670.953] (-672.429) (-675.323) * [-672.423] (-672.776) (-668.896) (-670.315) -- 0:00:34
477000 -- (-671.196) [-669.383] (-669.477) (-677.598) * (-673.117) [-671.424] (-668.568) (-670.852) -- 0:00:33
477500 -- (-671.191) (-668.115) (-670.890) [-673.934] * (-668.512) (-669.242) [-671.720] (-670.327) -- 0:00:33
478000 -- (-673.087) [-671.135] (-673.331) (-669.681) * (-672.130) (-671.254) [-670.784] (-675.453) -- 0:00:33
478500 -- (-671.653) (-668.676) (-672.550) [-668.159] * (-670.685) (-671.175) (-670.131) [-670.410] -- 0:00:33
479000 -- [-673.690] (-670.037) (-674.939) (-672.358) * [-669.094] (-671.091) (-670.473) (-669.193) -- 0:00:33
479500 -- [-673.558] (-669.176) (-672.056) (-670.821) * (-671.823) (-671.755) (-673.688) [-669.799] -- 0:00:33
480000 -- [-668.447] (-672.030) (-670.664) (-670.146) * (-671.073) (-671.753) [-676.050] (-670.854) -- 0:00:33
Average standard deviation of split frequencies: 0.010069
480500 -- (-672.192) [-670.572] (-672.414) (-669.344) * (-670.931) (-673.334) (-669.236) [-673.353] -- 0:00:33
481000 -- (-668.794) [-670.390] (-670.951) (-669.782) * (-671.742) (-670.400) (-668.936) [-670.968] -- 0:00:33
481500 -- (-670.288) (-671.550) (-671.563) [-672.633] * (-670.254) (-669.971) [-667.853] (-670.572) -- 0:00:33
482000 -- [-668.611] (-671.731) (-672.061) (-668.633) * (-672.288) (-669.592) [-669.238] (-671.921) -- 0:00:33
482500 -- [-670.963] (-671.221) (-672.575) (-670.466) * [-670.222] (-671.502) (-672.779) (-673.163) -- 0:00:33
483000 -- (-670.029) [-674.529] (-672.089) (-668.559) * (-669.669) [-671.409] (-674.109) (-670.360) -- 0:00:33
483500 -- (-667.966) (-671.456) [-671.407] (-670.785) * (-670.183) (-672.080) (-671.525) [-667.767] -- 0:00:33
484000 -- (-668.886) (-669.477) [-668.912] (-671.942) * (-669.771) [-674.377] (-675.124) (-669.088) -- 0:00:34
484500 -- (-670.045) (-671.894) [-668.593] (-668.934) * (-671.212) (-669.972) (-673.719) [-669.218] -- 0:00:34
485000 -- (-670.725) (-672.434) [-671.579] (-669.139) * (-673.815) (-671.821) [-671.978] (-674.676) -- 0:00:33
Average standard deviation of split frequencies: 0.009958
485500 -- (-669.708) (-667.373) [-669.170] (-671.633) * [-674.192] (-670.547) (-671.599) (-673.777) -- 0:00:33
486000 -- (-669.381) (-674.471) [-670.139] (-668.003) * (-670.039) [-672.202] (-672.264) (-668.232) -- 0:00:33
486500 -- (-668.731) [-673.673] (-668.750) (-672.400) * [-671.322] (-669.891) (-670.886) (-667.778) -- 0:00:33
487000 -- (-668.164) [-669.842] (-672.669) (-669.447) * (-669.979) (-674.448) (-671.105) [-670.044] -- 0:00:33
487500 -- (-668.281) (-669.615) (-668.657) [-670.954] * (-671.579) (-670.472) (-671.470) [-667.345] -- 0:00:33
488000 -- [-669.100] (-673.078) (-669.646) (-669.065) * (-673.189) (-672.248) (-670.833) [-669.189] -- 0:00:33
488500 -- (-666.997) [-669.737] (-668.000) (-673.824) * (-671.731) [-673.881] (-671.744) (-669.947) -- 0:00:33
489000 -- [-670.330] (-671.377) (-671.227) (-668.402) * [-671.520] (-673.792) (-670.373) (-671.387) -- 0:00:33
489500 -- (-670.770) (-673.748) [-671.948] (-668.968) * (-670.662) (-671.427) [-668.075] (-670.154) -- 0:00:33
490000 -- (-670.402) (-670.611) (-669.854) [-672.029] * [-672.075] (-668.156) (-673.296) (-671.001) -- 0:00:33
Average standard deviation of split frequencies: 0.010760
490500 -- (-672.699) [-669.281] (-673.336) (-668.105) * (-668.762) (-674.087) [-668.363] (-670.635) -- 0:00:33
491000 -- (-671.318) (-672.184) [-673.047] (-670.698) * (-670.573) [-672.530] (-668.616) (-669.206) -- 0:00:33
491500 -- (-670.428) (-670.530) [-670.957] (-673.606) * (-668.704) (-669.037) (-668.347) [-667.751] -- 0:00:33
492000 -- (-670.415) [-668.179] (-672.425) (-669.584) * (-669.353) (-668.918) [-667.668] (-669.215) -- 0:00:33
492500 -- [-672.596] (-668.928) (-670.745) (-667.643) * (-671.718) (-670.457) [-669.107] (-671.678) -- 0:00:32
493000 -- (-670.671) (-668.915) [-669.535] (-668.770) * (-670.318) (-671.488) [-671.652] (-672.438) -- 0:00:32
493500 -- (-668.741) [-668.199] (-668.791) (-670.513) * (-674.513) (-671.962) [-669.280] (-670.413) -- 0:00:32
494000 -- [-670.527] (-672.285) (-670.978) (-670.178) * (-678.512) (-669.403) [-669.055] (-670.413) -- 0:00:32
494500 -- (-669.758) (-674.557) [-667.572] (-671.084) * [-669.808] (-668.551) (-672.661) (-670.797) -- 0:00:32
495000 -- [-669.597] (-671.434) (-670.549) (-670.606) * (-671.840) (-668.777) [-673.401] (-668.237) -- 0:00:32
Average standard deviation of split frequencies: 0.010518
495500 -- (-670.008) [-670.888] (-668.864) (-668.725) * (-670.783) (-671.406) [-670.199] (-668.719) -- 0:00:32
496000 -- [-669.247] (-669.968) (-669.159) (-674.265) * [-671.316] (-667.632) (-668.153) (-668.971) -- 0:00:32
496500 -- (-668.850) (-672.549) [-669.169] (-670.779) * (-673.166) [-674.004] (-671.976) (-668.987) -- 0:00:32
497000 -- (-668.662) (-674.994) (-671.556) [-670.667] * (-670.772) (-675.697) (-673.123) [-669.795] -- 0:00:32
497500 -- [-667.214] (-669.078) (-670.667) (-667.879) * [-667.905] (-672.334) (-670.235) (-671.708) -- 0:00:32
498000 -- (-668.223) [-671.921] (-669.743) (-667.801) * [-671.799] (-672.475) (-674.261) (-674.475) -- 0:00:32
498500 -- (-669.822) (-672.426) (-669.803) [-667.342] * (-668.972) (-672.276) [-669.660] (-675.421) -- 0:00:32
499000 -- (-669.453) [-675.900] (-671.163) (-668.844) * (-669.638) [-675.634] (-671.747) (-674.734) -- 0:00:32
499500 -- (-668.820) (-673.221) [-669.460] (-669.223) * (-671.068) (-668.810) (-670.748) [-667.406] -- 0:00:33
500000 -- [-673.338] (-673.233) (-673.279) (-669.053) * (-676.092) (-671.517) (-671.634) [-668.628] -- 0:00:33
Average standard deviation of split frequencies: 0.010106
500500 -- [-672.132] (-671.222) (-670.795) (-669.401) * (-678.454) [-670.853] (-671.279) (-670.364) -- 0:00:32
501000 -- [-670.472] (-674.192) (-671.502) (-669.776) * (-673.160) (-673.487) (-671.766) [-671.269] -- 0:00:32
501500 -- (-670.097) (-673.799) [-669.945] (-671.396) * (-670.293) (-670.622) (-668.869) [-670.559] -- 0:00:32
502000 -- (-669.908) (-673.026) (-671.990) [-670.874] * (-672.786) [-671.349] (-668.322) (-670.315) -- 0:00:32
502500 -- [-672.598] (-675.913) (-675.233) (-672.497) * (-668.690) (-670.020) [-667.698] (-669.846) -- 0:00:32
503000 -- (-670.721) (-679.234) (-673.232) [-675.621] * [-671.757] (-670.501) (-670.450) (-673.254) -- 0:00:32
503500 -- (-670.563) (-675.858) [-672.618] (-668.323) * (-669.189) (-670.776) (-670.516) [-670.210] -- 0:00:32
504000 -- [-668.783] (-673.564) (-673.608) (-669.723) * (-672.968) (-670.578) [-671.490] (-670.645) -- 0:00:32
504500 -- (-672.771) [-673.335] (-673.468) (-671.927) * (-674.394) (-670.872) [-669.252] (-667.056) -- 0:00:32
505000 -- (-673.025) [-671.534] (-670.597) (-668.884) * (-671.870) [-669.866] (-676.710) (-671.023) -- 0:00:32
Average standard deviation of split frequencies: 0.010772
505500 -- (-671.575) [-672.556] (-670.637) (-667.719) * (-671.149) (-671.417) [-669.954] (-667.441) -- 0:00:32
506000 -- (-669.587) (-672.867) (-669.188) [-668.645] * (-670.466) (-671.733) (-669.303) [-667.801] -- 0:00:32
506500 -- (-671.183) [-671.362] (-668.800) (-673.323) * [-669.571] (-681.787) (-667.727) (-672.159) -- 0:00:32
507000 -- (-671.600) (-670.403) [-670.424] (-671.828) * [-672.021] (-671.865) (-672.016) (-671.235) -- 0:00:32
507500 -- (-667.967) [-671.811] (-669.836) (-669.370) * [-669.262] (-670.643) (-669.549) (-674.493) -- 0:00:32
508000 -- (-671.844) (-671.105) [-669.903] (-672.100) * (-671.546) [-671.001] (-669.806) (-673.244) -- 0:00:31
508500 -- [-673.253] (-672.554) (-668.478) (-670.362) * (-670.283) [-669.887] (-672.920) (-669.488) -- 0:00:31
509000 -- (-669.090) (-671.681) (-669.410) [-670.497] * (-670.620) (-669.901) [-672.246] (-670.760) -- 0:00:31
509500 -- (-669.355) (-672.871) (-668.685) [-673.564] * (-670.555) (-670.559) (-670.869) [-667.166] -- 0:00:31
510000 -- (-669.327) (-670.225) [-671.141] (-671.689) * [-671.543] (-671.431) (-669.654) (-669.932) -- 0:00:31
Average standard deviation of split frequencies: 0.010031
510500 -- (-671.525) (-671.859) [-671.165] (-670.467) * [-670.422] (-672.502) (-669.869) (-668.518) -- 0:00:31
511000 -- [-671.197] (-671.047) (-674.075) (-674.426) * [-670.878] (-668.923) (-670.004) (-667.504) -- 0:00:31
511500 -- (-673.008) (-674.437) (-671.585) [-668.877] * (-672.869) (-669.282) [-668.749] (-669.448) -- 0:00:31
512000 -- (-671.245) (-670.089) (-669.291) [-670.898] * (-670.302) (-674.107) (-669.531) [-670.806] -- 0:00:31
512500 -- [-670.043] (-669.090) (-670.196) (-672.819) * (-668.647) (-671.288) (-671.501) [-672.430] -- 0:00:31
513000 -- (-668.654) (-672.311) (-669.279) [-671.646] * [-668.428] (-674.580) (-674.272) (-672.946) -- 0:00:31
513500 -- (-673.875) (-669.894) [-668.008] (-671.412) * (-669.411) (-676.292) [-670.214] (-669.911) -- 0:00:31
514000 -- [-669.769] (-670.639) (-669.694) (-670.711) * [-669.776] (-670.945) (-675.058) (-671.541) -- 0:00:31
514500 -- (-671.086) (-671.854) (-670.817) [-671.233] * (-669.373) [-668.911] (-672.688) (-677.431) -- 0:00:31
515000 -- (-670.663) [-669.512] (-671.633) (-669.456) * (-668.613) (-668.832) [-671.695] (-671.436) -- 0:00:32
Average standard deviation of split frequencies: 0.009988
515500 -- (-669.863) [-673.914] (-669.681) (-667.174) * [-671.021] (-669.805) (-673.310) (-672.364) -- 0:00:31
516000 -- (-671.631) (-672.936) [-670.375] (-668.804) * [-670.085] (-670.089) (-672.909) (-671.823) -- 0:00:31
516500 -- (-671.397) (-676.251) [-669.371] (-668.088) * (-669.599) [-669.338] (-673.177) (-669.715) -- 0:00:31
517000 -- (-669.085) (-670.783) (-670.910) [-668.759] * (-669.443) (-671.413) [-669.303] (-672.600) -- 0:00:31
517500 -- (-673.650) (-671.983) (-671.898) [-667.218] * (-668.752) [-671.034] (-670.804) (-674.250) -- 0:00:31
518000 -- (-670.585) (-668.643) (-670.345) [-668.864] * [-669.990] (-671.920) (-671.502) (-673.780) -- 0:00:31
518500 -- (-669.632) (-669.832) (-671.553) [-671.429] * (-671.887) [-672.330] (-672.455) (-676.348) -- 0:00:31
519000 -- (-672.199) (-669.603) (-668.613) [-668.521] * [-667.705] (-671.506) (-672.826) (-671.248) -- 0:00:31
519500 -- (-669.290) (-672.145) (-672.502) [-669.261] * [-670.211] (-674.052) (-672.212) (-670.521) -- 0:00:31
520000 -- (-671.230) (-673.763) [-673.570] (-671.069) * (-671.362) (-672.616) (-670.324) [-669.874] -- 0:00:31
Average standard deviation of split frequencies: 0.010382
520500 -- (-674.688) (-672.820) [-669.600] (-669.248) * (-671.239) [-670.695] (-670.538) (-670.318) -- 0:00:31
521000 -- (-671.354) (-671.800) [-668.712] (-671.153) * (-669.803) (-669.123) (-673.907) [-670.844] -- 0:00:31
521500 -- (-669.984) (-672.415) (-671.703) [-668.393] * (-670.500) (-669.058) [-672.480] (-671.534) -- 0:00:31
522000 -- (-672.404) (-671.754) [-669.499] (-671.203) * [-668.986] (-667.378) (-671.173) (-669.794) -- 0:00:31
522500 -- (-667.326) [-672.613] (-669.579) (-670.944) * [-668.124] (-671.361) (-671.115) (-670.066) -- 0:00:31
523000 -- (-670.707) (-677.315) [-672.708] (-669.144) * (-673.022) (-672.073) [-671.633] (-670.067) -- 0:00:31
523500 -- (-670.514) (-677.514) (-670.780) [-673.018] * [-669.762] (-668.389) (-671.636) (-671.688) -- 0:00:30
524000 -- [-668.313] (-673.436) (-669.359) (-670.186) * (-674.136) (-672.148) (-672.331) [-670.175] -- 0:00:30
524500 -- (-669.012) (-673.147) (-671.006) [-674.571] * (-668.803) (-673.604) (-674.072) [-668.847] -- 0:00:30
525000 -- [-669.314] (-670.948) (-671.821) (-670.962) * (-669.974) [-670.939] (-669.131) (-670.548) -- 0:00:30
Average standard deviation of split frequencies: 0.010698
525500 -- (-672.711) [-668.216] (-669.912) (-671.352) * (-671.292) (-672.100) (-670.895) [-669.534] -- 0:00:30
526000 -- (-670.248) (-668.038) [-669.593] (-674.781) * (-672.063) (-672.684) (-673.828) [-671.251] -- 0:00:30
526500 -- (-670.512) (-670.186) (-669.098) [-671.533] * [-673.498] (-670.078) (-670.424) (-668.778) -- 0:00:30
527000 -- (-668.290) (-672.704) (-672.109) [-670.496] * (-673.096) [-671.115] (-672.596) (-671.144) -- 0:00:30
527500 -- (-667.690) [-667.647] (-673.447) (-668.935) * (-669.842) [-675.012] (-671.375) (-671.144) -- 0:00:30
528000 -- (-679.908) (-671.094) (-669.567) [-669.131] * (-671.650) (-675.899) (-670.920) [-669.697] -- 0:00:30
528500 -- (-670.020) [-673.714] (-671.191) (-671.533) * (-672.898) (-676.277) (-675.210) [-669.839] -- 0:00:30
529000 -- (-675.125) [-671.168] (-670.922) (-676.040) * [-671.138] (-670.792) (-678.999) (-671.449) -- 0:00:30
529500 -- [-668.900] (-671.567) (-673.729) (-669.203) * (-672.149) (-671.864) [-678.369] (-671.065) -- 0:00:30
530000 -- (-669.857) (-670.304) (-670.815) [-670.400] * (-673.118) (-670.391) (-669.669) [-668.712] -- 0:00:30
Average standard deviation of split frequencies: 0.010555
530500 -- (-669.289) (-669.191) [-667.700] (-674.853) * [-672.988] (-670.292) (-675.681) (-671.367) -- 0:00:30
531000 -- [-670.717] (-671.354) (-671.765) (-671.727) * (-671.853) [-670.688] (-672.346) (-670.441) -- 0:00:30
531500 -- (-671.565) (-670.758) (-669.179) [-673.729] * [-672.213] (-672.966) (-671.846) (-673.215) -- 0:00:30
532000 -- (-672.085) [-671.517] (-671.800) (-672.774) * (-671.032) (-669.834) [-671.929] (-670.639) -- 0:00:30
532500 -- [-671.561] (-670.095) (-676.948) (-671.063) * (-669.949) (-671.831) (-672.163) [-674.054] -- 0:00:30
533000 -- (-668.571) (-669.609) (-672.966) [-669.848] * (-671.294) [-672.424] (-672.548) (-669.946) -- 0:00:30
533500 -- (-670.416) (-672.422) (-671.206) [-672.491] * [-672.165] (-675.084) (-672.803) (-669.501) -- 0:00:30
534000 -- [-669.182] (-673.122) (-672.678) (-673.390) * [-671.399] (-670.403) (-674.955) (-669.356) -- 0:00:30
534500 -- (-669.911) [-674.303] (-671.088) (-670.554) * [-669.647] (-670.687) (-671.823) (-673.776) -- 0:00:30
535000 -- [-670.259] (-672.713) (-671.572) (-668.054) * [-671.244] (-671.007) (-671.232) (-673.430) -- 0:00:30
Average standard deviation of split frequencies: 0.010939
535500 -- (-670.290) [-669.877] (-671.851) (-669.182) * (-668.985) (-671.544) [-671.148] (-672.723) -- 0:00:30
536000 -- (-668.525) (-671.084) (-669.070) [-670.369] * (-674.624) [-674.759] (-670.692) (-669.920) -- 0:00:30
536500 -- (-677.037) (-674.533) (-670.232) [-668.595] * (-676.329) (-671.696) [-671.847] (-671.330) -- 0:00:30
537000 -- (-669.292) (-675.690) [-673.593] (-673.925) * (-670.025) (-671.487) (-670.341) [-669.392] -- 0:00:30
537500 -- (-673.037) (-668.697) (-671.948) [-668.729] * (-673.000) (-672.797) (-674.242) [-668.865] -- 0:00:30
538000 -- (-674.730) (-668.269) [-668.093] (-669.008) * (-671.368) [-672.452] (-674.850) (-672.557) -- 0:00:30
538500 -- (-671.438) [-669.608] (-669.398) (-669.010) * (-672.387) (-669.982) [-671.834] (-674.513) -- 0:00:29
539000 -- (-673.900) (-673.099) (-671.242) [-668.825] * (-670.694) (-669.527) (-672.221) [-671.175] -- 0:00:29
539500 -- (-673.919) (-670.038) [-668.683] (-669.992) * [-668.989] (-671.626) (-673.348) (-674.883) -- 0:00:29
540000 -- (-668.287) (-668.385) (-671.096) [-669.580] * (-671.420) [-672.237] (-673.698) (-673.138) -- 0:00:29
Average standard deviation of split frequencies: 0.009649
540500 -- (-672.849) [-669.706] (-668.864) (-671.655) * [-671.466] (-670.132) (-670.963) (-670.537) -- 0:00:29
541000 -- (-669.587) [-668.577] (-671.166) (-670.565) * (-672.264) (-668.557) (-670.526) [-667.420] -- 0:00:29
541500 -- [-668.480] (-670.025) (-674.867) (-670.431) * [-668.186] (-670.621) (-671.576) (-670.540) -- 0:00:29
542000 -- [-668.273] (-668.321) (-670.909) (-669.850) * [-671.514] (-670.679) (-671.892) (-669.318) -- 0:00:29
542500 -- [-668.904] (-671.622) (-669.858) (-670.719) * (-669.912) [-668.126] (-671.846) (-668.255) -- 0:00:29
543000 -- [-670.794] (-668.771) (-669.902) (-671.133) * (-671.535) (-670.633) (-669.277) [-669.864] -- 0:00:29
543500 -- (-674.180) [-668.125] (-670.088) (-669.604) * (-668.898) (-671.199) (-672.652) [-671.487] -- 0:00:29
544000 -- (-671.488) (-672.072) [-668.767] (-668.464) * (-669.060) (-669.874) [-672.514] (-671.072) -- 0:00:29
544500 -- (-673.311) [-670.878] (-668.878) (-669.941) * (-670.070) (-672.632) [-671.328] (-673.116) -- 0:00:29
545000 -- (-670.302) (-671.848) [-671.912] (-670.569) * (-675.904) [-669.326] (-671.540) (-669.167) -- 0:00:29
Average standard deviation of split frequencies: 0.009324
545500 -- [-673.232] (-670.476) (-673.226) (-673.861) * (-671.191) (-672.812) (-673.552) [-671.128] -- 0:00:29
546000 -- (-675.550) [-670.942] (-670.413) (-670.511) * (-670.917) (-673.738) [-669.840] (-673.399) -- 0:00:29
546500 -- (-669.751) (-672.957) [-668.914] (-674.261) * [-671.295] (-671.240) (-673.649) (-669.597) -- 0:00:29
547000 -- [-673.751] (-669.287) (-669.990) (-673.039) * (-671.375) (-676.006) [-670.171] (-671.073) -- 0:00:29
547500 -- (-673.274) (-674.418) [-667.190] (-676.331) * [-672.608] (-670.558) (-670.942) (-671.920) -- 0:00:29
548000 -- (-673.490) [-674.062] (-671.765) (-671.670) * (-672.794) [-671.106] (-674.169) (-670.752) -- 0:00:29
548500 -- (-673.975) (-669.776) (-671.572) [-668.231] * (-676.667) (-670.245) (-675.227) [-669.390] -- 0:00:29
549000 -- (-671.034) [-673.413] (-670.438) (-670.945) * (-674.269) (-674.146) [-669.727] (-674.257) -- 0:00:29
549500 -- [-671.844] (-672.715) (-668.930) (-672.280) * (-671.942) (-673.771) (-668.929) [-674.265] -- 0:00:29
550000 -- (-674.984) [-671.800] (-669.753) (-669.675) * (-670.753) (-671.700) [-672.182] (-672.315) -- 0:00:29
Average standard deviation of split frequencies: 0.010273
550500 -- (-668.470) [-669.284] (-671.383) (-670.156) * (-673.771) (-667.979) [-673.691] (-673.954) -- 0:00:29
551000 -- (-670.611) [-670.873] (-671.248) (-672.716) * (-668.822) [-670.532] (-673.894) (-671.787) -- 0:00:29
551500 -- (-668.920) [-672.175] (-672.277) (-676.850) * (-668.174) (-670.343) (-671.110) [-669.605] -- 0:00:29
552000 -- (-671.738) [-670.211] (-671.821) (-673.088) * (-668.229) (-674.580) [-668.394] (-668.661) -- 0:00:29
552500 -- [-673.078] (-670.988) (-671.652) (-674.878) * (-670.962) [-668.764] (-668.705) (-671.664) -- 0:00:29
553000 -- (-674.465) (-672.466) [-668.367] (-674.698) * (-668.811) (-671.641) (-668.844) [-671.668] -- 0:00:29
553500 -- [-671.816] (-667.889) (-673.990) (-674.065) * [-670.233] (-668.587) (-672.111) (-676.693) -- 0:00:29
554000 -- (-671.872) [-669.568] (-670.612) (-673.975) * (-673.767) (-669.920) [-669.088] (-667.728) -- 0:00:28
554500 -- (-672.948) [-669.202] (-669.074) (-673.666) * (-673.648) [-669.642] (-672.176) (-672.280) -- 0:00:28
555000 -- (-669.955) (-671.997) [-667.873] (-670.557) * (-671.590) (-670.291) (-669.850) [-670.871] -- 0:00:28
Average standard deviation of split frequencies: 0.009856
555500 -- [-669.219] (-671.848) (-674.330) (-668.896) * [-670.713] (-673.212) (-673.603) (-668.333) -- 0:00:28
556000 -- (-669.768) [-669.772] (-671.056) (-671.372) * (-672.274) (-675.537) (-672.411) [-669.844] -- 0:00:28
556500 -- (-668.312) (-669.686) [-671.903] (-670.460) * (-672.673) [-674.541] (-673.306) (-672.585) -- 0:00:28
557000 -- [-670.205] (-669.712) (-670.382) (-668.626) * (-671.041) [-671.903] (-671.800) (-674.716) -- 0:00:28
557500 -- (-670.456) (-673.571) (-671.315) [-670.220] * [-671.530] (-672.677) (-674.427) (-672.110) -- 0:00:28
558000 -- (-674.575) (-670.040) [-670.350] (-674.475) * (-670.106) (-671.737) (-671.486) [-668.637] -- 0:00:28
558500 -- [-673.608] (-670.971) (-671.979) (-674.257) * (-672.208) (-672.846) (-676.799) [-669.800] -- 0:00:28
559000 -- (-670.535) (-671.411) (-671.753) [-672.103] * (-671.760) (-670.239) (-673.624) [-670.841] -- 0:00:28
559500 -- (-668.697) [-668.876] (-671.803) (-668.125) * [-671.943] (-679.120) (-669.344) (-669.026) -- 0:00:28
560000 -- (-668.148) (-677.251) [-672.492] (-673.818) * (-671.806) [-672.180] (-669.686) (-672.847) -- 0:00:28
Average standard deviation of split frequencies: 0.008968
560500 -- (-672.065) [-671.835] (-671.323) (-670.052) * (-673.937) (-671.814) [-671.228] (-670.490) -- 0:00:28
561000 -- (-668.756) (-671.485) (-674.173) [-671.666] * (-672.256) (-672.722) (-671.953) [-670.869] -- 0:00:28
561500 -- [-670.719] (-669.908) (-673.617) (-676.279) * (-673.917) [-668.912] (-672.354) (-669.059) -- 0:00:28
562000 -- (-670.512) (-670.110) [-678.495] (-667.924) * (-669.768) (-671.222) (-670.672) [-672.640] -- 0:00:28
562500 -- (-675.092) [-672.266] (-673.562) (-668.268) * (-672.324) [-671.561] (-669.487) (-671.194) -- 0:00:28
563000 -- (-674.174) (-673.640) [-671.857] (-670.277) * (-671.060) (-669.810) [-676.076] (-671.614) -- 0:00:28
563500 -- (-672.537) (-669.459) [-670.333] (-669.118) * (-668.756) [-670.784] (-670.771) (-672.382) -- 0:00:28
564000 -- (-673.113) (-668.391) [-674.049] (-669.748) * (-675.546) (-672.592) [-671.517] (-674.223) -- 0:00:28
564500 -- (-672.917) (-672.707) (-672.695) [-674.451] * (-670.767) [-671.212] (-670.595) (-674.293) -- 0:00:28
565000 -- [-672.406] (-671.341) (-670.789) (-671.693) * (-669.834) (-673.878) [-668.446] (-670.218) -- 0:00:28
Average standard deviation of split frequencies: 0.009273
565500 -- (-668.896) (-672.079) (-670.201) [-671.128] * [-671.517] (-674.238) (-669.539) (-671.287) -- 0:00:28
566000 -- (-673.575) [-674.704] (-670.013) (-670.168) * (-670.770) (-672.143) [-671.691] (-673.612) -- 0:00:28
566500 -- (-670.822) (-674.646) [-670.749] (-669.890) * (-671.225) (-671.519) [-669.037] (-669.548) -- 0:00:28
567000 -- (-668.056) (-672.097) [-671.418] (-672.704) * [-669.658] (-670.684) (-673.183) (-671.576) -- 0:00:28
567500 -- [-668.631] (-671.458) (-671.076) (-671.356) * [-672.533] (-672.085) (-672.533) (-668.141) -- 0:00:28
568000 -- (-671.085) (-670.803) (-669.431) [-671.819] * (-671.030) (-675.384) (-675.387) [-669.937] -- 0:00:28
568500 -- (-671.721) (-670.486) [-672.509] (-670.786) * (-671.810) (-671.935) [-671.971] (-669.811) -- 0:00:28
569000 -- (-674.834) (-670.389) [-667.870] (-670.839) * (-671.847) [-669.825] (-670.936) (-672.723) -- 0:00:28
569500 -- (-672.037) [-671.484] (-668.377) (-671.186) * (-671.785) (-671.668) (-673.131) [-672.938] -- 0:00:27
570000 -- (-673.160) [-671.236] (-671.652) (-672.415) * [-668.810] (-671.837) (-671.439) (-671.978) -- 0:00:27
Average standard deviation of split frequencies: 0.009362
570500 -- (-671.894) (-671.055) (-669.754) [-671.113] * (-670.155) (-671.505) (-669.137) [-670.285] -- 0:00:27
571000 -- (-671.054) (-669.936) (-671.958) [-672.514] * (-670.810) [-673.285] (-669.889) (-672.708) -- 0:00:27
571500 -- [-670.076] (-671.794) (-672.890) (-672.210) * (-672.357) (-669.592) (-676.106) [-672.265] -- 0:00:27
572000 -- (-670.484) (-673.519) (-671.368) [-672.374] * (-668.329) (-673.953) [-674.060] (-673.076) -- 0:00:27
572500 -- (-671.116) (-675.230) [-670.562] (-670.596) * [-668.440] (-671.972) (-671.563) (-672.483) -- 0:00:27
573000 -- (-671.343) (-672.035) [-672.327] (-670.168) * (-673.710) [-672.431] (-673.375) (-671.511) -- 0:00:27
573500 -- (-670.918) (-668.532) [-672.368] (-668.935) * [-672.555] (-671.129) (-676.202) (-669.583) -- 0:00:27
574000 -- (-674.292) [-671.125] (-671.116) (-672.385) * (-672.034) (-675.368) [-675.122] (-671.866) -- 0:00:27
574500 -- (-670.192) (-671.742) [-671.687] (-671.648) * [-670.636] (-672.214) (-675.545) (-670.639) -- 0:00:27
575000 -- (-671.193) (-670.690) (-670.926) [-669.401] * (-671.726) [-670.742] (-671.554) (-671.567) -- 0:00:27
Average standard deviation of split frequencies: 0.010332
575500 -- (-672.278) (-671.050) (-670.172) [-668.632] * (-669.704) (-671.471) [-671.341] (-671.389) -- 0:00:27
576000 -- (-672.682) (-669.633) [-668.888] (-670.816) * (-675.123) [-672.956] (-671.549) (-669.999) -- 0:00:27
576500 -- (-671.535) (-670.441) (-676.514) [-671.658] * (-674.096) [-672.535] (-670.762) (-672.506) -- 0:00:27
577000 -- (-672.313) (-672.822) [-670.967] (-669.929) * [-672.452] (-673.976) (-671.873) (-673.086) -- 0:00:27
577500 -- (-671.143) (-673.272) [-666.355] (-673.905) * (-671.195) [-671.554] (-671.466) (-670.792) -- 0:00:27
578000 -- (-671.638) [-672.248] (-670.360) (-670.747) * [-670.307] (-671.335) (-671.088) (-669.613) -- 0:00:27
578500 -- (-670.495) (-670.264) (-672.935) [-670.769] * (-672.167) [-669.823] (-670.565) (-672.209) -- 0:00:27
579000 -- (-670.715) (-674.202) [-670.977] (-673.272) * (-675.002) [-670.503] (-669.677) (-672.762) -- 0:00:27
579500 -- (-670.589) (-670.641) (-669.155) [-668.307] * (-675.097) (-669.854) [-672.306] (-674.736) -- 0:00:27
580000 -- (-670.127) (-674.769) (-670.438) [-675.430] * [-673.739] (-674.400) (-672.242) (-671.342) -- 0:00:27
Average standard deviation of split frequencies: 0.009894
580500 -- (-672.063) [-670.569] (-679.712) (-673.416) * (-670.826) (-673.328) [-669.172] (-672.711) -- 0:00:27
581000 -- (-669.655) (-668.945) (-672.349) [-670.729] * (-671.433) (-670.977) [-668.110] (-669.393) -- 0:00:27
581500 -- [-669.125] (-668.797) (-675.307) (-672.445) * (-671.404) [-670.872] (-672.798) (-669.716) -- 0:00:27
582000 -- (-670.965) [-671.430] (-670.414) (-676.491) * (-670.627) (-670.755) [-670.090] (-669.669) -- 0:00:27
582500 -- (-669.394) (-672.622) (-671.254) [-673.569] * (-672.704) (-671.009) [-669.094] (-673.455) -- 0:00:27
583000 -- (-668.048) [-672.471] (-672.186) (-673.705) * (-671.502) [-668.350] (-670.820) (-674.236) -- 0:00:27
583500 -- (-670.270) [-671.816] (-672.735) (-670.582) * (-672.098) [-672.277] (-669.266) (-675.463) -- 0:00:27
584000 -- (-670.204) (-670.023) (-674.428) [-671.584] * (-671.798) (-668.240) (-670.187) [-670.290] -- 0:00:27
584500 -- (-668.643) [-672.735] (-668.886) (-671.272) * (-673.164) (-671.196) [-670.998] (-672.820) -- 0:00:27
585000 -- (-671.586) [-672.943] (-669.457) (-670.669) * (-674.837) [-668.935] (-671.153) (-671.209) -- 0:00:26
Average standard deviation of split frequencies: 0.009603
585500 -- (-671.292) [-670.738] (-671.067) (-667.873) * (-671.412) (-673.114) [-670.597] (-669.378) -- 0:00:26
586000 -- (-675.793) [-673.894] (-670.471) (-672.001) * [-677.394] (-671.866) (-673.489) (-670.480) -- 0:00:26
586500 -- (-675.043) [-672.389] (-668.261) (-670.367) * (-673.538) (-669.841) [-669.986] (-670.004) -- 0:00:26
587000 -- [-670.416] (-673.720) (-670.992) (-668.646) * [-671.178] (-674.041) (-668.840) (-671.173) -- 0:00:26
587500 -- (-670.583) (-674.240) (-671.582) [-667.410] * (-672.569) (-670.315) (-670.684) [-670.479] -- 0:00:26
588000 -- (-673.967) [-671.595] (-670.248) (-676.924) * (-671.058) (-667.838) [-669.767] (-668.745) -- 0:00:26
588500 -- (-670.501) [-671.330] (-672.084) (-671.262) * (-669.762) [-670.271] (-670.005) (-670.197) -- 0:00:26
589000 -- [-671.501] (-672.334) (-671.284) (-669.229) * [-670.202] (-671.068) (-670.068) (-667.702) -- 0:00:26
589500 -- [-669.779] (-672.261) (-669.045) (-670.450) * (-675.511) (-668.202) [-668.986] (-669.660) -- 0:00:26
590000 -- (-670.546) (-672.503) (-668.727) [-668.656] * (-672.901) (-668.941) (-670.529) [-672.017] -- 0:00:26
Average standard deviation of split frequencies: 0.008194
590500 -- (-670.773) [-671.885] (-671.997) (-669.498) * (-672.840) [-671.764] (-670.033) (-672.526) -- 0:00:26
591000 -- (-669.967) (-676.220) [-670.602] (-667.131) * (-669.370) (-672.708) [-667.547] (-673.479) -- 0:00:26
591500 -- (-671.227) (-668.579) (-672.138) [-670.160] * (-670.800) (-669.017) (-670.691) [-670.953] -- 0:00:26
592000 -- (-670.967) (-672.342) (-671.308) [-670.135] * (-670.993) [-669.014] (-670.802) (-670.544) -- 0:00:26
592500 -- (-670.833) (-671.154) [-670.997] (-677.689) * (-668.707) [-671.786] (-671.898) (-672.038) -- 0:00:26
593000 -- [-669.607] (-669.736) (-671.201) (-669.566) * (-671.960) (-674.520) (-671.023) [-672.581] -- 0:00:26
593500 -- [-670.649] (-671.433) (-673.656) (-668.814) * (-669.676) [-675.681] (-672.769) (-671.975) -- 0:00:26
594000 -- (-670.551) (-671.288) (-672.724) [-667.160] * (-671.696) (-670.779) [-671.220] (-672.962) -- 0:00:26
594500 -- (-670.103) (-675.822) (-671.487) [-667.389] * (-672.634) [-671.787] (-671.461) (-670.410) -- 0:00:26
595000 -- [-670.671] (-669.765) (-672.876) (-676.986) * (-669.644) [-671.495] (-671.916) (-669.774) -- 0:00:26
Average standard deviation of split frequencies: 0.008173
595500 -- (-674.540) (-669.211) [-669.300] (-672.356) * (-670.199) (-669.736) (-675.291) [-669.603] -- 0:00:26
596000 -- (-672.612) (-672.408) (-670.108) [-669.861] * (-669.167) (-671.532) (-675.144) [-672.652] -- 0:00:26
596500 -- (-672.340) (-668.708) [-669.905] (-671.400) * (-670.992) (-673.091) [-668.740] (-671.406) -- 0:00:26
597000 -- (-671.993) [-668.580] (-672.070) (-672.207) * (-672.620) (-673.464) (-668.495) [-670.766] -- 0:00:26
597500 -- (-672.141) [-670.817] (-671.713) (-669.354) * (-668.475) (-668.791) [-671.273] (-673.368) -- 0:00:26
598000 -- (-674.180) (-671.361) (-671.055) [-668.968] * (-670.761) (-669.207) (-676.962) [-670.513] -- 0:00:26
598500 -- (-670.455) (-673.181) (-670.362) [-669.079] * [-668.692] (-668.716) (-671.004) (-672.647) -- 0:00:26
599000 -- (-671.427) (-673.161) (-671.888) [-669.467] * (-673.865) (-669.738) (-669.461) [-669.526] -- 0:00:26
599500 -- (-668.638) (-671.756) (-670.788) [-671.844] * (-670.333) (-671.958) (-672.811) [-668.999] -- 0:00:26
600000 -- (-674.321) [-670.250] (-669.411) (-671.841) * [-667.667] (-670.374) (-671.238) (-671.420) -- 0:00:25
Average standard deviation of split frequencies: 0.008535
600500 -- (-674.550) (-669.316) (-670.567) [-672.312] * (-669.782) (-669.288) [-668.080] (-675.033) -- 0:00:25
601000 -- (-670.736) (-669.558) (-670.308) [-670.550] * [-671.224] (-671.951) (-668.670) (-672.488) -- 0:00:25
601500 -- (-671.293) [-668.575] (-671.651) (-668.944) * (-673.491) (-670.152) (-668.374) [-673.587] -- 0:00:25
602000 -- (-671.340) [-672.087] (-670.337) (-674.636) * (-668.187) [-669.284] (-671.935) (-674.274) -- 0:00:25
602500 -- [-670.774] (-675.205) (-671.063) (-671.012) * (-671.874) (-669.200) (-671.246) [-670.159] -- 0:00:25
603000 -- (-672.256) (-675.946) (-669.764) [-669.608] * [-670.526] (-669.145) (-672.012) (-673.810) -- 0:00:25
603500 -- (-672.386) (-672.101) (-670.826) [-668.517] * (-667.642) (-669.335) (-671.487) [-673.011] -- 0:00:25
604000 -- (-673.429) (-670.545) [-672.698] (-667.951) * [-668.978] (-670.712) (-670.775) (-669.809) -- 0:00:25
604500 -- (-671.759) (-669.282) [-669.315] (-669.158) * [-669.401] (-669.778) (-670.194) (-671.397) -- 0:00:25
605000 -- (-669.369) (-671.280) [-668.508] (-669.860) * (-671.649) [-670.918] (-670.737) (-670.961) -- 0:00:25
Average standard deviation of split frequencies: 0.008654
605500 -- (-669.942) [-670.340] (-669.510) (-667.998) * (-673.708) (-669.019) [-675.537] (-670.995) -- 0:00:25
606000 -- [-670.832] (-671.913) (-671.352) (-669.085) * (-671.339) [-668.320] (-670.273) (-667.586) -- 0:00:25
606500 -- [-671.963] (-671.948) (-669.302) (-672.922) * [-668.267] (-671.210) (-669.323) (-669.156) -- 0:00:25
607000 -- (-669.710) (-673.558) [-670.552] (-672.176) * (-669.525) (-670.470) (-670.515) [-668.411] -- 0:00:25
607500 -- [-671.091] (-670.736) (-670.437) (-671.564) * [-669.946] (-666.690) (-670.457) (-671.371) -- 0:00:25
608000 -- [-672.234] (-672.334) (-670.193) (-677.544) * (-670.141) (-673.783) (-671.925) [-674.068] -- 0:00:25
608500 -- (-674.558) [-668.362] (-670.701) (-672.062) * (-670.029) (-670.169) [-668.752] (-672.633) -- 0:00:25
609000 -- (-673.141) (-670.685) [-674.227] (-675.225) * (-671.524) [-670.015] (-671.471) (-672.647) -- 0:00:25
609500 -- [-673.390] (-672.336) (-670.633) (-668.112) * (-672.192) (-670.871) (-668.944) [-673.326] -- 0:00:25
610000 -- (-670.277) (-674.319) (-672.806) [-673.603] * [-672.505] (-671.943) (-667.595) (-668.291) -- 0:00:25
Average standard deviation of split frequencies: 0.008009
610500 -- [-670.102] (-670.356) (-671.177) (-669.141) * (-672.438) (-669.406) [-669.518] (-670.531) -- 0:00:25
611000 -- [-671.193] (-673.158) (-670.737) (-670.240) * (-673.681) (-669.630) [-667.954] (-670.366) -- 0:00:25
611500 -- (-670.138) [-668.301] (-671.230) (-671.963) * (-674.187) (-676.019) (-671.242) [-670.479] -- 0:00:25
612000 -- [-672.069] (-672.641) (-669.497) (-672.741) * (-668.941) [-669.054] (-668.134) (-669.682) -- 0:00:25
612500 -- (-671.958) (-670.236) (-668.391) [-669.910] * (-669.292) (-668.081) (-669.994) [-668.793] -- 0:00:25
613000 -- (-671.145) (-670.845) (-668.446) [-671.322] * [-670.924] (-669.664) (-674.679) (-673.950) -- 0:00:25
613500 -- [-671.653] (-676.203) (-673.706) (-670.708) * (-670.832) (-672.688) [-668.933] (-668.978) -- 0:00:25
614000 -- (-671.467) (-677.287) [-672.204] (-669.522) * (-669.981) (-672.047) (-667.875) [-669.105] -- 0:00:25
614500 -- [-671.000] (-675.164) (-668.842) (-667.417) * [-672.091] (-669.137) (-668.280) (-669.902) -- 0:00:25
615000 -- (-673.309) (-675.133) (-667.803) [-672.492] * (-672.142) (-672.806) (-670.386) [-670.229] -- 0:00:25
Average standard deviation of split frequencies: 0.008083
615500 -- (-669.927) (-671.451) [-668.015] (-673.550) * [-669.643] (-667.494) (-670.857) (-671.721) -- 0:00:24
616000 -- (-673.635) [-675.103] (-667.443) (-671.102) * [-668.991] (-669.180) (-672.155) (-670.380) -- 0:00:24
616500 -- (-668.279) (-671.522) (-669.072) [-671.849] * (-673.372) (-672.059) [-668.118] (-667.350) -- 0:00:24
617000 -- (-669.509) [-674.923] (-669.148) (-671.120) * [-669.989] (-673.539) (-671.462) (-669.391) -- 0:00:24
617500 -- (-672.508) [-675.200] (-668.845) (-669.124) * (-668.326) (-669.079) (-668.946) [-668.722] -- 0:00:24
618000 -- (-670.576) (-669.791) [-667.575] (-673.041) * [-669.832] (-670.330) (-671.253) (-669.117) -- 0:00:24
618500 -- (-671.975) (-673.352) [-671.329] (-672.590) * (-674.652) (-675.424) [-671.487] (-669.150) -- 0:00:24
619000 -- (-669.256) (-669.313) (-670.577) [-670.614] * [-672.202] (-671.325) (-671.858) (-674.491) -- 0:00:24
619500 -- (-673.597) (-670.665) (-671.581) [-671.967] * [-668.999] (-677.461) (-670.659) (-670.983) -- 0:00:24
620000 -- (-671.309) (-671.079) (-671.192) [-671.725] * [-672.388] (-669.068) (-672.700) (-668.442) -- 0:00:24
Average standard deviation of split frequencies: 0.006937
620500 -- (-670.154) [-669.321] (-669.221) (-676.754) * [-672.961] (-669.801) (-670.699) (-669.530) -- 0:00:24
621000 -- (-669.693) (-668.938) (-672.730) [-670.637] * [-671.169] (-667.924) (-670.757) (-670.627) -- 0:00:24
621500 -- (-670.338) (-671.142) (-669.960) [-670.145] * (-674.960) [-669.924] (-668.056) (-675.678) -- 0:00:24
622000 -- (-671.462) (-671.585) (-672.276) [-668.730] * [-670.960] (-670.327) (-669.198) (-671.718) -- 0:00:24
622500 -- (-668.973) (-670.563) (-670.541) [-671.856] * (-671.581) (-672.792) (-671.941) [-670.594] -- 0:00:24
623000 -- (-667.653) (-669.360) (-673.927) [-673.161] * (-675.725) [-672.196] (-670.405) (-671.632) -- 0:00:24
623500 -- (-672.071) (-671.010) (-668.871) [-668.503] * (-672.108) (-670.927) [-670.909] (-669.032) -- 0:00:24
624000 -- (-671.821) [-672.943] (-670.025) (-669.976) * (-669.922) (-671.043) (-673.893) [-672.071] -- 0:00:24
624500 -- (-671.567) (-669.845) (-675.436) [-668.924] * (-673.178) (-668.111) (-672.622) [-667.432] -- 0:00:24
625000 -- [-670.230] (-670.582) (-670.720) (-668.200) * (-672.456) (-671.716) [-669.795] (-668.521) -- 0:00:24
Average standard deviation of split frequencies: 0.006878
625500 -- [-671.400] (-671.615) (-672.905) (-670.716) * (-669.870) (-670.459) [-670.134] (-673.300) -- 0:00:24
626000 -- (-675.837) [-670.406] (-672.335) (-672.272) * (-672.642) (-671.224) (-669.029) [-669.831] -- 0:00:24
626500 -- [-676.643] (-673.535) (-670.312) (-673.387) * (-671.557) (-672.404) (-671.882) [-671.242] -- 0:00:24
627000 -- (-676.034) (-671.725) (-671.236) [-672.435] * [-671.379] (-672.181) (-670.695) (-672.568) -- 0:00:24
627500 -- (-673.469) [-670.494] (-669.974) (-672.619) * (-670.202) [-673.381] (-681.054) (-671.306) -- 0:00:24
628000 -- (-671.611) (-669.576) (-670.132) [-670.398] * (-670.197) (-673.606) [-673.882] (-671.264) -- 0:00:24
628500 -- (-672.717) (-669.089) (-670.661) [-669.667] * (-669.240) (-670.705) (-669.467) [-670.998] -- 0:00:24
629000 -- [-670.888] (-671.721) (-668.219) (-672.427) * [-671.830] (-671.301) (-673.350) (-671.277) -- 0:00:24
629500 -- [-672.289] (-669.512) (-668.998) (-672.442) * (-671.753) (-670.899) (-670.148) [-673.347] -- 0:00:24
630000 -- (-672.124) (-674.305) [-673.240] (-670.950) * (-670.806) (-671.692) (-671.710) [-671.693] -- 0:00:24
Average standard deviation of split frequencies: 0.007288
630500 -- (-673.512) [-670.441] (-672.687) (-674.676) * (-668.971) (-672.688) [-669.927] (-671.102) -- 0:00:24
631000 -- (-671.396) [-670.601] (-673.260) (-671.542) * (-670.872) [-676.682] (-671.202) (-670.896) -- 0:00:23
631500 -- (-668.738) [-670.216] (-671.058) (-672.201) * (-671.580) (-675.068) (-674.250) [-672.106] -- 0:00:23
632000 -- (-672.389) [-667.931] (-678.498) (-672.399) * (-670.726) (-670.776) (-673.862) [-669.568] -- 0:00:23
632500 -- (-672.784) [-670.619] (-671.171) (-672.760) * [-670.278] (-672.094) (-672.460) (-669.674) -- 0:00:23
633000 -- (-672.706) (-670.960) (-670.840) [-670.346] * (-668.638) (-672.557) (-670.186) [-669.055] -- 0:00:23
633500 -- (-671.862) (-667.169) (-670.579) [-670.217] * [-668.373] (-674.634) (-672.367) (-669.513) -- 0:00:23
634000 -- (-670.101) [-669.756] (-670.581) (-672.370) * (-668.943) (-673.867) (-670.856) [-672.115] -- 0:00:23
634500 -- [-668.091] (-669.836) (-671.548) (-673.262) * (-670.714) [-672.429] (-670.686) (-674.691) -- 0:00:23
635000 -- (-673.357) (-671.870) [-672.521] (-679.864) * (-675.573) [-672.643] (-670.480) (-672.644) -- 0:00:23
Average standard deviation of split frequencies: 0.007458
635500 -- [-669.519] (-671.860) (-670.391) (-679.308) * (-674.710) (-672.000) [-669.624] (-671.626) -- 0:00:23
636000 -- (-670.833) (-668.035) [-672.586] (-672.331) * (-669.684) [-669.517] (-670.934) (-671.384) -- 0:00:23
636500 -- (-671.760) (-672.730) [-668.915] (-676.462) * (-676.077) (-673.499) (-669.293) [-672.504] -- 0:00:23
637000 -- (-670.292) (-669.430) (-671.046) [-673.031] * (-673.367) (-675.545) (-670.782) [-671.103] -- 0:00:23
637500 -- (-671.406) [-668.855] (-670.100) (-671.234) * (-672.888) (-673.432) [-672.009] (-671.186) -- 0:00:23
638000 -- [-669.665] (-668.623) (-673.625) (-672.275) * (-672.751) (-672.628) (-675.408) [-672.723] -- 0:00:23
638500 -- (-669.163) [-670.421] (-669.108) (-676.247) * [-672.055] (-671.567) (-672.819) (-672.679) -- 0:00:23
639000 -- (-671.725) (-670.529) [-671.532] (-672.845) * (-669.386) (-671.877) [-668.668] (-670.167) -- 0:00:23
639500 -- (-669.228) (-671.063) [-669.696] (-672.282) * (-670.583) (-672.233) (-670.072) [-671.305] -- 0:00:23
640000 -- [-670.912] (-670.893) (-669.917) (-673.266) * (-671.661) (-670.617) (-675.981) [-672.106] -- 0:00:23
Average standard deviation of split frequencies: 0.007082
640500 -- [-670.108] (-672.769) (-671.448) (-669.983) * [-670.424] (-670.931) (-668.462) (-673.570) -- 0:00:23
641000 -- (-672.656) (-676.160) [-670.640] (-672.109) * (-675.171) (-671.931) [-672.190] (-672.323) -- 0:00:23
641500 -- (-668.831) (-671.125) [-671.237] (-675.891) * [-670.394] (-673.902) (-668.310) (-670.947) -- 0:00:23
642000 -- (-671.114) [-671.398] (-669.711) (-671.265) * [-669.883] (-677.490) (-667.952) (-670.509) -- 0:00:23
642500 -- (-672.070) (-672.328) (-674.450) [-673.408] * [-668.540] (-670.770) (-669.687) (-671.912) -- 0:00:23
643000 -- (-671.933) (-672.430) [-671.251] (-671.011) * [-671.942] (-670.169) (-670.158) (-671.967) -- 0:00:23
643500 -- (-670.480) [-672.175] (-670.919) (-668.668) * [-673.032] (-668.626) (-671.569) (-671.527) -- 0:00:23
644000 -- (-670.746) [-670.269] (-669.484) (-670.790) * (-670.116) [-670.159] (-671.342) (-671.813) -- 0:00:23
644500 -- (-670.886) [-669.887] (-669.872) (-668.657) * (-669.130) (-673.190) (-667.966) [-671.556] -- 0:00:23
645000 -- [-670.054] (-670.948) (-669.676) (-671.402) * [-669.598] (-674.180) (-668.463) (-668.149) -- 0:00:23
Average standard deviation of split frequencies: 0.007024
645500 -- (-673.698) (-671.890) [-671.650] (-675.307) * (-668.347) (-669.207) [-670.061] (-671.385) -- 0:00:23
646000 -- (-669.399) (-670.310) (-672.654) [-671.901] * (-668.787) (-673.488) [-671.851] (-671.975) -- 0:00:23
646500 -- (-668.423) (-671.035) [-668.556] (-670.423) * (-669.477) [-672.446] (-671.431) (-668.764) -- 0:00:22
647000 -- (-669.310) (-670.781) [-670.988] (-669.524) * [-672.896] (-673.131) (-668.869) (-672.191) -- 0:00:22
647500 -- (-670.440) [-671.043] (-674.724) (-672.319) * [-668.499] (-671.814) (-673.010) (-668.675) -- 0:00:22
648000 -- (-670.386) (-676.579) (-670.708) [-668.881] * (-670.448) (-668.207) (-673.777) [-669.367] -- 0:00:22
648500 -- (-673.101) [-672.170] (-670.479) (-670.434) * (-671.757) (-672.300) (-670.851) [-667.715] -- 0:00:22
649000 -- (-675.045) [-672.038] (-670.917) (-669.703) * (-671.304) [-672.177] (-672.017) (-668.519) -- 0:00:22
649500 -- (-673.096) (-669.172) [-670.315] (-668.377) * (-669.794) (-668.532) (-672.434) [-673.580] -- 0:00:22
650000 -- (-671.408) (-674.010) [-670.652] (-672.834) * [-669.936] (-672.327) (-669.181) (-673.297) -- 0:00:22
Average standard deviation of split frequencies: 0.006762
650500 -- (-670.635) [-670.540] (-670.163) (-668.198) * (-670.259) (-667.980) [-670.579] (-672.550) -- 0:00:22
651000 -- [-670.689] (-672.578) (-669.745) (-676.632) * [-669.398] (-671.065) (-673.579) (-670.735) -- 0:00:22
651500 -- (-673.695) [-669.103] (-669.376) (-674.455) * [-672.420] (-669.878) (-676.025) (-672.158) -- 0:00:22
652000 -- (-673.099) (-671.499) (-670.178) [-670.204] * (-669.696) (-672.870) (-672.808) [-670.508] -- 0:00:22
652500 -- (-670.429) (-670.825) [-671.049] (-668.442) * (-669.815) (-669.106) [-673.010] (-671.598) -- 0:00:22
653000 -- (-674.414) (-671.505) [-670.760] (-669.913) * (-675.640) [-672.960] (-669.765) (-671.536) -- 0:00:22
653500 -- (-673.351) [-673.357] (-672.219) (-670.556) * (-673.251) [-669.406] (-675.133) (-670.984) -- 0:00:22
654000 -- (-673.776) (-671.113) [-672.613] (-669.745) * (-667.215) (-666.955) (-671.032) [-673.768] -- 0:00:22
654500 -- (-674.710) (-672.383) [-670.952] (-669.480) * (-669.050) [-669.404] (-672.014) (-673.221) -- 0:00:22
655000 -- (-677.210) (-670.706) (-672.867) [-673.641] * (-669.462) (-669.580) (-671.169) [-669.438] -- 0:00:22
Average standard deviation of split frequencies: 0.006036
655500 -- (-669.725) (-672.051) [-672.085] (-670.968) * (-671.420) (-669.847) (-672.691) [-670.050] -- 0:00:22
656000 -- (-671.942) (-670.712) (-673.207) [-670.069] * (-672.959) (-668.438) (-669.303) [-668.163] -- 0:00:22
656500 -- (-674.199) [-671.504] (-671.582) (-672.282) * (-669.742) (-669.708) (-671.776) [-673.661] -- 0:00:22
657000 -- (-671.136) (-671.018) (-669.657) [-671.780] * [-669.211] (-671.135) (-675.872) (-668.266) -- 0:00:22
657500 -- (-674.010) (-670.163) [-669.869] (-672.626) * (-671.662) [-669.852] (-670.436) (-669.981) -- 0:00:22
658000 -- [-672.456] (-669.854) (-671.858) (-671.125) * (-672.271) (-668.161) (-686.977) [-671.200] -- 0:00:22
658500 -- [-669.288] (-670.438) (-675.726) (-669.411) * (-671.293) (-670.371) (-672.041) [-672.816] -- 0:00:22
659000 -- (-670.919) [-668.618] (-669.723) (-673.103) * (-668.710) (-669.786) (-672.029) [-671.321] -- 0:00:22
659500 -- (-670.383) [-673.869] (-669.325) (-668.783) * (-673.728) (-673.920) (-669.335) [-668.568] -- 0:00:22
660000 -- (-670.005) (-673.521) [-667.835] (-673.068) * (-668.576) (-672.145) (-671.654) [-672.222] -- 0:00:22
Average standard deviation of split frequencies: 0.006136
660500 -- (-669.661) (-673.908) (-671.851) [-671.152] * (-671.872) [-673.012] (-671.230) (-672.964) -- 0:00:22
661000 -- (-671.471) (-669.254) (-673.658) [-669.444] * (-670.667) (-671.950) [-668.969] (-673.115) -- 0:00:22
661500 -- (-670.017) (-671.028) [-671.253] (-671.724) * (-671.169) [-672.902] (-671.054) (-671.488) -- 0:00:22
662000 -- (-672.043) (-669.826) [-671.603] (-670.241) * (-668.917) (-672.850) (-673.599) [-671.705] -- 0:00:21
662500 -- (-671.362) (-675.116) [-670.196] (-672.425) * (-671.936) (-673.582) (-671.271) [-668.811] -- 0:00:21
663000 -- [-669.456] (-677.586) (-668.406) (-671.066) * (-673.445) (-668.066) [-671.062] (-671.724) -- 0:00:21
663500 -- [-668.818] (-668.118) (-668.455) (-670.334) * [-673.169] (-669.849) (-672.373) (-671.796) -- 0:00:21
664000 -- [-671.470] (-669.794) (-672.954) (-670.317) * (-668.391) (-671.391) [-669.098] (-668.286) -- 0:00:21
664500 -- (-670.840) (-672.319) (-675.529) [-668.263] * (-671.687) (-670.616) (-671.156) [-668.811] -- 0:00:21
665000 -- (-674.040) (-671.976) [-669.724] (-676.598) * (-671.141) [-670.996] (-671.438) (-671.978) -- 0:00:21
Average standard deviation of split frequencies: 0.006857
665500 -- (-672.633) [-670.576] (-674.589) (-671.859) * (-671.003) (-671.780) [-670.119] (-669.106) -- 0:00:21
666000 -- (-671.768) (-673.412) [-670.843] (-668.605) * [-670.194] (-670.069) (-673.314) (-667.876) -- 0:00:21
666500 -- [-667.936] (-671.341) (-673.191) (-667.791) * (-667.624) [-674.799] (-673.490) (-670.991) -- 0:00:21
667000 -- (-668.348) [-670.722] (-670.559) (-671.742) * [-675.118] (-677.099) (-669.048) (-670.785) -- 0:00:21
667500 -- (-671.693) (-671.312) (-673.169) [-668.904] * [-670.080] (-671.551) (-671.203) (-670.569) -- 0:00:21
668000 -- [-669.534] (-674.485) (-669.545) (-672.862) * (-671.299) (-674.011) (-669.679) [-669.712] -- 0:00:21
668500 -- (-670.126) [-669.363] (-670.580) (-670.452) * [-671.641] (-675.334) (-669.742) (-669.878) -- 0:00:21
669000 -- (-672.212) (-672.108) [-671.705] (-671.546) * [-670.161] (-672.687) (-669.286) (-672.141) -- 0:00:21
669500 -- [-671.758] (-668.589) (-672.409) (-669.692) * [-668.753] (-675.240) (-671.309) (-669.499) -- 0:00:21
670000 -- (-669.470) (-669.091) [-671.974] (-669.726) * (-669.237) (-675.615) [-671.504] (-669.516) -- 0:00:21
Average standard deviation of split frequencies: 0.007380
670500 -- (-667.816) [-669.474] (-673.749) (-670.791) * [-670.155] (-674.212) (-673.409) (-668.889) -- 0:00:21
671000 -- (-671.411) (-672.796) (-671.345) [-668.928] * (-671.512) (-672.612) [-668.253] (-670.416) -- 0:00:21
671500 -- (-669.799) [-669.056] (-668.971) (-675.892) * (-670.895) (-674.579) [-674.792] (-669.663) -- 0:00:21
672000 -- (-668.594) (-670.010) [-668.365] (-673.808) * [-672.744] (-670.264) (-668.723) (-672.683) -- 0:00:21
672500 -- (-674.026) (-669.807) [-671.087] (-668.394) * [-670.812] (-668.902) (-667.354) (-670.357) -- 0:00:21
673000 -- (-669.862) [-671.089] (-669.523) (-671.446) * (-672.416) (-668.902) [-670.187] (-672.230) -- 0:00:21
673500 -- (-669.290) [-670.699] (-672.261) (-670.577) * [-669.010] (-672.856) (-672.043) (-671.564) -- 0:00:21
674000 -- (-675.859) (-671.887) (-673.042) [-672.013] * (-671.044) [-673.298] (-670.109) (-673.223) -- 0:00:21
674500 -- [-671.105] (-673.411) (-672.654) (-671.555) * (-678.136) (-678.861) [-669.509] (-672.475) -- 0:00:21
675000 -- (-672.034) (-670.837) (-671.209) [-667.939] * (-671.729) [-671.848] (-669.378) (-673.563) -- 0:00:21
Average standard deviation of split frequencies: 0.006834
675500 -- (-669.662) (-669.901) [-671.323] (-668.084) * [-671.300] (-674.029) (-670.321) (-675.401) -- 0:00:21
676000 -- (-670.017) [-670.824] (-669.870) (-667.471) * (-670.761) (-671.258) (-668.961) [-672.659] -- 0:00:21
676500 -- (-669.591) [-675.049] (-670.699) (-668.273) * (-673.386) (-673.543) [-670.599] (-672.763) -- 0:00:21
677000 -- (-673.773) (-671.946) [-669.962] (-671.145) * (-669.981) [-671.211] (-672.781) (-674.343) -- 0:00:20
677500 -- (-673.681) [-669.649] (-672.401) (-671.739) * (-671.998) (-673.242) (-670.146) [-672.248] -- 0:00:20
678000 -- (-674.627) (-669.289) (-669.804) [-672.705] * (-672.610) [-670.506] (-671.735) (-668.620) -- 0:00:20
678500 -- [-670.325] (-673.485) (-669.894) (-671.396) * [-671.687] (-668.936) (-668.931) (-673.342) -- 0:00:20
679000 -- [-673.084] (-670.092) (-670.177) (-670.956) * (-672.628) [-670.065] (-669.620) (-679.718) -- 0:00:20
679500 -- (-671.491) (-670.945) (-669.057) [-669.580] * (-670.725) (-675.244) (-671.147) [-676.676] -- 0:00:20
680000 -- (-672.168) (-670.982) [-669.073] (-668.823) * (-671.886) (-675.864) (-670.604) [-671.478] -- 0:00:20
Average standard deviation of split frequencies: 0.006787
680500 -- (-670.503) (-671.963) (-669.760) [-669.748] * (-669.935) (-669.520) [-674.093] (-673.152) -- 0:00:20
681000 -- (-672.099) (-670.609) (-669.417) [-671.346] * (-669.633) (-670.358) (-669.735) [-668.923] -- 0:00:20
681500 -- [-669.864] (-674.538) (-670.121) (-672.305) * [-669.398] (-673.331) (-671.211) (-669.052) -- 0:00:20
682000 -- (-668.650) (-671.292) [-667.549] (-671.245) * [-671.692] (-673.065) (-669.976) (-670.000) -- 0:00:20
682500 -- (-669.850) (-671.008) [-668.102] (-670.020) * (-672.284) (-671.750) [-671.213] (-673.898) -- 0:00:20
683000 -- (-679.377) [-671.284] (-671.839) (-670.507) * (-672.845) (-672.636) (-672.413) [-674.200] -- 0:00:20
683500 -- (-674.685) (-671.332) (-671.074) [-669.754] * (-676.793) (-670.324) (-670.997) [-674.422] -- 0:00:20
684000 -- (-672.122) [-671.959] (-670.500) (-669.939) * (-672.312) [-668.981] (-671.600) (-673.906) -- 0:00:20
684500 -- (-672.841) (-671.521) [-670.983] (-670.720) * [-671.378] (-668.358) (-670.432) (-675.133) -- 0:00:20
685000 -- [-670.728] (-676.411) (-669.981) (-668.667) * (-672.389) (-671.802) (-673.027) [-668.614] -- 0:00:20
Average standard deviation of split frequencies: 0.007645
685500 -- [-671.449] (-672.773) (-670.296) (-670.770) * (-670.432) (-670.909) [-671.444] (-670.986) -- 0:00:20
686000 -- (-669.976) [-671.040] (-669.376) (-669.707) * (-669.469) [-668.602] (-670.867) (-671.620) -- 0:00:20
686500 -- (-666.611) [-668.560] (-669.765) (-675.354) * [-677.431] (-669.492) (-671.955) (-671.364) -- 0:00:20
687000 -- (-670.976) (-669.535) [-672.559] (-672.340) * (-670.809) (-672.196) (-669.489) [-668.230] -- 0:00:20
687500 -- (-672.664) (-671.347) (-667.289) [-670.970] * (-670.329) (-670.730) (-672.480) [-670.808] -- 0:00:20
688000 -- (-669.497) (-671.314) (-672.594) [-671.056] * (-670.426) (-670.811) (-674.011) [-668.753] -- 0:00:20
688500 -- (-668.022) (-669.976) [-669.821] (-668.692) * (-670.655) [-672.720] (-669.785) (-669.169) -- 0:00:20
689000 -- (-669.083) [-670.487] (-671.137) (-668.750) * (-668.143) (-675.711) (-671.562) [-674.057] -- 0:00:20
689500 -- [-669.276] (-670.131) (-668.273) (-675.729) * [-669.010] (-669.460) (-674.022) (-671.829) -- 0:00:20
690000 -- (-670.655) (-672.444) [-670.114] (-674.478) * (-674.947) (-669.682) [-670.926] (-672.263) -- 0:00:20
Average standard deviation of split frequencies: 0.007423
690500 -- (-669.569) (-670.207) [-671.654] (-671.423) * (-670.255) [-671.849] (-673.128) (-670.774) -- 0:00:20
691000 -- (-668.027) (-668.953) (-667.501) [-671.224] * (-670.517) (-669.760) [-671.657] (-668.808) -- 0:00:20
691500 -- [-668.767] (-670.800) (-668.575) (-673.430) * (-670.565) (-668.448) [-674.411] (-669.616) -- 0:00:20
692000 -- (-671.540) [-673.032] (-672.361) (-673.189) * (-671.626) [-671.634] (-671.803) (-671.594) -- 0:00:20
692500 -- (-671.097) (-674.943) [-672.288] (-669.017) * (-670.041) (-669.738) [-671.579] (-673.163) -- 0:00:19
693000 -- (-669.320) [-669.890] (-668.886) (-669.800) * (-672.586) (-674.659) [-670.094] (-668.347) -- 0:00:19
693500 -- (-669.160) (-669.441) (-672.869) [-667.464] * (-671.046) (-671.750) [-669.113] (-668.069) -- 0:00:19
694000 -- [-670.709] (-669.956) (-670.825) (-669.520) * (-672.793) [-675.256] (-670.228) (-668.985) -- 0:00:19
694500 -- (-670.610) (-671.892) (-670.046) [-668.626] * (-668.555) (-669.762) [-670.465] (-669.001) -- 0:00:19
695000 -- (-669.365) [-670.482] (-671.394) (-670.313) * (-674.671) [-671.841] (-672.619) (-670.981) -- 0:00:19
Average standard deviation of split frequencies: 0.007112
695500 -- (-670.628) (-670.250) [-668.118] (-669.136) * (-674.207) [-670.839] (-669.883) (-672.418) -- 0:00:19
696000 -- (-671.653) (-673.449) (-669.745) [-670.769] * (-672.964) (-670.967) [-671.339] (-671.144) -- 0:00:19
696500 -- (-672.989) (-671.829) [-668.202] (-671.751) * (-670.608) [-671.117] (-670.818) (-670.228) -- 0:00:19
697000 -- (-668.760) (-673.921) (-670.866) [-672.120] * (-671.151) [-673.919] (-674.303) (-670.899) -- 0:00:19
697500 -- (-671.264) [-669.383] (-670.607) (-670.493) * (-669.827) (-673.184) [-673.997] (-670.231) -- 0:00:19
698000 -- (-677.544) (-672.127) (-669.335) [-671.510] * [-673.967] (-673.651) (-670.338) (-670.011) -- 0:00:19
698500 -- [-668.894] (-669.675) (-671.112) (-670.445) * (-668.965) [-671.859] (-672.235) (-667.731) -- 0:00:19
699000 -- (-670.270) [-668.908] (-675.208) (-671.902) * (-670.378) (-672.823) [-671.157] (-669.115) -- 0:00:19
699500 -- [-672.719] (-670.118) (-670.757) (-671.736) * [-669.683] (-673.844) (-674.292) (-670.823) -- 0:00:19
700000 -- (-668.466) (-668.266) [-672.691] (-671.170) * (-669.242) (-671.546) [-672.192] (-670.301) -- 0:00:19
Average standard deviation of split frequencies: 0.006854
700500 -- (-668.404) (-672.214) (-671.572) [-670.144] * (-672.549) (-672.269) (-672.224) [-676.086] -- 0:00:19
701000 -- (-668.782) (-669.127) [-670.605] (-671.539) * (-671.659) (-673.670) (-669.247) [-669.667] -- 0:00:19
701500 -- [-670.387] (-670.351) (-668.062) (-673.124) * (-675.252) (-673.350) (-674.058) [-668.079] -- 0:00:19
702000 -- (-672.461) (-670.421) [-668.548] (-672.588) * [-670.624] (-671.514) (-671.801) (-670.117) -- 0:00:19
702500 -- (-670.591) [-668.919] (-673.417) (-672.635) * [-670.668] (-668.830) (-670.174) (-670.798) -- 0:00:19
703000 -- [-670.927] (-672.850) (-668.868) (-672.426) * (-678.451) (-671.093) (-672.640) [-668.148] -- 0:00:19
703500 -- (-670.977) (-669.575) [-670.059] (-676.979) * (-671.850) (-672.368) (-672.819) [-670.859] -- 0:00:19
704000 -- [-671.083] (-669.942) (-674.853) (-677.378) * (-669.623) (-674.074) (-671.239) [-670.218] -- 0:00:19
704500 -- [-670.263] (-670.158) (-675.744) (-672.704) * (-671.588) (-671.057) [-671.200] (-670.551) -- 0:00:19
705000 -- [-670.578] (-669.469) (-671.988) (-669.925) * [-670.594] (-671.012) (-673.826) (-671.091) -- 0:00:19
Average standard deviation of split frequencies: 0.006343
705500 -- (-673.604) (-674.132) [-670.958] (-670.306) * (-671.234) (-670.790) (-670.075) [-667.099] -- 0:00:19
706000 -- (-673.284) (-670.244) (-669.847) [-670.915] * (-672.686) [-671.018] (-672.788) (-669.829) -- 0:00:19
706500 -- (-668.173) [-670.369] (-671.988) (-672.502) * [-669.470] (-670.418) (-671.666) (-671.186) -- 0:00:19
707000 -- (-668.792) (-670.078) (-673.889) [-670.270] * (-672.286) (-671.331) (-671.685) [-667.277] -- 0:00:19
707500 -- (-671.202) [-668.916] (-669.578) (-672.114) * (-669.427) [-669.214] (-672.338) (-669.480) -- 0:00:19
708000 -- (-674.575) (-670.269) [-671.799] (-671.327) * (-670.246) [-670.393] (-673.690) (-668.791) -- 0:00:18
708500 -- [-670.012] (-669.267) (-674.745) (-673.641) * (-672.965) (-672.807) (-672.067) [-671.130] -- 0:00:18
709000 -- (-670.403) (-671.944) (-672.976) [-671.274] * (-670.436) (-670.301) (-672.320) [-676.668] -- 0:00:18
709500 -- (-670.525) [-669.484] (-668.544) (-670.942) * (-670.083) (-670.197) (-672.075) [-669.514] -- 0:00:18
710000 -- [-669.936] (-673.031) (-670.471) (-672.425) * [-670.266] (-672.268) (-674.319) (-671.799) -- 0:00:18
Average standard deviation of split frequencies: 0.005749
710500 -- (-670.184) (-668.735) [-669.050] (-670.479) * [-669.290] (-670.941) (-669.835) (-671.694) -- 0:00:18
711000 -- [-668.362] (-672.205) (-672.132) (-671.914) * (-669.196) (-670.321) [-670.095] (-671.343) -- 0:00:18
711500 -- [-669.835] (-670.459) (-673.336) (-669.715) * (-672.223) (-676.256) (-670.155) [-672.057] -- 0:00:18
712000 -- (-669.816) [-669.172] (-673.116) (-671.432) * (-668.720) (-672.443) [-668.481] (-672.733) -- 0:00:18
712500 -- [-669.891] (-669.016) (-669.733) (-670.205) * (-670.575) [-669.116] (-668.789) (-673.818) -- 0:00:18
713000 -- (-669.412) (-671.098) (-668.920) [-671.320] * [-671.113] (-670.310) (-669.758) (-677.344) -- 0:00:18
713500 -- (-674.290) [-671.152] (-670.693) (-673.257) * (-670.877) (-671.445) (-671.132) [-671.236] -- 0:00:18
714000 -- (-675.830) (-669.189) [-670.186] (-670.804) * (-673.719) (-672.503) (-669.639) [-670.536] -- 0:00:18
714500 -- (-670.988) (-668.435) [-670.845] (-670.020) * [-671.217] (-672.376) (-670.389) (-670.749) -- 0:00:18
715000 -- (-669.522) (-668.410) (-669.722) [-670.025] * (-674.541) [-672.166] (-672.890) (-671.697) -- 0:00:18
Average standard deviation of split frequencies: 0.005443
715500 -- (-671.030) (-667.370) [-670.743] (-671.340) * (-675.477) (-671.714) [-674.505] (-672.361) -- 0:00:18
716000 -- (-673.784) (-671.676) [-670.539] (-670.055) * (-671.810) (-670.710) (-673.330) [-671.618] -- 0:00:18
716500 -- (-671.974) [-673.797] (-669.683) (-674.751) * [-669.934] (-673.700) (-670.212) (-670.593) -- 0:00:18
717000 -- (-669.790) (-670.223) [-671.824] (-670.594) * [-668.398] (-674.415) (-671.785) (-671.873) -- 0:00:18
717500 -- (-672.211) (-670.584) (-673.621) [-669.221] * (-675.211) (-668.643) (-672.430) [-671.027] -- 0:00:18
718000 -- (-670.128) [-671.418] (-670.170) (-668.915) * (-672.214) [-671.958] (-671.839) (-670.861) -- 0:00:18
718500 -- (-671.251) (-669.544) (-672.525) [-670.774] * (-677.248) (-674.175) (-671.823) [-673.591] -- 0:00:18
719000 -- [-668.807] (-670.477) (-671.340) (-670.890) * (-680.621) (-673.110) [-671.533] (-673.429) -- 0:00:18
719500 -- [-670.768] (-670.243) (-670.874) (-670.828) * (-673.381) (-672.665) (-671.328) [-674.948] -- 0:00:18
720000 -- (-675.683) (-671.456) (-670.448) [-675.432] * [-671.711] (-672.753) (-673.486) (-670.348) -- 0:00:18
Average standard deviation of split frequencies: 0.005364
720500 -- [-669.560] (-670.089) (-668.181) (-670.840) * (-672.139) [-671.499] (-670.244) (-669.500) -- 0:00:18
721000 -- (-671.319) (-674.363) [-666.812] (-672.278) * (-672.133) [-675.948] (-670.791) (-669.454) -- 0:00:18
721500 -- (-677.533) (-675.673) [-669.079] (-669.762) * [-670.487] (-673.155) (-669.431) (-672.738) -- 0:00:18
722000 -- (-671.679) (-672.994) (-668.392) [-672.946] * (-670.798) (-672.768) [-671.125] (-672.226) -- 0:00:18
722500 -- (-669.739) (-669.960) [-671.336] (-673.534) * (-670.225) (-673.793) (-671.182) [-669.421] -- 0:00:18
723000 -- [-673.650] (-671.660) (-675.504) (-668.480) * (-670.552) [-671.884] (-669.770) (-670.695) -- 0:00:18
723500 -- (-672.755) (-666.828) [-671.364] (-671.626) * (-673.909) [-670.597] (-669.945) (-672.232) -- 0:00:17
724000 -- (-670.875) (-668.596) [-670.923] (-670.289) * (-672.187) (-671.421) [-672.366] (-670.097) -- 0:00:17
724500 -- (-670.147) (-669.368) [-670.274] (-670.520) * [-673.128] (-677.086) (-673.589) (-671.779) -- 0:00:17
725000 -- (-671.486) (-668.806) (-678.585) [-672.614] * [-669.641] (-671.020) (-675.741) (-669.682) -- 0:00:17
Average standard deviation of split frequencies: 0.005195
725500 -- [-671.481] (-669.522) (-675.792) (-675.275) * (-670.863) (-671.185) [-672.680] (-670.398) -- 0:00:17
726000 -- (-674.202) (-673.967) (-672.915) [-669.464] * (-670.282) (-671.970) (-673.627) [-671.270] -- 0:00:17
726500 -- [-670.238] (-668.694) (-670.344) (-670.800) * [-669.773] (-674.770) (-670.207) (-670.188) -- 0:00:17
727000 -- (-671.758) [-667.996] (-672.478) (-673.561) * [-669.454] (-669.475) (-670.209) (-673.516) -- 0:00:17
727500 -- (-672.002) (-671.919) (-671.873) [-669.246] * (-669.348) (-668.666) [-668.163] (-672.622) -- 0:00:17
728000 -- [-672.221] (-670.321) (-670.395) (-676.476) * (-669.045) (-673.412) [-670.444] (-672.388) -- 0:00:17
728500 -- [-669.065] (-670.320) (-678.240) (-675.815) * (-671.370) [-672.819] (-675.256) (-672.341) -- 0:00:17
729000 -- (-667.404) (-668.538) (-672.091) [-673.656] * (-668.458) (-671.813) [-671.079] (-672.629) -- 0:00:17
729500 -- (-670.748) (-670.517) (-672.291) [-672.732] * (-673.777) (-669.752) [-671.327] (-676.564) -- 0:00:17
730000 -- (-672.898) [-669.851] (-670.861) (-669.623) * (-670.965) [-672.069] (-667.602) (-672.324) -- 0:00:17
Average standard deviation of split frequencies: 0.005462
730500 -- [-669.173] (-669.503) (-669.063) (-667.194) * (-670.512) [-670.669] (-670.342) (-671.457) -- 0:00:17
731000 -- (-669.241) (-672.227) [-667.498] (-670.324) * (-670.961) [-669.630] (-669.348) (-668.364) -- 0:00:17
731500 -- (-672.181) (-668.203) [-671.007] (-670.538) * (-671.438) (-670.195) (-669.866) [-670.768] -- 0:00:17
732000 -- (-675.261) (-671.175) (-671.131) [-670.154] * (-673.026) (-671.174) [-673.423] (-670.217) -- 0:00:17
732500 -- (-670.465) [-672.792] (-673.117) (-672.235) * (-672.983) (-669.613) (-670.355) [-671.937] -- 0:00:17
733000 -- [-669.415] (-672.344) (-671.268) (-674.287) * (-672.991) (-670.405) [-670.156] (-673.901) -- 0:00:17
733500 -- (-668.095) [-672.576] (-670.338) (-670.332) * (-670.086) (-673.260) (-672.779) [-673.653] -- 0:00:17
734000 -- (-672.217) (-671.638) [-671.196] (-668.114) * [-670.932] (-672.012) (-671.853) (-671.746) -- 0:00:17
734500 -- (-672.816) (-673.323) [-669.400] (-668.059) * [-668.701] (-670.770) (-672.347) (-668.233) -- 0:00:17
735000 -- [-670.959] (-672.390) (-669.168) (-668.489) * [-670.822] (-675.429) (-670.612) (-666.984) -- 0:00:17
Average standard deviation of split frequencies: 0.005081
735500 -- (-672.066) (-672.235) [-672.382] (-673.026) * (-669.641) [-669.200] (-668.047) (-669.549) -- 0:00:17
736000 -- (-672.607) (-670.894) (-670.071) [-670.387] * (-669.479) (-668.961) [-667.529] (-669.564) -- 0:00:17
736500 -- (-670.595) (-672.298) [-673.974] (-671.358) * (-669.420) [-669.592] (-669.926) (-671.840) -- 0:00:17
737000 -- (-671.077) (-670.849) [-670.550] (-671.472) * (-671.126) (-669.039) (-669.842) [-670.832] -- 0:00:17
737500 -- (-669.903) [-670.847] (-671.261) (-667.971) * (-670.023) [-669.498] (-670.676) (-669.724) -- 0:00:17
738000 -- (-670.876) [-672.224] (-672.438) (-672.505) * (-670.953) (-675.733) (-668.129) [-670.236] -- 0:00:17
738500 -- [-672.191] (-673.201) (-673.732) (-669.516) * [-669.196] (-670.589) (-667.724) (-673.184) -- 0:00:16
739000 -- (-671.195) (-672.334) (-669.678) [-671.505] * (-669.586) [-669.854] (-670.223) (-674.093) -- 0:00:16
739500 -- (-673.393) (-670.077) [-674.287] (-667.495) * [-667.880] (-670.780) (-668.271) (-673.529) -- 0:00:16
740000 -- (-673.646) (-669.891) [-669.346] (-667.409) * (-669.429) (-669.442) (-672.203) [-671.258] -- 0:00:16
Average standard deviation of split frequencies: 0.005304
740500 -- (-673.474) (-671.981) [-670.787] (-667.854) * [-671.928] (-669.931) (-674.179) (-673.434) -- 0:00:16
741000 -- (-671.335) (-675.712) [-671.315] (-668.374) * (-675.645) [-669.317] (-671.126) (-667.884) -- 0:00:16
741500 -- (-672.043) [-674.044] (-672.026) (-669.278) * [-674.291] (-668.094) (-677.101) (-672.266) -- 0:00:16
742000 -- (-676.924) (-669.780) [-669.453] (-671.687) * (-670.655) (-669.084) (-670.430) [-671.552] -- 0:00:16
742500 -- (-672.526) [-673.854] (-670.291) (-669.400) * (-667.240) (-668.982) (-669.184) [-673.535] -- 0:00:16
743000 -- (-671.772) (-670.463) (-669.180) [-667.520] * (-668.101) [-671.376] (-669.237) (-671.209) -- 0:00:16
743500 -- (-669.851) (-670.281) [-668.867] (-667.937) * [-668.575] (-672.740) (-670.477) (-670.765) -- 0:00:16
744000 -- (-672.239) [-671.483] (-669.931) (-669.797) * (-672.051) (-676.645) [-669.081] (-668.293) -- 0:00:16
744500 -- (-671.154) [-671.139] (-670.069) (-671.420) * (-670.191) (-675.022) (-671.461) [-669.458] -- 0:00:16
745000 -- (-668.273) (-669.107) (-670.307) [-670.093] * (-670.023) (-670.485) [-668.739] (-671.833) -- 0:00:16
Average standard deviation of split frequencies: 0.005392
745500 -- (-670.155) (-669.404) [-669.357] (-670.108) * (-668.191) [-671.369] (-672.230) (-671.369) -- 0:00:16
746000 -- [-672.532] (-668.063) (-671.304) (-674.551) * [-668.953] (-669.893) (-673.134) (-668.602) -- 0:00:16
746500 -- [-673.069] (-670.540) (-673.789) (-672.329) * (-670.933) [-670.665] (-671.870) (-670.223) -- 0:00:16
747000 -- [-670.383] (-671.900) (-674.719) (-672.539) * (-668.988) [-670.627] (-669.118) (-671.526) -- 0:00:16
747500 -- [-668.927] (-669.579) (-670.962) (-672.817) * (-672.713) (-674.550) [-668.539] (-672.061) -- 0:00:16
748000 -- (-674.526) (-669.754) (-672.569) [-668.295] * (-671.466) (-671.162) (-668.913) [-669.368] -- 0:00:16
748500 -- [-673.232] (-672.664) (-673.229) (-670.655) * (-668.710) [-675.688] (-671.938) (-670.583) -- 0:00:16
749000 -- [-670.944] (-676.020) (-673.015) (-674.137) * [-668.159] (-673.767) (-672.129) (-673.870) -- 0:00:16
749500 -- (-670.158) (-670.481) (-669.144) [-669.702] * (-668.984) [-669.824] (-673.444) (-668.791) -- 0:00:16
750000 -- (-667.566) (-670.983) (-672.302) [-668.750] * [-669.958] (-669.478) (-670.698) (-668.901) -- 0:00:16
Average standard deviation of split frequencies: 0.005149
750500 -- (-669.682) [-668.390] (-671.053) (-670.295) * (-671.977) [-671.260] (-671.757) (-669.891) -- 0:00:16
751000 -- (-671.707) [-669.267] (-670.273) (-668.667) * (-670.716) (-668.377) [-672.941] (-670.342) -- 0:00:16
751500 -- (-667.752) (-669.659) [-671.882] (-668.112) * (-669.355) (-670.881) [-668.961] (-671.982) -- 0:00:16
752000 -- [-670.841] (-675.716) (-673.084) (-673.793) * (-668.546) (-668.694) (-672.200) [-671.304] -- 0:00:16
752500 -- (-671.633) (-669.574) [-671.255] (-669.148) * (-669.299) (-668.371) [-670.346] (-672.150) -- 0:00:16
753000 -- (-668.391) [-669.829] (-669.771) (-670.290) * (-676.008) [-672.200] (-670.157) (-669.914) -- 0:00:16
753500 -- (-667.582) (-668.651) (-673.118) [-671.947] * (-669.707) [-671.377] (-671.018) (-672.462) -- 0:00:16
754000 -- [-668.614] (-667.901) (-672.951) (-668.571) * [-674.783] (-672.702) (-673.421) (-671.151) -- 0:00:15
754500 -- [-666.621] (-668.595) (-674.188) (-669.456) * [-670.135] (-671.988) (-671.246) (-671.642) -- 0:00:15
755000 -- (-669.251) [-668.176] (-673.464) (-668.832) * (-673.465) (-670.829) (-672.233) [-668.728] -- 0:00:15
Average standard deviation of split frequencies: 0.005279
755500 -- (-671.456) (-671.360) (-673.400) [-673.086] * (-669.742) (-671.176) [-671.586] (-670.266) -- 0:00:15
756000 -- (-674.932) (-672.943) [-674.645] (-673.128) * (-674.377) (-679.951) [-670.930] (-670.562) -- 0:00:15
756500 -- (-671.826) [-672.576] (-672.619) (-673.191) * (-669.461) (-672.290) [-669.772] (-670.080) -- 0:00:15
757000 -- (-675.895) [-669.826] (-671.304) (-670.892) * (-672.808) (-670.765) (-670.104) [-669.980] -- 0:00:15
757500 -- [-668.099] (-672.553) (-670.278) (-673.849) * (-670.745) [-671.726] (-675.615) (-668.643) -- 0:00:15
758000 -- (-671.505) [-669.769] (-671.473) (-669.003) * [-671.426] (-670.967) (-672.937) (-670.816) -- 0:00:15
758500 -- (-673.004) [-669.146] (-673.063) (-668.004) * (-674.297) (-669.923) [-670.744] (-669.782) -- 0:00:15
759000 -- (-674.259) [-669.083] (-673.129) (-670.471) * [-670.097] (-669.280) (-671.670) (-668.942) -- 0:00:15
759500 -- (-670.037) [-669.754] (-671.372) (-668.970) * (-672.803) (-671.913) (-673.024) [-670.849] -- 0:00:15
760000 -- (-672.798) [-669.340] (-671.044) (-670.235) * (-670.650) [-671.912] (-670.167) (-672.483) -- 0:00:15
Average standard deviation of split frequencies: 0.005908
760500 -- (-670.318) [-667.789] (-670.364) (-669.674) * (-673.308) (-669.145) [-670.553] (-669.812) -- 0:00:15
761000 -- [-667.907] (-669.053) (-675.559) (-669.530) * (-668.084) [-675.175] (-672.257) (-671.697) -- 0:00:15
761500 -- (-667.964) [-674.610] (-670.875) (-668.720) * (-670.939) (-674.845) (-670.034) [-672.742] -- 0:00:15
762000 -- (-666.633) (-672.269) (-671.065) [-670.505] * [-670.282] (-677.638) (-672.522) (-670.979) -- 0:00:15
762500 -- (-670.715) (-667.629) (-668.815) [-667.790] * (-669.305) (-676.035) [-670.278] (-670.804) -- 0:00:15
763000 -- [-669.799] (-670.890) (-672.293) (-677.136) * (-669.072) (-674.431) [-670.186] (-670.585) -- 0:00:15
763500 -- (-673.520) (-669.557) [-669.482] (-672.438) * (-671.528) (-668.403) (-668.832) [-670.136] -- 0:00:15
764000 -- (-673.079) [-670.277] (-672.387) (-670.798) * [-673.376] (-673.313) (-669.046) (-670.675) -- 0:00:15
764500 -- [-668.386] (-669.504) (-668.440) (-671.373) * (-670.970) (-669.560) [-669.540] (-672.655) -- 0:00:15
765000 -- (-670.327) [-670.644] (-671.289) (-669.507) * [-671.050] (-674.023) (-669.078) (-671.449) -- 0:00:15
Average standard deviation of split frequencies: 0.006277
765500 -- [-670.009] (-668.843) (-673.233) (-671.283) * (-675.033) [-671.859] (-669.406) (-672.159) -- 0:00:15
766000 -- (-670.662) (-668.875) [-672.751] (-666.588) * (-672.142) (-672.764) (-668.462) [-671.842] -- 0:00:15
766500 -- (-673.789) (-669.753) [-668.708] (-670.996) * (-674.575) (-671.756) [-671.179] (-675.830) -- 0:00:15
767000 -- (-669.266) (-672.351) [-669.620] (-666.634) * [-670.334] (-671.440) (-671.565) (-672.467) -- 0:00:15
767500 -- [-671.840] (-670.834) (-670.379) (-671.094) * (-672.095) (-673.576) (-671.201) [-669.886] -- 0:00:15
768000 -- (-673.045) (-669.647) (-671.017) [-669.182] * (-676.567) [-671.048] (-669.557) (-673.065) -- 0:00:15
768500 -- (-672.434) (-669.367) [-671.553] (-671.403) * (-673.908) (-673.141) [-670.792] (-675.432) -- 0:00:15
769000 -- (-674.288) (-672.125) (-671.689) [-670.562] * (-681.346) (-670.604) [-669.885] (-678.598) -- 0:00:15
769500 -- [-675.309] (-670.963) (-670.283) (-673.367) * (-671.215) (-670.405) [-670.044] (-671.621) -- 0:00:14
770000 -- (-671.027) (-669.093) [-670.579] (-672.219) * [-671.705] (-670.423) (-668.189) (-670.671) -- 0:00:14
Average standard deviation of split frequencies: 0.005995
770500 -- [-670.684] (-669.157) (-670.856) (-666.995) * (-670.168) (-674.297) (-674.070) [-670.321] -- 0:00:14
771000 -- [-671.362] (-672.681) (-670.300) (-671.731) * (-671.361) (-671.342) [-673.822] (-672.923) -- 0:00:14
771500 -- [-672.097] (-672.062) (-671.138) (-669.939) * (-672.805) [-672.281] (-674.270) (-670.170) -- 0:00:14
772000 -- [-670.002] (-672.290) (-672.589) (-669.778) * (-669.531) [-669.602] (-668.537) (-671.269) -- 0:00:14
772500 -- (-670.490) (-671.907) (-668.813) [-670.584] * (-670.925) (-671.821) [-673.702] (-669.812) -- 0:00:14
773000 -- [-671.348] (-669.172) (-674.131) (-669.735) * (-672.450) [-671.643] (-672.433) (-672.561) -- 0:00:14
773500 -- (-673.732) (-669.473) (-675.834) [-671.638] * (-671.460) (-670.628) [-672.080] (-672.051) -- 0:00:14
774000 -- (-669.685) [-672.404] (-671.912) (-670.865) * (-672.235) (-671.416) [-671.148] (-670.370) -- 0:00:14
774500 -- [-672.327] (-670.363) (-668.452) (-674.011) * (-672.099) [-667.885] (-669.963) (-671.805) -- 0:00:14
775000 -- (-670.691) [-671.324] (-672.814) (-676.066) * (-669.792) (-666.983) [-669.291] (-676.085) -- 0:00:14
Average standard deviation of split frequencies: 0.006034
775500 -- (-671.048) (-670.805) [-670.491] (-670.479) * (-668.462) [-670.165] (-675.987) (-670.180) -- 0:00:14
776000 -- (-674.648) (-670.749) (-670.940) [-671.282] * (-668.929) (-670.094) (-669.170) [-669.552] -- 0:00:14
776500 -- (-671.887) (-672.205) (-672.144) [-671.825] * [-674.017] (-669.293) (-670.988) (-670.204) -- 0:00:14
777000 -- (-669.752) (-671.492) (-671.921) [-671.017] * (-675.174) [-668.714] (-671.233) (-669.984) -- 0:00:14
777500 -- (-670.207) (-673.455) [-674.714] (-670.054) * (-670.574) [-669.111] (-669.398) (-671.306) -- 0:00:14
778000 -- (-669.068) (-670.352) (-671.463) [-668.401] * [-667.899] (-669.132) (-669.535) (-670.462) -- 0:00:14
778500 -- (-669.432) (-670.737) (-670.628) [-669.850] * (-671.086) (-667.763) (-669.360) [-672.581] -- 0:00:14
779000 -- (-668.909) (-670.858) [-670.859] (-671.223) * (-671.094) [-670.353] (-673.757) (-671.501) -- 0:00:14
779500 -- (-672.332) (-670.717) (-670.512) [-675.024] * [-670.993] (-666.671) (-671.938) (-670.816) -- 0:00:14
780000 -- (-670.984) (-669.356) [-667.362] (-669.834) * (-675.519) [-670.471] (-668.498) (-671.578) -- 0:00:14
Average standard deviation of split frequencies: 0.005998
780500 -- (-670.116) [-672.524] (-669.059) (-671.095) * (-672.792) [-667.473] (-670.062) (-672.657) -- 0:00:14
781000 -- [-670.594] (-672.843) (-669.814) (-670.057) * (-671.510) (-667.466) (-672.721) [-669.479] -- 0:00:14
781500 -- (-669.628) (-675.160) (-669.604) [-671.540] * [-673.024] (-671.184) (-670.279) (-673.703) -- 0:00:14
782000 -- (-669.063) (-670.725) (-671.743) [-673.488] * (-672.196) [-668.536] (-672.250) (-674.271) -- 0:00:14
782500 -- (-673.094) [-670.543] (-671.091) (-668.594) * [-671.309] (-671.295) (-671.370) (-673.856) -- 0:00:14
783000 -- (-677.918) [-671.367] (-671.425) (-673.290) * (-674.902) (-668.886) [-670.436] (-668.174) -- 0:00:14
783500 -- (-677.480) (-674.279) [-667.068] (-669.234) * (-671.566) [-668.819] (-675.738) (-668.674) -- 0:00:14
784000 -- [-671.154] (-673.391) (-673.779) (-675.926) * (-669.025) (-669.100) (-672.758) [-671.502] -- 0:00:14
784500 -- (-672.144) (-668.773) [-670.404] (-673.801) * (-669.428) [-672.284] (-669.981) (-669.664) -- 0:00:14
785000 -- (-674.553) [-670.605] (-673.421) (-670.287) * (-669.519) [-671.520] (-671.050) (-670.314) -- 0:00:13
Average standard deviation of split frequencies: 0.005718
785500 -- (-674.632) (-669.112) [-668.461] (-673.363) * (-669.563) [-671.075] (-672.145) (-669.609) -- 0:00:13
786000 -- [-669.117] (-668.771) (-670.274) (-671.634) * (-670.031) (-669.432) [-673.554] (-669.053) -- 0:00:13
786500 -- [-669.617] (-669.401) (-669.040) (-669.588) * [-667.727] (-671.333) (-671.801) (-670.886) -- 0:00:13
787000 -- (-669.322) [-672.749] (-670.200) (-667.437) * (-670.512) [-669.774] (-671.997) (-672.273) -- 0:00:13
787500 -- (-670.446) (-669.243) (-668.295) [-670.039] * (-671.754) [-668.783] (-672.084) (-672.110) -- 0:00:13
788000 -- (-675.178) (-669.604) [-672.465] (-670.776) * (-671.075) (-671.650) (-673.422) [-671.297] -- 0:00:13
788500 -- (-672.464) (-667.961) [-670.949] (-671.369) * (-670.448) (-673.886) [-672.812] (-669.724) -- 0:00:13
789000 -- (-673.018) (-672.251) (-671.953) [-668.852] * (-673.755) (-672.617) (-672.570) [-671.130] -- 0:00:13
789500 -- (-669.874) (-671.847) [-672.640] (-671.048) * (-674.601) (-669.692) [-670.908] (-669.384) -- 0:00:13
790000 -- (-672.225) (-669.886) [-669.206] (-672.244) * (-671.483) (-671.701) (-673.012) [-669.900] -- 0:00:13
Average standard deviation of split frequencies: 0.005684
790500 -- (-670.358) [-668.996] (-674.552) (-673.331) * (-669.239) (-670.450) [-676.821] (-669.163) -- 0:00:13
791000 -- [-674.199] (-670.638) (-670.368) (-673.219) * (-668.993) (-678.056) (-675.150) [-670.591] -- 0:00:13
791500 -- (-671.890) [-670.609] (-672.162) (-669.332) * (-670.438) (-676.601) [-674.360] (-673.157) -- 0:00:13
792000 -- [-672.518] (-672.872) (-667.834) (-669.208) * [-671.370] (-666.971) (-674.604) (-675.939) -- 0:00:13
792500 -- (-674.665) [-672.102] (-670.894) (-669.307) * [-669.279] (-672.282) (-671.705) (-674.705) -- 0:00:13
793000 -- (-671.340) (-676.974) (-669.745) [-674.476] * [-672.802] (-670.116) (-674.301) (-674.065) -- 0:00:13
793500 -- [-668.890] (-670.694) (-672.385) (-673.531) * (-669.592) (-669.189) (-670.963) [-675.231] -- 0:00:13
794000 -- (-671.944) (-671.853) (-672.099) [-670.011] * (-671.374) [-669.319] (-670.883) (-674.351) -- 0:00:13
794500 -- (-671.523) [-671.399] (-678.365) (-669.432) * [-674.536] (-669.655) (-671.718) (-671.191) -- 0:00:13
795000 -- (-674.391) (-668.962) [-670.270] (-670.620) * (-673.293) [-670.757] (-674.759) (-668.368) -- 0:00:13
Average standard deviation of split frequencies: 0.005488
795500 -- (-673.094) [-669.713] (-671.321) (-672.159) * [-671.972] (-668.657) (-674.012) (-672.407) -- 0:00:13
796000 -- (-669.927) (-672.216) (-670.153) [-671.007] * (-670.744) (-672.038) (-668.864) [-671.897] -- 0:00:13
796500 -- (-668.976) (-670.588) [-670.135] (-670.535) * [-670.487] (-670.578) (-672.668) (-671.589) -- 0:00:13
797000 -- [-671.588] (-675.374) (-672.919) (-668.982) * (-671.032) (-670.892) [-673.131] (-671.620) -- 0:00:13
797500 -- (-677.080) (-671.895) (-670.023) [-670.472] * [-668.101] (-672.549) (-670.382) (-671.216) -- 0:00:13
798000 -- [-669.609] (-672.102) (-673.700) (-673.680) * [-670.710] (-672.422) (-673.058) (-670.292) -- 0:00:13
798500 -- [-671.835] (-672.190) (-672.008) (-672.887) * (-679.035) [-670.802] (-671.970) (-667.755) -- 0:00:13
799000 -- (-673.226) (-672.079) (-670.128) [-674.501] * (-677.107) [-670.138] (-672.684) (-667.723) -- 0:00:13
799500 -- (-670.790) [-671.890] (-671.718) (-670.056) * (-675.661) (-673.283) [-671.667] (-668.463) -- 0:00:13
800000 -- (-674.315) [-671.536] (-672.254) (-681.987) * [-670.379] (-672.791) (-669.506) (-671.926) -- 0:00:12
Average standard deviation of split frequencies: 0.005534
800500 -- (-671.308) (-673.220) (-672.380) [-674.013] * (-672.167) (-670.146) (-670.159) [-669.466] -- 0:00:12
801000 -- [-674.827] (-669.285) (-669.469) (-671.502) * (-671.208) (-669.993) [-670.227] (-671.496) -- 0:00:12
801500 -- [-670.987] (-672.319) (-673.546) (-669.250) * [-670.589] (-671.350) (-673.518) (-671.026) -- 0:00:12
802000 -- (-670.346) (-671.327) [-670.407] (-670.421) * (-675.902) (-670.664) (-672.485) [-669.291] -- 0:00:12
802500 -- (-672.373) (-671.354) [-670.448] (-670.414) * (-677.035) [-671.070] (-671.617) (-671.287) -- 0:00:12
803000 -- (-669.289) (-675.373) (-669.547) [-669.133] * (-669.195) [-669.192] (-670.318) (-671.877) -- 0:00:12
803500 -- [-671.014] (-668.461) (-668.866) (-671.766) * (-669.000) (-669.850) [-668.901] (-671.231) -- 0:00:12
804000 -- (-668.882) [-667.452] (-668.362) (-670.721) * (-672.559) (-672.270) [-672.771] (-673.791) -- 0:00:12
804500 -- (-671.443) (-670.880) [-669.271] (-677.233) * (-674.270) (-672.247) [-670.468] (-672.537) -- 0:00:12
805000 -- (-676.273) (-670.538) (-668.569) [-672.001] * (-670.020) [-670.477] (-671.782) (-672.841) -- 0:00:12
Average standard deviation of split frequencies: 0.005498
805500 -- (-673.014) (-672.603) [-667.974] (-669.916) * (-676.222) [-669.023] (-671.370) (-672.899) -- 0:00:12
806000 -- (-673.493) (-672.111) (-670.761) [-671.002] * (-671.081) [-670.344] (-673.215) (-677.802) -- 0:00:12
806500 -- (-673.835) (-670.053) (-669.354) [-671.623] * (-671.874) (-672.038) [-670.352] (-674.192) -- 0:00:12
807000 -- (-669.867) (-670.605) [-668.152] (-671.559) * (-668.520) [-676.358] (-674.859) (-670.782) -- 0:00:12
807500 -- [-672.689] (-670.705) (-671.100) (-670.983) * (-669.725) (-675.847) (-671.135) [-671.961] -- 0:00:12
808000 -- (-677.305) (-669.749) [-669.098] (-671.564) * [-670.329] (-672.706) (-668.681) (-674.659) -- 0:00:12
808500 -- (-668.475) [-671.116] (-669.300) (-670.964) * [-671.808] (-672.316) (-672.696) (-673.444) -- 0:00:12
809000 -- (-672.095) [-670.308] (-671.648) (-670.916) * (-671.910) [-670.970] (-671.265) (-674.894) -- 0:00:12
809500 -- (-669.602) (-671.560) [-674.574] (-670.908) * (-671.381) (-671.230) [-670.555] (-681.931) -- 0:00:12
810000 -- (-671.686) (-671.162) (-671.994) [-672.336] * [-670.502] (-672.523) (-674.238) (-670.803) -- 0:00:12
Average standard deviation of split frequencies: 0.005389
810500 -- (-670.228) (-670.721) [-671.786] (-670.925) * (-669.931) (-670.563) (-674.378) [-670.824] -- 0:00:12
811000 -- (-671.232) [-670.314] (-670.606) (-669.716) * (-670.696) (-672.757) [-674.450] (-673.195) -- 0:00:12
811500 -- (-672.415) [-670.073] (-677.027) (-673.875) * (-672.280) (-674.661) [-673.761] (-673.747) -- 0:00:12
812000 -- (-669.421) [-670.213] (-670.158) (-671.960) * (-670.257) [-668.534] (-674.720) (-671.741) -- 0:00:12
812500 -- (-669.906) (-670.952) (-671.907) [-669.560] * (-672.436) [-668.699] (-672.333) (-671.268) -- 0:00:12
813000 -- (-669.112) [-669.920] (-671.440) (-674.195) * (-674.416) (-669.985) [-669.339] (-672.907) -- 0:00:12
813500 -- (-670.693) (-671.363) [-670.306] (-669.955) * (-673.134) [-671.451] (-671.774) (-673.198) -- 0:00:12
814000 -- (-670.171) (-670.241) (-670.730) [-670.700] * [-674.761] (-677.045) (-670.775) (-673.037) -- 0:00:12
814500 -- (-669.164) (-675.135) [-671.052] (-670.427) * (-674.565) (-669.532) [-673.938] (-672.910) -- 0:00:12
815000 -- (-668.313) (-678.119) [-674.535] (-673.586) * [-672.985] (-672.794) (-672.625) (-671.856) -- 0:00:12
Average standard deviation of split frequencies: 0.005276
815500 -- (-670.594) (-675.507) (-674.634) [-670.036] * (-668.820) [-670.397] (-669.695) (-669.130) -- 0:00:11
816000 -- (-669.860) (-673.666) [-668.231] (-673.503) * (-673.092) (-671.586) [-669.721] (-672.281) -- 0:00:11
816500 -- (-670.718) (-668.403) [-672.318] (-670.702) * (-673.249) (-670.753) (-672.162) [-669.853] -- 0:00:11
817000 -- [-675.393] (-669.484) (-669.645) (-671.657) * [-670.274] (-673.335) (-673.409) (-668.313) -- 0:00:11
817500 -- (-669.854) (-670.348) [-671.614] (-669.309) * [-670.349] (-672.124) (-674.864) (-669.487) -- 0:00:11
818000 -- (-670.224) [-668.920] (-670.975) (-669.789) * (-671.855) (-671.722) (-669.923) [-669.975] -- 0:00:11
818500 -- (-669.387) (-672.154) [-669.007] (-672.023) * (-674.668) (-669.545) [-669.347] (-668.820) -- 0:00:11
819000 -- (-669.322) (-667.557) [-671.116] (-671.182) * (-676.012) (-669.386) [-670.761] (-672.304) -- 0:00:11
819500 -- (-668.888) (-671.579) (-670.478) [-669.161] * (-672.426) (-668.563) (-674.245) [-671.229] -- 0:00:11
820000 -- [-669.077] (-671.707) (-671.295) (-670.632) * (-671.628) (-671.703) (-669.454) [-668.407] -- 0:00:11
Average standard deviation of split frequencies: 0.005208
820500 -- (-668.017) [-669.049] (-672.111) (-672.100) * [-670.249] (-672.787) (-670.031) (-671.105) -- 0:00:11
821000 -- (-671.903) (-670.921) [-670.481] (-669.783) * (-670.264) (-671.803) (-671.300) [-671.198] -- 0:00:11
821500 -- (-670.451) [-668.969] (-670.228) (-669.907) * (-669.368) [-671.049] (-672.689) (-671.117) -- 0:00:11
822000 -- [-669.768] (-670.532) (-671.184) (-670.533) * (-670.304) [-668.308] (-673.715) (-670.257) -- 0:00:11
822500 -- (-670.428) [-670.964] (-669.466) (-672.802) * [-673.565] (-669.581) (-673.721) (-671.974) -- 0:00:11
823000 -- (-672.556) [-667.772] (-674.252) (-673.979) * [-668.459] (-669.976) (-673.637) (-672.476) -- 0:00:11
823500 -- [-670.893] (-670.112) (-672.746) (-669.304) * (-671.042) [-668.681] (-671.226) (-667.784) -- 0:00:11
824000 -- (-671.414) [-669.884] (-672.309) (-675.170) * (-675.208) (-677.976) [-675.283] (-667.877) -- 0:00:11
824500 -- (-670.119) (-671.993) [-671.731] (-678.238) * [-670.665] (-669.598) (-673.785) (-672.655) -- 0:00:11
825000 -- (-675.187) [-670.564] (-671.770) (-672.564) * (-669.143) (-673.167) (-668.821) [-672.564] -- 0:00:11
Average standard deviation of split frequencies: 0.005973
825500 -- [-668.767] (-668.106) (-671.219) (-668.776) * (-671.329) [-673.679] (-668.378) (-671.112) -- 0:00:11
826000 -- (-670.482) (-669.632) [-670.874] (-670.923) * (-667.855) [-668.883] (-673.534) (-670.304) -- 0:00:11
826500 -- (-668.814) [-672.950] (-672.391) (-671.553) * (-673.704) (-667.384) [-678.633] (-675.893) -- 0:00:11
827000 -- (-667.451) (-670.519) (-669.227) [-669.435] * (-675.803) (-669.374) (-672.976) [-670.950] -- 0:00:11
827500 -- (-668.445) [-676.367] (-669.508) (-671.590) * (-669.770) [-669.183] (-673.314) (-672.402) -- 0:00:11
828000 -- (-668.644) (-674.236) (-670.137) [-672.523] * [-668.180] (-670.541) (-670.330) (-675.535) -- 0:00:11
828500 -- (-671.081) (-675.447) [-672.816] (-669.773) * [-668.470] (-674.520) (-670.986) (-677.252) -- 0:00:11
829000 -- (-670.714) (-676.265) (-669.391) [-670.847] * (-668.371) (-671.637) [-669.291] (-670.754) -- 0:00:11
829500 -- (-668.300) (-670.437) [-667.774] (-671.328) * (-672.316) (-669.990) (-671.722) [-670.725] -- 0:00:11
830000 -- [-668.203] (-670.724) (-671.235) (-670.429) * (-670.932) (-670.032) (-670.472) [-671.671] -- 0:00:11
Average standard deviation of split frequencies: 0.006356
830500 -- (-670.987) [-671.831] (-668.099) (-672.939) * (-679.958) [-672.128] (-670.235) (-671.371) -- 0:00:11
831000 -- (-670.222) [-669.139] (-669.353) (-678.719) * [-670.642] (-670.262) (-670.685) (-671.875) -- 0:00:10
831500 -- (-673.408) (-674.332) [-668.789] (-673.956) * (-671.414) (-672.749) (-673.129) [-669.603] -- 0:00:10
832000 -- (-671.614) (-672.867) [-669.709] (-670.450) * [-672.306] (-670.730) (-671.710) (-678.730) -- 0:00:10
832500 -- (-674.192) (-674.924) [-670.381] (-669.297) * (-674.041) (-669.639) [-670.585] (-673.113) -- 0:00:10
833000 -- (-672.632) (-672.791) [-669.955] (-671.234) * (-670.826) (-671.541) [-675.316] (-677.248) -- 0:00:10
833500 -- (-670.576) [-671.292] (-671.908) (-669.941) * (-670.582) (-671.717) [-669.361] (-670.173) -- 0:00:10
834000 -- (-670.023) (-673.171) [-668.737] (-671.943) * [-669.072] (-669.360) (-676.830) (-668.394) -- 0:00:10
834500 -- [-672.864] (-670.552) (-671.307) (-672.252) * (-669.648) (-670.237) [-668.832] (-669.647) -- 0:00:10
835000 -- [-671.628] (-672.655) (-672.574) (-671.972) * [-668.234] (-674.759) (-670.582) (-670.553) -- 0:00:10
Average standard deviation of split frequencies: 0.006315
835500 -- (-670.495) (-669.883) [-676.138] (-671.032) * [-673.000] (-671.607) (-673.861) (-670.644) -- 0:00:10
836000 -- (-669.654) (-675.795) [-671.421] (-671.216) * (-670.011) [-674.969] (-675.442) (-674.461) -- 0:00:10
836500 -- (-669.901) (-680.377) (-673.371) [-668.672] * (-670.400) (-675.717) [-672.362] (-671.676) -- 0:00:10
837000 -- (-670.760) (-674.803) (-669.904) [-670.821] * (-673.356) (-670.120) [-672.341] (-668.808) -- 0:00:10
837500 -- (-670.989) [-673.331] (-670.872) (-671.328) * (-674.654) (-673.293) (-671.879) [-669.475] -- 0:00:10
838000 -- (-673.047) (-670.654) (-675.108) [-668.699] * (-672.266) [-669.302] (-672.005) (-672.631) -- 0:00:10
838500 -- (-671.728) (-674.058) (-676.787) [-670.851] * [-670.887] (-677.678) (-673.491) (-671.234) -- 0:00:10
839000 -- (-671.131) [-672.974] (-674.567) (-667.908) * [-672.840] (-678.665) (-673.256) (-676.737) -- 0:00:10
839500 -- (-671.704) (-673.019) (-671.953) [-669.570] * (-667.105) [-670.553] (-672.744) (-669.984) -- 0:00:10
840000 -- (-673.020) (-672.699) [-669.330] (-668.121) * [-670.884] (-669.798) (-672.162) (-671.959) -- 0:00:10
Average standard deviation of split frequencies: 0.006168
840500 -- (-676.158) (-673.452) [-670.829] (-671.270) * (-670.106) [-667.259] (-672.561) (-673.470) -- 0:00:10
841000 -- [-671.972] (-672.914) (-672.246) (-674.691) * (-677.063) (-670.092) [-670.901] (-671.419) -- 0:00:10
841500 -- (-671.750) [-671.586] (-669.555) (-669.617) * (-673.651) [-668.309] (-672.323) (-670.941) -- 0:00:10
842000 -- (-670.319) (-668.540) [-668.852] (-670.641) * (-672.334) (-671.528) (-672.026) [-671.536] -- 0:00:10
842500 -- [-669.804] (-672.286) (-668.958) (-672.690) * (-670.832) (-673.042) [-670.031] (-671.042) -- 0:00:10
843000 -- (-669.868) [-668.704] (-670.760) (-673.250) * (-671.473) (-669.800) [-669.866] (-670.319) -- 0:00:10
843500 -- (-672.860) [-672.736] (-669.362) (-669.783) * [-673.343] (-669.140) (-668.872) (-671.343) -- 0:00:10
844000 -- (-672.459) (-673.671) (-668.578) [-669.572] * [-675.127] (-669.118) (-671.826) (-668.974) -- 0:00:10
844500 -- (-670.386) (-678.625) [-669.637] (-667.630) * (-670.236) (-669.348) [-672.431] (-670.212) -- 0:00:10
845000 -- (-672.001) (-676.564) (-672.038) [-672.411] * (-671.665) (-673.999) (-670.953) [-672.865] -- 0:00:10
Average standard deviation of split frequencies: 0.005869
845500 -- (-670.194) (-673.032) [-670.897] (-671.528) * (-670.513) (-670.204) (-672.747) [-670.466] -- 0:00:10
846000 -- [-670.013] (-672.919) (-672.918) (-675.695) * (-671.321) (-670.171) [-671.287] (-669.434) -- 0:00:10
846500 -- [-667.868] (-676.890) (-670.604) (-680.341) * (-671.226) [-673.770] (-670.497) (-674.785) -- 0:00:09
847000 -- (-670.790) (-668.025) [-669.285] (-671.551) * (-671.749) [-672.975] (-671.706) (-670.743) -- 0:00:09
847500 -- (-671.277) (-669.059) [-669.045] (-672.387) * (-672.581) (-669.688) (-669.940) [-673.987] -- 0:00:09
848000 -- (-670.676) (-670.676) (-670.443) [-669.774] * [-672.350] (-679.184) (-671.206) (-672.233) -- 0:00:09
848500 -- (-670.476) (-669.470) [-672.956] (-670.969) * (-669.335) (-669.320) [-671.266] (-671.035) -- 0:00:09
849000 -- (-671.358) (-668.986) [-668.374] (-670.987) * [-671.926] (-668.975) (-676.897) (-676.014) -- 0:00:09
849500 -- (-672.784) (-672.628) [-668.488] (-671.694) * (-673.611) [-675.422] (-674.193) (-674.577) -- 0:00:09
850000 -- (-669.071) [-672.009] (-669.134) (-670.424) * (-675.442) [-672.408] (-671.279) (-671.821) -- 0:00:09
Average standard deviation of split frequencies: 0.005985
850500 -- (-669.210) (-671.883) (-670.341) [-670.229] * (-673.446) (-670.452) [-669.707] (-673.184) -- 0:00:09
851000 -- (-671.252) (-672.811) (-668.523) [-671.110] * [-669.931] (-670.451) (-669.684) (-670.744) -- 0:00:09
851500 -- (-670.938) (-672.683) [-667.981] (-672.483) * (-671.800) [-672.718] (-670.122) (-672.698) -- 0:00:09
852000 -- (-670.881) (-674.533) [-671.059] (-674.004) * (-672.169) [-669.162] (-668.856) (-670.195) -- 0:00:09
852500 -- [-669.568] (-670.187) (-672.883) (-671.702) * [-667.379] (-668.906) (-672.004) (-670.934) -- 0:00:09
853000 -- (-674.207) (-671.628) [-667.590] (-675.335) * (-672.446) (-668.692) [-671.411] (-675.049) -- 0:00:09
853500 -- (-679.883) [-672.147] (-669.538) (-671.291) * (-669.905) [-670.863] (-672.158) (-668.699) -- 0:00:09
854000 -- (-672.853) (-670.923) [-671.352] (-671.311) * (-674.939) [-670.424] (-671.716) (-671.092) -- 0:00:09
854500 -- (-670.428) (-671.943) [-671.081] (-668.228) * (-668.714) (-670.783) (-670.093) [-672.350] -- 0:00:09
855000 -- [-669.432] (-670.365) (-669.714) (-671.681) * (-670.361) [-673.795] (-671.786) (-671.029) -- 0:00:09
Average standard deviation of split frequencies: 0.006021
855500 -- [-669.632] (-670.940) (-670.909) (-670.990) * [-669.243] (-673.169) (-672.748) (-674.383) -- 0:00:09
856000 -- (-669.401) (-671.528) [-671.252] (-673.383) * (-673.001) (-669.764) (-673.883) [-670.926] -- 0:00:09
856500 -- [-669.473] (-670.659) (-668.758) (-680.632) * [-669.970] (-669.471) (-671.560) (-670.755) -- 0:00:09
857000 -- (-671.919) [-670.071] (-674.869) (-670.214) * (-671.599) (-671.387) [-670.065] (-670.963) -- 0:00:09
857500 -- (-670.073) (-668.262) [-668.097] (-672.471) * (-668.892) (-672.447) (-669.846) [-669.055] -- 0:00:09
858000 -- (-669.839) (-670.237) [-673.200] (-668.757) * [-674.302] (-672.195) (-670.089) (-673.141) -- 0:00:09
858500 -- (-668.698) (-671.668) [-667.637] (-673.004) * (-674.616) (-671.854) [-674.172] (-670.131) -- 0:00:09
859000 -- (-670.753) (-672.009) (-670.823) [-669.479] * (-673.698) (-670.043) (-671.491) [-669.738] -- 0:00:09
859500 -- (-672.000) [-669.070] (-670.626) (-670.662) * (-673.550) (-672.771) [-670.619] (-671.916) -- 0:00:09
860000 -- (-670.325) [-669.783] (-669.934) (-671.273) * (-670.041) (-673.138) [-670.051] (-669.860) -- 0:00:09
Average standard deviation of split frequencies: 0.005733
860500 -- (-670.189) (-672.155) [-669.903] (-672.343) * (-670.407) (-674.372) (-669.706) [-670.056] -- 0:00:09
861000 -- (-671.856) (-671.496) (-669.908) [-671.148] * (-672.257) [-673.794] (-669.353) (-669.920) -- 0:00:09
861500 -- (-668.495) [-670.783] (-667.955) (-673.140) * [-670.507] (-671.423) (-671.321) (-674.214) -- 0:00:09
862000 -- (-669.325) (-670.310) (-673.071) [-671.257] * (-673.545) [-671.004] (-671.586) (-671.933) -- 0:00:08
862500 -- [-669.132] (-672.663) (-672.423) (-670.935) * (-670.902) (-669.328) (-671.502) [-672.790] -- 0:00:08
863000 -- (-669.375) (-671.743) [-671.026] (-671.662) * (-669.866) (-669.314) [-669.687] (-672.071) -- 0:00:08
863500 -- (-671.195) (-670.409) [-669.654] (-670.570) * (-670.113) (-671.252) [-668.956] (-674.149) -- 0:00:08
864000 -- [-669.966] (-670.830) (-671.902) (-669.775) * (-670.491) [-670.223] (-672.241) (-672.043) -- 0:00:08
864500 -- (-668.861) [-670.572] (-677.103) (-670.106) * (-674.072) (-669.772) (-670.910) [-672.813] -- 0:00:08
865000 -- (-669.705) (-673.266) (-668.401) [-672.508] * (-675.936) (-671.244) [-671.562] (-670.674) -- 0:00:08
Average standard deviation of split frequencies: 0.006242
865500 -- (-669.912) (-672.832) (-672.636) [-670.918] * (-672.587) [-669.496] (-672.755) (-671.007) -- 0:00:08
866000 -- (-673.675) [-677.125] (-674.463) (-668.605) * [-670.175] (-667.459) (-670.240) (-671.589) -- 0:00:08
866500 -- (-669.874) (-671.745) [-669.134] (-670.841) * (-670.322) [-671.808] (-676.510) (-673.077) -- 0:00:08
867000 -- [-674.446] (-669.828) (-667.922) (-668.014) * (-668.751) (-670.182) (-671.611) [-673.030] -- 0:00:08
867500 -- [-673.226] (-670.437) (-672.026) (-672.974) * (-668.533) [-674.067] (-672.222) (-673.744) -- 0:00:08
868000 -- (-673.220) [-672.075] (-669.884) (-673.241) * [-670.382] (-675.902) (-669.246) (-668.415) -- 0:00:08
868500 -- (-670.485) (-673.475) [-667.620] (-671.674) * [-669.685] (-675.625) (-669.024) (-669.126) -- 0:00:08
869000 -- [-676.439] (-673.713) (-670.887) (-683.783) * (-670.657) (-670.773) (-670.586) [-671.057] -- 0:00:08
869500 -- (-676.352) (-670.575) [-669.819] (-675.146) * (-669.612) (-669.220) (-669.501) [-672.156] -- 0:00:08
870000 -- (-671.892) (-671.638) [-667.716] (-670.202) * [-669.609] (-670.669) (-668.510) (-670.413) -- 0:00:08
Average standard deviation of split frequencies: 0.006317
870500 -- (-673.999) (-670.762) (-671.324) [-669.753] * [-668.224] (-669.451) (-672.217) (-671.341) -- 0:00:08
871000 -- (-669.049) [-668.345] (-679.173) (-671.939) * (-669.084) (-668.410) (-673.511) [-672.444] -- 0:00:08
871500 -- [-670.425] (-668.190) (-673.945) (-671.361) * (-669.693) (-666.821) (-670.317) [-670.226] -- 0:00:08
872000 -- (-671.741) (-669.683) (-672.454) [-671.258] * [-670.060] (-667.267) (-669.778) (-671.742) -- 0:00:08
872500 -- (-670.907) [-668.763] (-669.083) (-668.737) * (-678.657) (-676.190) [-672.732] (-671.456) -- 0:00:08
873000 -- (-669.911) (-670.710) (-672.891) [-670.280] * (-678.819) [-668.943] (-671.852) (-670.856) -- 0:00:08
873500 -- [-671.959] (-672.050) (-669.019) (-672.612) * (-673.262) (-671.286) [-672.943] (-669.512) -- 0:00:08
874000 -- [-669.926] (-669.832) (-668.537) (-672.518) * (-671.425) (-668.467) (-670.008) [-667.895] -- 0:00:08
874500 -- (-671.141) [-671.921] (-673.250) (-670.780) * [-670.007] (-669.951) (-670.136) (-670.063) -- 0:00:08
875000 -- [-670.172] (-669.925) (-677.094) (-670.883) * (-670.073) (-669.118) [-668.477] (-668.933) -- 0:00:08
Average standard deviation of split frequencies: 0.006673
875500 -- (-673.762) [-672.090] (-672.236) (-674.801) * (-669.689) (-669.909) [-670.381] (-668.739) -- 0:00:08
876000 -- (-670.341) (-670.135) (-670.140) [-670.002] * (-672.119) (-669.252) [-667.452] (-673.447) -- 0:00:08
876500 -- (-674.485) (-671.564) [-668.344] (-671.257) * (-670.039) (-669.803) (-670.364) [-669.708] -- 0:00:08
877000 -- (-673.522) (-670.435) (-670.510) [-667.974] * [-669.428] (-670.907) (-673.926) (-672.308) -- 0:00:07
877500 -- (-672.435) (-671.412) (-671.218) [-668.084] * [-669.708] (-668.428) (-675.115) (-672.187) -- 0:00:07
878000 -- (-670.978) (-672.291) (-669.769) [-668.581] * [-672.453] (-671.635) (-673.006) (-672.923) -- 0:00:07
878500 -- (-672.859) [-670.478] (-671.951) (-671.868) * [-671.360] (-671.929) (-668.823) (-672.658) -- 0:00:07
879000 -- (-670.722) (-668.749) [-669.684] (-669.971) * (-671.686) (-672.092) (-671.874) [-671.546] -- 0:00:07
879500 -- [-670.713] (-671.703) (-669.281) (-669.458) * (-669.256) [-668.439] (-671.954) (-671.027) -- 0:00:07
880000 -- (-672.699) (-670.237) (-671.110) [-671.873] * [-669.551] (-668.481) (-673.904) (-671.545) -- 0:00:07
Average standard deviation of split frequencies: 0.006637
880500 -- (-670.433) (-670.486) [-667.729] (-669.322) * (-668.404) (-669.836) (-669.473) [-670.649] -- 0:00:07
881000 -- (-670.305) (-669.061) [-669.890] (-668.779) * (-669.983) (-674.934) [-669.887] (-669.981) -- 0:00:07
881500 -- (-671.061) [-671.094] (-669.517) (-672.310) * [-671.508] (-670.827) (-669.128) (-671.696) -- 0:00:07
882000 -- (-672.240) (-670.069) [-668.377] (-668.581) * (-670.677) (-669.596) [-668.742] (-673.763) -- 0:00:07
882500 -- (-673.434) [-668.491] (-668.659) (-670.994) * (-670.726) (-668.263) [-669.348] (-669.190) -- 0:00:07
883000 -- (-670.270) [-671.516] (-669.683) (-674.432) * [-672.763] (-668.273) (-671.983) (-672.103) -- 0:00:07
883500 -- (-669.260) (-674.737) (-672.922) [-668.238] * [-674.244] (-667.896) (-670.224) (-669.374) -- 0:00:07
884000 -- [-669.928] (-671.341) (-670.399) (-668.826) * (-674.103) (-671.412) [-669.106] (-669.553) -- 0:00:07
884500 -- [-671.446] (-671.014) (-673.284) (-669.488) * [-668.976] (-670.060) (-671.557) (-668.500) -- 0:00:07
885000 -- (-670.886) (-670.772) [-669.573] (-673.020) * (-671.027) (-671.264) [-672.190] (-672.497) -- 0:00:07
Average standard deviation of split frequencies: 0.006598
885500 -- (-670.700) [-670.615] (-668.656) (-668.834) * [-668.601] (-667.362) (-673.413) (-669.797) -- 0:00:07
886000 -- (-669.350) [-671.215] (-669.026) (-671.722) * (-673.622) [-671.054] (-671.435) (-670.061) -- 0:00:07
886500 -- [-669.456] (-669.908) (-671.189) (-670.062) * (-673.420) (-669.537) [-672.734] (-671.791) -- 0:00:07
887000 -- (-669.108) [-669.671] (-670.611) (-673.502) * (-670.957) (-669.531) (-671.264) [-670.180] -- 0:00:07
887500 -- (-668.400) (-670.545) [-672.938] (-669.239) * (-675.792) (-668.971) [-670.875] (-670.993) -- 0:00:07
888000 -- (-671.145) (-672.588) (-671.445) [-669.417] * (-672.185) (-671.275) [-671.926] (-675.375) -- 0:00:07
888500 -- (-671.459) [-671.756] (-674.500) (-675.217) * (-670.730) [-670.972] (-669.848) (-673.215) -- 0:00:07
889000 -- [-669.859] (-670.396) (-674.052) (-669.630) * (-671.342) [-668.380] (-669.578) (-669.460) -- 0:00:07
889500 -- (-669.899) (-671.767) (-672.099) [-670.632] * (-672.639) [-671.918] (-670.112) (-673.918) -- 0:00:07
890000 -- (-669.790) (-672.527) [-672.349] (-671.874) * [-671.343] (-669.055) (-672.435) (-670.846) -- 0:00:07
Average standard deviation of split frequencies: 0.006387
890500 -- [-672.666] (-670.622) (-668.738) (-673.659) * [-669.962] (-670.093) (-672.909) (-671.749) -- 0:00:07
891000 -- (-670.103) (-668.403) (-674.372) [-672.026] * (-670.876) [-669.068] (-670.891) (-669.696) -- 0:00:07
891500 -- (-668.983) [-667.915] (-671.192) (-670.232) * [-671.458] (-668.153) (-670.057) (-672.943) -- 0:00:07
892000 -- (-669.245) (-669.431) [-673.615] (-670.985) * (-670.216) (-668.876) [-671.807] (-670.628) -- 0:00:07
892500 -- (-668.827) (-674.950) (-668.763) [-674.887] * [-670.115] (-671.277) (-671.391) (-672.269) -- 0:00:06
893000 -- (-670.615) [-669.217] (-668.943) (-677.307) * (-675.253) [-673.984] (-674.475) (-670.358) -- 0:00:06
893500 -- (-669.278) [-671.102] (-671.897) (-677.064) * (-671.445) (-669.442) (-672.145) [-669.855] -- 0:00:06
894000 -- (-669.571) [-670.496] (-669.142) (-673.279) * (-674.919) (-669.487) [-667.740] (-671.021) -- 0:00:06
894500 -- (-668.134) (-671.612) (-667.859) [-670.209] * [-672.745] (-673.566) (-675.071) (-673.036) -- 0:00:06
895000 -- [-668.937] (-668.621) (-669.094) (-672.378) * (-671.321) [-669.841] (-668.253) (-671.447) -- 0:00:06
Average standard deviation of split frequencies: 0.006243
895500 -- (-676.479) (-672.088) (-669.605) [-668.218] * (-671.320) (-671.739) (-669.461) [-675.301] -- 0:00:06
896000 -- (-670.738) (-672.635) (-671.238) [-670.339] * (-671.703) [-670.010] (-670.835) (-672.100) -- 0:00:06
896500 -- (-670.292) (-679.346) (-669.703) [-668.648] * [-672.829] (-673.277) (-673.272) (-673.091) -- 0:00:06
897000 -- (-668.175) [-668.787] (-674.572) (-673.726) * [-670.428] (-674.474) (-672.155) (-672.015) -- 0:00:06
897500 -- (-670.401) (-669.267) [-672.411] (-668.171) * (-672.129) (-668.930) (-674.011) [-670.551] -- 0:00:06
898000 -- (-667.714) (-671.132) [-671.984] (-667.810) * (-669.287) (-671.696) (-670.404) [-671.967] -- 0:00:06
898500 -- (-671.501) (-670.315) (-670.878) [-668.908] * (-671.638) (-670.231) [-669.907] (-672.108) -- 0:00:06
899000 -- [-672.195] (-672.330) (-671.242) (-672.250) * (-671.246) [-675.010] (-674.299) (-671.985) -- 0:00:06
899500 -- [-668.696] (-670.389) (-673.483) (-670.794) * (-674.594) [-671.790] (-675.002) (-671.710) -- 0:00:06
900000 -- (-668.070) (-670.388) (-670.934) [-669.742] * [-672.248] (-672.350) (-675.224) (-671.244) -- 0:00:06
Average standard deviation of split frequencies: 0.005932
900500 -- (-670.176) [-671.683] (-670.385) (-670.816) * (-671.894) (-672.553) [-672.683] (-672.713) -- 0:00:06
901000 -- (-672.482) (-668.365) (-671.018) [-668.741] * (-675.162) (-670.909) (-673.198) [-671.353] -- 0:00:06
901500 -- (-672.355) (-670.607) (-671.035) [-671.049] * (-673.415) (-672.140) (-671.130) [-671.937] -- 0:00:06
902000 -- (-671.830) (-669.067) (-677.097) [-668.433] * [-672.319] (-672.459) (-670.439) (-678.056) -- 0:00:06
902500 -- (-672.583) (-669.868) (-672.422) [-671.097] * (-673.814) [-669.919] (-669.263) (-671.554) -- 0:00:06
903000 -- (-675.067) [-670.671] (-670.634) (-671.169) * (-674.305) (-670.297) [-670.610] (-671.729) -- 0:00:06
903500 -- (-672.123) [-671.722] (-669.552) (-669.627) * (-672.608) (-670.246) [-670.774] (-674.057) -- 0:00:06
904000 -- [-669.102] (-670.759) (-668.751) (-669.506) * (-671.166) [-670.619] (-668.462) (-670.655) -- 0:00:06
904500 -- (-668.839) [-671.646] (-672.576) (-674.408) * (-673.711) (-671.113) [-671.284] (-669.473) -- 0:00:06
905000 -- (-669.658) (-670.066) (-672.804) [-675.396] * (-671.756) (-670.118) [-670.365] (-674.418) -- 0:00:06
Average standard deviation of split frequencies: 0.006313
905500 -- [-667.241] (-669.807) (-669.189) (-670.638) * (-668.699) [-670.369] (-671.695) (-670.020) -- 0:00:06
906000 -- (-669.691) (-668.998) (-672.820) [-669.325] * (-673.296) (-673.510) (-673.477) [-670.058] -- 0:00:06
906500 -- (-671.958) (-672.475) (-671.982) [-669.611] * (-671.145) (-672.241) [-671.482] (-670.591) -- 0:00:06
907000 -- [-674.414] (-671.148) (-671.971) (-671.209) * (-673.379) (-671.539) (-673.848) [-672.948] -- 0:00:06
907500 -- (-669.413) (-669.103) [-672.117] (-670.252) * [-673.293] (-671.960) (-675.800) (-670.416) -- 0:00:06
908000 -- (-673.540) [-670.430] (-668.657) (-671.227) * (-669.471) [-670.638] (-671.402) (-671.152) -- 0:00:05
908500 -- (-668.682) (-670.685) (-672.362) [-669.018] * (-670.810) [-672.841] (-670.629) (-670.973) -- 0:00:05
909000 -- (-668.040) (-670.401) (-668.809) [-670.902] * (-672.580) (-671.402) [-671.577] (-669.904) -- 0:00:05
909500 -- (-673.233) (-671.965) (-669.431) [-667.895] * (-670.114) (-677.258) (-670.757) [-670.258] -- 0:00:05
910000 -- (-669.315) (-670.627) (-670.682) [-667.210] * (-670.073) (-672.379) (-672.259) [-670.597] -- 0:00:05
Average standard deviation of split frequencies: 0.005832
910500 -- (-670.546) (-671.661) [-669.343] (-669.529) * (-669.765) (-673.398) (-670.741) [-671.467] -- 0:00:05
911000 -- (-667.852) (-670.182) (-671.098) [-669.829] * (-667.818) (-671.760) (-672.705) [-669.989] -- 0:00:05
911500 -- (-670.913) (-673.290) (-671.450) [-669.589] * (-667.425) [-670.402] (-672.762) (-671.453) -- 0:00:05
912000 -- (-674.461) (-670.077) [-670.617] (-674.325) * (-672.484) [-669.443] (-674.606) (-673.419) -- 0:00:05
912500 -- (-672.987) [-669.886] (-672.684) (-669.784) * (-668.069) [-670.817] (-671.667) (-672.109) -- 0:00:05
913000 -- (-673.967) (-669.538) (-670.450) [-670.647] * [-670.334] (-671.174) (-669.853) (-668.693) -- 0:00:05
913500 -- (-670.993) (-669.135) [-670.937] (-671.028) * (-669.499) (-669.006) [-671.382] (-668.348) -- 0:00:05
914000 -- [-673.353] (-676.115) (-670.282) (-669.445) * (-676.618) [-669.528] (-669.502) (-670.673) -- 0:00:05
914500 -- (-672.371) (-672.749) (-670.310) [-669.021] * (-670.595) [-668.982] (-672.000) (-672.110) -- 0:00:05
915000 -- (-674.668) (-672.527) (-671.818) [-667.814] * (-669.839) (-670.291) [-670.473] (-672.840) -- 0:00:05
Average standard deviation of split frequencies: 0.006107
915500 -- (-671.220) [-672.036] (-670.010) (-668.365) * (-673.276) (-669.286) (-671.793) [-672.483] -- 0:00:05
916000 -- (-670.354) (-673.098) (-675.927) [-669.034] * (-670.492) [-669.858] (-674.351) (-672.453) -- 0:00:05
916500 -- (-671.962) (-670.398) [-671.827] (-670.208) * [-670.188] (-668.865) (-674.580) (-670.981) -- 0:00:05
917000 -- (-671.823) (-672.992) (-672.556) [-670.751] * (-667.297) (-671.478) (-669.624) [-667.893] -- 0:00:05
917500 -- (-670.457) (-674.099) (-671.862) [-672.226] * (-669.834) [-669.756] (-671.896) (-670.230) -- 0:00:05
918000 -- [-674.226] (-671.124) (-670.883) (-670.335) * [-669.791] (-670.729) (-673.642) (-671.992) -- 0:00:05
918500 -- (-670.662) [-672.129] (-670.037) (-673.517) * (-669.523) (-670.154) [-670.822] (-672.118) -- 0:00:05
919000 -- [-672.707] (-677.014) (-668.499) (-669.341) * [-668.062] (-670.420) (-670.142) (-670.534) -- 0:00:05
919500 -- (-670.569) (-675.084) (-672.518) [-668.605] * (-669.965) (-670.977) (-671.375) [-671.937] -- 0:00:05
920000 -- (-675.001) (-674.264) [-669.448] (-667.746) * (-673.734) (-670.367) [-667.875] (-669.269) -- 0:00:05
Average standard deviation of split frequencies: 0.006008
920500 -- [-670.952] (-670.641) (-671.330) (-671.286) * (-671.620) (-673.162) [-670.230] (-672.431) -- 0:00:05
921000 -- (-671.939) (-669.802) (-668.943) [-671.855] * [-672.416] (-671.121) (-667.715) (-676.937) -- 0:00:05
921500 -- [-671.431] (-671.473) (-666.925) (-674.356) * (-668.979) (-668.732) (-670.920) [-671.291] -- 0:00:05
922000 -- (-672.224) (-673.449) [-668.995] (-671.445) * (-667.953) (-669.750) [-671.983] (-671.070) -- 0:00:05
922500 -- [-670.407] (-671.375) (-668.209) (-670.688) * [-669.945] (-670.637) (-668.296) (-671.038) -- 0:00:05
923000 -- (-678.461) (-674.080) [-668.388] (-671.612) * (-676.894) [-672.063] (-669.261) (-669.357) -- 0:00:05
923500 -- (-670.465) (-671.576) [-672.868] (-671.713) * (-671.159) (-671.458) (-671.051) [-670.827] -- 0:00:04
924000 -- (-670.643) [-671.693] (-672.979) (-668.581) * (-671.934) (-671.463) (-671.328) [-669.075] -- 0:00:04
924500 -- (-670.323) [-672.351] (-670.350) (-673.085) * [-669.589] (-670.591) (-669.179) (-672.258) -- 0:00:04
925000 -- (-669.362) [-668.602] (-670.596) (-671.439) * (-669.247) (-667.803) [-668.615] (-671.215) -- 0:00:04
Average standard deviation of split frequencies: 0.005736
925500 -- (-670.850) (-670.353) (-668.559) [-670.120] * [-669.049] (-673.143) (-668.203) (-670.798) -- 0:00:04
926000 -- (-669.105) [-667.810] (-669.302) (-667.506) * (-667.466) (-671.413) [-668.449] (-668.392) -- 0:00:04
926500 -- (-670.607) (-671.381) [-670.714] (-672.079) * [-670.229] (-671.520) (-672.846) (-671.079) -- 0:00:04
927000 -- (-670.718) (-667.543) (-670.392) [-670.191] * (-678.658) (-673.785) [-670.846] (-671.885) -- 0:00:04
927500 -- [-670.340] (-670.631) (-674.052) (-671.386) * [-674.161] (-672.900) (-669.830) (-672.101) -- 0:00:04
928000 -- (-670.207) [-668.340] (-668.612) (-669.585) * (-669.303) (-669.489) [-670.351] (-672.559) -- 0:00:04
928500 -- (-671.335) (-668.656) (-670.853) [-671.648] * [-669.204] (-668.361) (-669.639) (-670.821) -- 0:00:04
929000 -- (-673.883) (-670.390) [-671.384] (-673.848) * (-668.240) (-668.802) [-668.589] (-675.866) -- 0:00:04
929500 -- (-674.544) (-670.028) (-671.324) [-669.855] * (-668.565) [-669.076] (-672.249) (-673.084) -- 0:00:04
930000 -- (-672.409) [-669.307] (-670.456) (-671.688) * (-672.794) [-674.186] (-669.343) (-672.561) -- 0:00:04
Average standard deviation of split frequencies: 0.006213
930500 -- (-670.110) (-671.388) [-671.698] (-671.112) * (-669.657) (-675.916) [-671.247] (-674.085) -- 0:00:04
931000 -- (-672.144) [-669.501] (-671.957) (-669.856) * (-672.625) (-672.699) (-670.199) [-672.863] -- 0:00:04
931500 -- (-670.680) [-669.417] (-673.051) (-670.650) * (-676.630) (-671.802) (-673.201) [-671.696] -- 0:00:04
932000 -- [-671.705] (-674.078) (-672.799) (-671.693) * (-671.625) (-672.233) [-669.104] (-669.320) -- 0:00:04
932500 -- (-668.611) [-670.708] (-673.933) (-671.925) * (-676.522) (-672.094) (-671.247) [-669.912] -- 0:00:04
933000 -- (-672.407) (-669.739) (-673.686) [-672.032] * (-676.026) (-675.015) (-676.369) [-670.585] -- 0:00:04
933500 -- [-668.920] (-669.205) (-672.402) (-668.439) * [-673.218] (-674.220) (-676.287) (-670.305) -- 0:00:04
934000 -- [-669.772] (-667.871) (-672.546) (-669.947) * (-673.614) (-671.759) (-670.443) [-669.397] -- 0:00:04
934500 -- (-672.483) (-670.337) [-671.271] (-671.263) * [-672.198] (-670.669) (-671.775) (-674.982) -- 0:00:04
935000 -- (-671.883) [-669.667] (-672.382) (-668.993) * (-675.046) [-672.727] (-670.203) (-672.252) -- 0:00:04
Average standard deviation of split frequencies: 0.006379
935500 -- (-670.634) (-675.263) (-670.642) [-671.257] * (-670.340) (-672.888) (-675.593) [-671.117] -- 0:00:04
936000 -- (-670.041) (-672.941) [-671.736] (-667.940) * [-671.945] (-672.927) (-672.930) (-671.470) -- 0:00:04
936500 -- (-669.098) [-667.693] (-672.508) (-672.600) * [-671.323] (-670.578) (-673.174) (-670.397) -- 0:00:04
937000 -- (-671.539) (-669.717) [-672.383] (-674.291) * (-671.912) [-676.656] (-672.526) (-672.699) -- 0:00:04
937500 -- [-670.511] (-672.400) (-674.847) (-671.579) * (-672.743) [-673.060] (-674.380) (-671.609) -- 0:00:04
938000 -- [-670.408] (-670.512) (-672.832) (-673.137) * (-669.045) (-670.157) (-669.450) [-669.511] -- 0:00:04
938500 -- [-670.415] (-669.933) (-670.587) (-673.198) * (-671.866) (-670.082) [-670.368] (-668.803) -- 0:00:03
939000 -- (-671.071) [-669.689] (-674.738) (-673.707) * (-670.288) [-670.564] (-668.771) (-672.240) -- 0:00:03
939500 -- (-672.986) (-669.252) (-674.335) [-669.038] * [-672.490] (-671.261) (-673.542) (-672.050) -- 0:00:03
940000 -- (-668.725) (-670.754) (-670.918) [-671.253] * (-671.198) (-671.098) [-669.125] (-671.536) -- 0:00:03
Average standard deviation of split frequencies: 0.006214
940500 -- (-671.918) (-671.653) [-671.615] (-669.597) * (-671.537) (-672.514) (-672.343) [-670.881] -- 0:00:03
941000 -- (-672.169) (-668.242) (-672.158) [-671.381] * (-668.516) (-675.262) (-674.991) [-670.017] -- 0:00:03
941500 -- (-671.750) [-669.859] (-670.722) (-669.016) * (-670.724) (-669.432) (-669.918) [-671.401] -- 0:00:03
942000 -- (-670.210) [-672.429] (-674.088) (-670.963) * (-672.652) [-668.868] (-670.705) (-671.206) -- 0:00:03
942500 -- (-670.539) (-668.814) [-673.006] (-673.673) * [-670.541] (-673.654) (-671.725) (-671.769) -- 0:00:03
943000 -- (-669.822) (-669.043) [-670.931] (-674.734) * (-673.137) (-671.366) (-671.173) [-671.142] -- 0:00:03
943500 -- (-669.186) (-670.051) (-671.479) [-668.526] * (-673.023) (-671.721) (-673.211) [-671.531] -- 0:00:03
944000 -- (-670.928) (-669.437) (-671.093) [-671.185] * (-674.456) (-669.365) [-668.091] (-671.563) -- 0:00:03
944500 -- [-673.528] (-674.134) (-670.577) (-669.452) * (-670.988) (-668.096) [-670.827] (-672.094) -- 0:00:03
945000 -- (-670.816) (-669.586) [-670.751] (-671.179) * (-671.271) (-667.468) [-672.331] (-669.655) -- 0:00:03
Average standard deviation of split frequencies: 0.006079
945500 -- (-667.716) (-669.676) [-669.611] (-671.629) * (-669.141) (-670.762) (-672.484) [-671.576] -- 0:00:03
946000 -- (-669.947) [-671.498] (-671.482) (-672.683) * (-674.169) (-671.139) [-670.106] (-671.829) -- 0:00:03
946500 -- (-669.326) (-673.866) [-673.231] (-678.309) * (-670.738) (-671.332) [-668.203] (-671.528) -- 0:00:03
947000 -- [-672.699] (-670.854) (-669.837) (-675.431) * (-671.469) (-670.907) [-669.620] (-670.410) -- 0:00:03
947500 -- (-674.551) (-675.105) [-670.226] (-672.128) * (-670.655) (-673.554) [-667.557] (-668.214) -- 0:00:03
948000 -- (-669.944) (-674.561) [-669.316] (-672.277) * (-673.449) [-671.365] (-668.026) (-670.064) -- 0:00:03
948500 -- [-670.642] (-675.521) (-670.815) (-670.271) * (-672.057) (-671.526) [-671.168] (-669.728) -- 0:00:03
949000 -- [-671.031] (-673.956) (-670.918) (-668.011) * (-672.425) (-671.868) (-671.186) [-672.178] -- 0:00:03
949500 -- (-670.761) [-673.018] (-672.213) (-670.385) * (-670.909) [-671.896] (-671.785) (-676.518) -- 0:00:03
950000 -- (-670.577) (-672.269) (-669.423) [-671.561] * (-672.264) [-672.743] (-669.465) (-673.245) -- 0:00:03
Average standard deviation of split frequencies: 0.006083
950500 -- (-674.625) (-676.872) [-668.446] (-668.759) * (-670.378) (-673.073) (-673.000) [-670.464] -- 0:00:03
951000 -- (-670.668) (-677.617) [-670.817] (-672.186) * (-670.984) [-672.463] (-673.617) (-673.089) -- 0:00:03
951500 -- (-669.753) (-674.870) [-671.515] (-671.595) * (-671.174) [-672.717] (-672.667) (-673.724) -- 0:00:03
952000 -- [-669.056] (-668.931) (-671.542) (-668.488) * (-672.285) [-670.520] (-678.793) (-672.502) -- 0:00:03
952500 -- (-669.905) [-672.565] (-670.259) (-668.842) * [-671.738] (-669.264) (-671.062) (-671.413) -- 0:00:03
953000 -- (-669.536) [-671.263] (-670.128) (-673.639) * (-671.214) (-670.419) (-670.341) [-670.300] -- 0:00:03
953500 -- (-671.385) (-672.533) (-674.068) [-671.398] * (-673.895) (-671.713) (-671.977) [-667.058] -- 0:00:03
954000 -- [-671.843] (-668.694) (-673.530) (-671.169) * (-670.288) (-669.168) (-667.844) [-670.897] -- 0:00:02
954500 -- (-669.935) (-677.377) (-673.827) [-670.455] * (-670.690) [-672.236] (-668.865) (-672.716) -- 0:00:02
955000 -- (-675.784) (-673.737) [-668.986] (-669.968) * [-671.297] (-672.980) (-672.989) (-674.837) -- 0:00:02
Average standard deviation of split frequencies: 0.006147
955500 -- [-669.499] (-671.134) (-674.307) (-672.513) * (-672.472) [-676.490] (-669.470) (-672.061) -- 0:00:02
956000 -- [-669.653] (-669.408) (-673.071) (-672.707) * (-673.755) (-668.039) (-670.986) [-668.528] -- 0:00:02
956500 -- [-670.369] (-669.618) (-672.225) (-670.223) * [-673.340] (-668.718) (-669.968) (-669.155) -- 0:00:02
957000 -- (-669.950) (-669.037) (-675.028) [-672.318] * (-670.553) (-671.339) [-670.137] (-669.007) -- 0:00:02
957500 -- (-670.793) (-670.923) [-670.044] (-668.224) * (-672.936) (-672.829) (-669.828) [-670.547] -- 0:00:02
958000 -- [-671.145] (-669.891) (-669.012) (-669.731) * (-671.033) [-672.509] (-670.769) (-671.070) -- 0:00:02
958500 -- (-672.661) [-669.330] (-669.369) (-670.669) * (-673.039) (-674.972) (-670.326) [-669.754] -- 0:00:02
959000 -- [-670.728] (-668.306) (-669.341) (-676.801) * [-670.504] (-674.021) (-672.702) (-670.256) -- 0:00:02
959500 -- (-670.245) [-670.431] (-670.850) (-670.344) * (-668.085) (-671.371) [-674.700] (-670.396) -- 0:00:02
960000 -- [-668.738] (-672.347) (-671.899) (-669.152) * (-668.308) (-671.941) (-669.001) [-671.915] -- 0:00:02
Average standard deviation of split frequencies: 0.005954
960500 -- (-670.076) (-673.249) (-670.310) [-669.208] * (-672.135) [-671.831] (-668.052) (-671.369) -- 0:00:02
961000 -- (-670.212) (-670.868) (-674.526) [-668.950] * (-669.886) (-675.878) [-668.049] (-669.774) -- 0:00:02
961500 -- (-669.140) (-671.732) [-668.773] (-671.163) * [-669.920] (-676.075) (-671.281) (-669.037) -- 0:00:02
962000 -- [-668.600] (-672.148) (-669.009) (-669.197) * (-669.794) (-673.632) [-672.184] (-673.270) -- 0:00:02
962500 -- (-670.617) (-671.111) [-668.382] (-668.642) * (-668.997) [-671.583] (-669.649) (-675.311) -- 0:00:02
963000 -- (-674.217) (-669.930) [-671.926] (-670.516) * (-670.453) (-674.879) [-671.986] (-673.798) -- 0:00:02
963500 -- [-670.982] (-671.241) (-667.852) (-672.223) * [-668.532] (-670.173) (-669.707) (-672.492) -- 0:00:02
964000 -- [-668.796] (-670.824) (-670.473) (-670.931) * (-668.122) (-671.206) [-668.123] (-673.936) -- 0:00:02
964500 -- [-669.801] (-669.535) (-671.342) (-670.724) * (-669.443) (-674.087) [-668.505] (-671.576) -- 0:00:02
965000 -- [-670.264] (-671.841) (-669.948) (-672.139) * (-672.010) (-673.879) [-669.938] (-668.793) -- 0:00:02
Average standard deviation of split frequencies: 0.006539
965500 -- (-672.035) [-667.955] (-672.834) (-671.252) * (-671.751) (-672.761) [-669.899] (-668.456) -- 0:00:02
966000 -- (-670.942) [-669.863] (-670.159) (-669.361) * (-673.357) [-672.507] (-673.079) (-667.811) -- 0:00:02
966500 -- (-674.694) (-669.396) [-668.619] (-668.249) * (-668.787) (-670.444) (-673.281) [-667.272] -- 0:00:02
967000 -- (-671.430) [-670.190] (-672.353) (-667.643) * (-668.799) (-671.041) [-668.739] (-669.018) -- 0:00:02
967500 -- (-671.904) (-668.879) (-667.394) [-668.425] * (-670.592) (-671.130) (-671.036) [-669.500] -- 0:00:02
968000 -- (-670.173) (-669.706) [-669.824] (-671.811) * (-670.664) (-671.008) [-672.052] (-669.055) -- 0:00:02
968500 -- (-672.357) [-671.054] (-667.480) (-670.311) * (-672.950) [-668.371] (-671.278) (-672.076) -- 0:00:02
969000 -- (-668.657) (-673.213) (-671.947) [-671.175] * [-669.086] (-670.377) (-674.188) (-670.219) -- 0:00:02
969500 -- [-669.632] (-671.377) (-671.220) (-671.750) * (-671.034) (-672.817) (-672.469) [-668.781] -- 0:00:01
970000 -- (-671.308) (-675.670) [-670.407] (-677.040) * (-671.103) (-670.178) [-669.978] (-669.231) -- 0:00:01
Average standard deviation of split frequencies: 0.006799
970500 -- [-672.130] (-672.639) (-668.726) (-677.735) * [-667.690] (-670.776) (-678.574) (-674.539) -- 0:00:01
971000 -- (-672.002) (-670.581) (-669.540) [-673.412] * [-669.259] (-672.757) (-670.696) (-671.550) -- 0:00:01
971500 -- [-673.866] (-670.891) (-672.753) (-673.714) * (-668.365) (-674.220) (-668.571) [-669.693] -- 0:00:01
972000 -- (-672.511) [-671.907] (-670.889) (-671.364) * [-672.646] (-670.075) (-669.519) (-671.383) -- 0:00:01
972500 -- (-670.906) [-669.225] (-672.376) (-670.680) * [-669.584] (-671.830) (-671.418) (-671.141) -- 0:00:01
973000 -- [-670.809] (-672.747) (-672.686) (-669.101) * (-671.865) (-669.717) (-673.892) [-670.013] -- 0:00:01
973500 -- [-668.217] (-670.424) (-668.363) (-667.483) * [-668.580] (-675.684) (-669.107) (-670.529) -- 0:00:01
974000 -- (-671.858) [-671.217] (-676.757) (-671.519) * (-669.384) (-671.163) (-673.279) [-669.611] -- 0:00:01
974500 -- (-670.148) [-672.577] (-670.064) (-670.677) * [-669.683] (-671.521) (-671.221) (-671.464) -- 0:00:01
975000 -- (-670.045) [-668.826] (-671.083) (-671.699) * (-670.244) (-670.117) [-669.954] (-671.834) -- 0:00:01
Average standard deviation of split frequencies: 0.006569
975500 -- (-671.998) [-674.807] (-668.362) (-670.740) * (-669.351) [-671.437] (-669.827) (-668.692) -- 0:00:01
976000 -- (-672.758) (-672.085) (-668.599) [-672.623] * (-669.292) [-669.611] (-668.744) (-674.344) -- 0:00:01
976500 -- (-668.149) (-671.331) (-671.489) [-670.471] * (-670.320) (-668.900) (-671.003) [-671.845] -- 0:00:01
977000 -- (-669.091) (-670.768) (-670.127) [-673.583] * (-669.106) (-671.796) (-669.243) [-672.661] -- 0:00:01
977500 -- (-671.456) (-669.423) [-673.115] (-671.856) * (-672.025) (-673.406) (-667.576) [-669.508] -- 0:00:01
978000 -- (-670.999) [-669.299] (-671.292) (-670.303) * (-671.233) (-678.859) (-671.049) [-669.759] -- 0:00:01
978500 -- (-671.217) (-676.962) (-672.052) [-672.016] * [-669.343] (-674.852) (-672.324) (-670.522) -- 0:00:01
979000 -- (-673.530) (-669.582) [-671.401] (-675.904) * (-668.598) (-674.577) (-670.774) [-671.129] -- 0:00:01
979500 -- (-670.866) [-670.012] (-671.326) (-672.308) * (-668.820) [-670.524] (-671.752) (-671.040) -- 0:00:01
980000 -- (-673.623) (-671.208) [-674.677] (-674.104) * (-670.851) (-671.238) (-670.007) [-668.045] -- 0:00:01
Average standard deviation of split frequencies: 0.006441
980500 -- (-671.708) (-674.459) [-674.852] (-669.044) * (-671.598) (-669.104) [-672.370] (-671.639) -- 0:00:01
981000 -- (-673.560) (-669.043) (-669.821) [-669.979] * (-669.762) (-672.895) [-670.194] (-675.704) -- 0:00:01
981500 -- (-670.905) [-672.526] (-670.024) (-668.544) * [-669.790] (-670.395) (-669.472) (-668.794) -- 0:00:01
982000 -- (-671.714) [-670.599] (-667.901) (-671.520) * [-667.867] (-668.805) (-672.223) (-670.516) -- 0:00:01
982500 -- [-672.843] (-670.695) (-668.166) (-669.303) * (-671.284) (-669.417) [-671.716] (-667.512) -- 0:00:01
983000 -- (-671.033) [-671.677] (-673.289) (-669.502) * (-671.019) (-674.140) (-671.876) [-668.043] -- 0:00:01
983500 -- (-671.507) (-670.941) (-672.982) [-667.622] * (-670.911) (-670.110) [-670.887] (-668.139) -- 0:00:01
984000 -- (-669.514) [-667.428] (-671.068) (-669.864) * [-671.206] (-671.060) (-674.735) (-670.273) -- 0:00:01
984500 -- (-669.633) (-669.282) (-673.463) [-668.569] * (-668.333) [-669.283] (-670.843) (-670.151) -- 0:00:01
985000 -- (-668.543) (-670.460) (-672.490) [-669.055] * (-671.442) (-670.202) (-671.328) [-670.553] -- 0:00:00
Average standard deviation of split frequencies: 0.006661
985500 -- (-673.283) [-667.338] (-671.173) (-670.948) * [-672.099] (-671.942) (-669.770) (-670.401) -- 0:00:00
986000 -- (-671.737) (-667.951) [-667.949] (-671.056) * (-672.097) [-669.442] (-670.308) (-669.174) -- 0:00:00
986500 -- (-672.329) [-668.696] (-671.991) (-669.507) * (-670.857) [-670.086] (-671.532) (-671.910) -- 0:00:00
987000 -- (-673.640) [-671.080] (-672.381) (-669.994) * [-669.565] (-671.422) (-672.565) (-671.363) -- 0:00:00
987500 -- (-671.904) [-670.852] (-674.165) (-670.727) * (-670.934) [-670.743] (-669.148) (-674.381) -- 0:00:00
988000 -- (-677.309) (-672.747) [-673.114] (-668.589) * (-670.707) [-668.890] (-671.862) (-672.627) -- 0:00:00
988500 -- (-671.249) [-669.381] (-668.686) (-667.215) * (-671.955) (-666.338) (-671.335) [-668.549] -- 0:00:00
989000 -- (-673.570) [-672.088] (-670.244) (-670.815) * (-672.181) (-668.690) [-670.022] (-668.220) -- 0:00:00
989500 -- (-669.446) [-671.903] (-682.479) (-672.232) * (-670.537) (-669.690) [-670.549] (-670.808) -- 0:00:00
990000 -- (-671.214) (-673.476) [-669.803] (-669.667) * [-673.362] (-670.252) (-675.190) (-672.840) -- 0:00:00
Average standard deviation of split frequencies: 0.006345
990500 -- (-668.820) (-668.722) (-671.414) [-668.724] * (-670.606) (-669.345) [-669.721] (-677.758) -- 0:00:00
991000 -- (-671.448) (-668.840) (-670.737) [-668.522] * (-671.601) (-671.651) [-670.695] (-670.952) -- 0:00:00
991500 -- (-670.579) (-669.772) (-669.285) [-669.750] * (-674.400) (-671.992) (-675.240) [-670.502] -- 0:00:00
992000 -- (-670.226) (-671.717) (-669.067) [-670.020] * (-670.791) [-671.197] (-677.174) (-670.013) -- 0:00:00
992500 -- (-671.885) (-670.266) [-670.430] (-672.037) * (-674.679) (-670.080) [-670.687] (-671.989) -- 0:00:00
993000 -- [-669.009] (-672.438) (-674.958) (-672.194) * (-670.362) [-675.620] (-670.410) (-670.958) -- 0:00:00
993500 -- [-669.275] (-669.690) (-674.071) (-670.715) * (-675.284) (-671.770) [-669.691] (-671.183) -- 0:00:00
994000 -- (-671.275) [-669.113] (-668.980) (-670.792) * [-673.388] (-672.096) (-676.735) (-670.968) -- 0:00:00
994500 -- (-668.327) (-670.342) (-668.200) [-668.969] * (-671.007) (-670.619) (-670.664) [-668.491] -- 0:00:00
995000 -- [-669.886] (-669.656) (-669.301) (-668.286) * (-668.503) (-671.821) (-669.446) [-670.340] -- 0:00:00
Average standard deviation of split frequencies: 0.006311
995500 -- (-669.969) (-668.966) [-669.836] (-671.041) * [-671.015] (-670.043) (-672.403) (-671.012) -- 0:00:00
996000 -- [-668.428] (-675.726) (-672.207) (-669.298) * (-667.276) (-672.762) (-669.886) [-670.862] -- 0:00:00
996500 -- [-672.080] (-673.035) (-670.890) (-674.154) * (-670.312) (-674.161) (-670.173) [-667.386] -- 0:00:00
997000 -- [-673.035] (-670.762) (-669.674) (-671.469) * (-670.048) [-673.403] (-670.322) (-675.739) -- 0:00:00
997500 -- (-672.275) [-668.762] (-673.072) (-670.279) * (-671.866) (-675.173) [-671.245] (-676.184) -- 0:00:00
998000 -- (-672.161) [-670.614] (-671.638) (-671.859) * (-670.558) [-671.548] (-668.829) (-668.608) -- 0:00:00
998500 -- (-672.545) (-672.063) (-671.496) [-668.378] * [-668.394] (-674.423) (-670.430) (-670.961) -- 0:00:00
999000 -- (-668.771) (-670.423) [-669.281] (-670.657) * (-667.431) (-669.748) [-673.788] (-669.231) -- 0:00:00
999500 -- (-673.160) (-669.200) (-675.866) [-670.011] * (-679.324) [-668.965] (-670.828) (-670.367) -- 0:00:00
1000000 -- (-671.674) [-669.458] (-673.316) (-668.659) * (-671.545) (-669.712) [-669.529] (-672.676) -- 0:00:00
Average standard deviation of split frequencies: 0.006847
Analysis completed in 1 mins 5 seconds
Analysis used 63.31 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -665.43
Likelihood of best state for "cold" chain of run 2 was -665.45
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 65 %) Dirichlet(Revmat{all})
97.8 % ( 94 %) Slider(Revmat{all})
32.2 % ( 23 %) Dirichlet(Pi{all})
32.5 % ( 23 %) Slider(Pi{all})
65.2 % ( 38 %) Multiplier(Alpha{1,2})
78.8 % ( 49 %) Multiplier(Alpha{3})
27.0 % ( 18 %) Slider(Pinvar{all})
97.2 % ( 99 %) ExtSPR(Tau{all},V{all})
68.8 % ( 68 %) ExtTBR(Tau{all},V{all})
98.1 % ( 99 %) NNI(Tau{all},V{all})
87.8 % ( 88 %) ParsSPR(Tau{all},V{all})
28.0 % ( 32 %) Multiplier(V{all})
94.4 % ( 96 %) Nodeslider(V{all})
30.4 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.3 % ( 68 %) Dirichlet(Revmat{all})
97.7 % ( 96 %) Slider(Revmat{all})
31.5 % ( 29 %) Dirichlet(Pi{all})
33.3 % ( 32 %) Slider(Pi{all})
65.9 % ( 36 %) Multiplier(Alpha{1,2})
79.9 % ( 57 %) Multiplier(Alpha{3})
27.6 % ( 20 %) Slider(Pinvar{all})
97.2 % ( 96 %) ExtSPR(Tau{all},V{all})
69.2 % ( 57 %) ExtTBR(Tau{all},V{all})
98.1 % ( 99 %) NNI(Tau{all},V{all})
87.8 % ( 82 %) ParsSPR(Tau{all},V{all})
28.1 % ( 22 %) Multiplier(V{all})
94.5 % ( 98 %) Nodeslider(V{all})
30.2 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 166816 0.82 0.66
3 | 166791 167054 0.83
4 | 166754 166467 166118
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.49
2 | 166955 0.82 0.66
3 | 166714 167074 0.83
4 | 166419 166384 166454
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -669.60
| 2 2 2 |
| 2 12 1 |
| 1 2 2 1 1 1 1|
| 2 1 1 22 1 1 1 1 |
|* 1 1 1 1 1 1 121 1 2 |
| 1 1 1 2 1 22 2 2 2 1 2 1 |
| 1 21 2 2 1 1 2 |
| 11 2 2 1 2 1 2 1 2|
| 2 1 1 2 11 1 * 1 2 1 |
| 2 2 1 2 2* 1 2 21 1 1 |
| 2 2 2 1 1 2 1 22 2 |
| 12 2 12 2 2 |
| 1 1 2 |
| 2 1 2 2 2 2 |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -671.80
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -669.35 -673.17
2 -669.53 -673.36
--------------------------------------
TOTAL -669.43 -673.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.869765 0.087917 0.345811 1.454291 0.836653 1409.92 1418.26 1.000
r(A<->C){all} 0.132670 0.014971 0.000012 0.383816 0.096269 217.66 243.64 1.000
r(A<->G){all} 0.141473 0.016452 0.000042 0.406753 0.105468 136.50 170.82 1.008
r(A<->T){all} 0.227505 0.026161 0.000087 0.534009 0.194074 98.86 176.77 1.006
r(C<->G){all} 0.164854 0.019196 0.000026 0.441694 0.126077 264.42 307.77 1.002
r(C<->T){all} 0.176937 0.021419 0.000024 0.482695 0.142050 199.77 302.81 1.000
r(G<->T){all} 0.156562 0.020062 0.000021 0.445118 0.119117 139.27 181.03 1.001
pi(A){all} 0.243433 0.000379 0.206571 0.282364 0.243091 1377.17 1392.63 1.001
pi(C){all} 0.254135 0.000389 0.215538 0.291861 0.253796 1315.14 1334.26 1.000
pi(G){all} 0.301998 0.000449 0.262198 0.345100 0.302231 1203.63 1234.31 1.001
pi(T){all} 0.200434 0.000342 0.166136 0.237150 0.199712 1001.94 1189.56 1.000
alpha{1,2} 0.284949 0.122287 0.000615 0.931898 0.180849 1223.38 1234.14 1.000
alpha{3} 0.408241 0.247204 0.000134 1.321192 0.238678 1263.21 1284.73 1.000
pinvar{all} 0.992301 0.000040 0.980501 0.999844 0.994056 1393.64 1447.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .*..*.
9 -- ...**.
10 -- .****.
11 -- .***.*
12 -- .*.***
13 -- .*...*
14 -- ...*.*
15 -- .*.*..
16 -- .**...
17 -- .**.**
18 -- ..*.*.
19 -- ..**..
20 -- ..****
21 -- ....**
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 452 0.150566 0.000942 0.149900 0.151233 2
8 449 0.149567 0.010835 0.141905 0.157229 2
9 442 0.147235 0.011306 0.139241 0.155230 2
10 441 0.146902 0.000471 0.146569 0.147235 2
11 440 0.146569 0.002827 0.144570 0.148568 2
12 438 0.145903 0.003769 0.143238 0.148568 2
13 436 0.145237 0.021670 0.129913 0.160560 2
14 431 0.143571 0.006124 0.139241 0.147901 2
15 423 0.140906 0.002355 0.139241 0.142572 2
16 422 0.140573 0.009422 0.133911 0.147235 2
17 421 0.140240 0.003298 0.137908 0.142572 2
18 416 0.138574 0.001884 0.137242 0.139907 2
19 416 0.138574 0.002827 0.136576 0.140573 2
20 411 0.136909 0.009893 0.129913 0.143904 2
21 410 0.136576 0.015075 0.125916 0.147235 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.091568 0.008695 0.000021 0.277196 0.062237 1.000 2
length{all}[2] 0.091222 0.008945 0.000048 0.284901 0.061050 1.000 2
length{all}[3] 0.150437 0.016382 0.000037 0.401908 0.119119 1.000 2
length{all}[4] 0.087476 0.008222 0.000009 0.267114 0.059296 1.000 2
length{all}[5] 0.089529 0.008776 0.000017 0.278453 0.060900 1.000 2
length{all}[6] 0.085622 0.007634 0.000058 0.262393 0.059426 1.000 2
length{all}[7] 0.093192 0.009461 0.000182 0.296015 0.065040 0.998 2
length{all}[8] 0.087092 0.007599 0.000174 0.284198 0.059280 1.000 2
length{all}[9] 0.089614 0.010165 0.000011 0.292137 0.056709 0.998 2
length{all}[10] 0.092919 0.008763 0.000100 0.268361 0.062021 0.998 2
length{all}[11] 0.095414 0.008037 0.000040 0.272615 0.072286 0.998 2
length{all}[12] 0.091078 0.008319 0.000436 0.280525 0.064339 1.000 2
length{all}[13] 0.091585 0.009475 0.000138 0.281525 0.060702 0.998 2
length{all}[14] 0.090414 0.008455 0.000317 0.255988 0.062991 0.998 2
length{all}[15] 0.086205 0.007187 0.000015 0.238142 0.055270 0.998 2
length{all}[16] 0.091437 0.009480 0.000226 0.286202 0.059573 0.998 2
length{all}[17] 0.085287 0.007300 0.000075 0.260117 0.056246 0.998 2
length{all}[18] 0.090126 0.008438 0.000295 0.282293 0.061244 0.998 2
length{all}[19] 0.095186 0.009331 0.000680 0.291712 0.062580 0.998 2
length{all}[20] 0.093173 0.006907 0.000229 0.257786 0.070344 0.998 2
length{all}[21] 0.098881 0.010075 0.000066 0.303720 0.068645 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006847
Maximum standard deviation of split frequencies = 0.021670
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------- C1 (1)
|
|------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------ C4 (4)
|
|------------------------------------- C5 (5)
|
\------------------------------------ C6 (6)
|-----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 477
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 53 patterns at 159 / 159 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 53 patterns at 159 / 159 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
51728 bytes for conP
4664 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.011003 0.107627 0.039086 0.037999 0.045110 0.014312 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -670.251363
Iterating by ming2
Initial: fx= 670.251363
x= 0.01100 0.10763 0.03909 0.03800 0.04511 0.01431 0.30000 1.30000
1 h-m-p 0.0000 0.0001 371.6065 ++ 660.575362 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 3416.2918 ++ 658.454434 m 0.0000 24 | 2/8
3 h-m-p 0.0001 0.0012 64.8671 ++ 646.702821 m 0.0012 35 | 3/8
4 h-m-p 0.0000 0.0001 118.7811 ++ 644.475582 m 0.0001 46 | 4/8
5 h-m-p 0.0000 0.0004 357.5313 +++ 633.517477 m 0.0004 58 | 5/8
6 h-m-p 0.0957 0.4785 0.4809 +YYCCC 633.181260 4 0.3179 76 | 5/8
7 h-m-p 0.0172 0.0860 0.5923 ++ 633.158406 m 0.0860 90 | 6/8
8 h-m-p 0.0278 8.0000 0.0569 ++YC 633.154504 1 0.7122 107 | 6/8
9 h-m-p 0.8678 8.0000 0.0467 ++ 633.131333 m 8.0000 120 | 6/8
10 h-m-p 0.6234 8.0000 0.5990 ++ 633.080672 m 8.0000 133 | 6/8
11 h-m-p 1.6000 8.0000 0.3411 YCCC 633.069932 3 1.0204 151 | 6/8
12 h-m-p 1.0092 8.0000 0.3449 ++ 633.063962 m 8.0000 164 | 6/8
13 h-m-p 0.9631 8.0000 2.8651 ++ 633.053826 m 8.0000 177 | 6/8
14 h-m-p 1.6000 8.0000 2.1091 C 633.053164 0 1.7678 188 | 6/8
15 h-m-p 1.4871 8.0000 2.5072 ++ 633.051778 m 8.0000 199 | 6/8
16 h-m-p 1.6000 8.0000 12.2176 YC 633.050737 1 3.8673 211 | 6/8
17 h-m-p 1.6000 8.0000 11.8423 CC 633.050281 1 2.2086 224 | 6/8
18 h-m-p 1.5286 8.0000 17.1097 ++ 633.049801 m 8.0000 235 | 6/8
19 h-m-p 1.6000 8.0000 29.0681 C 633.049610 0 1.6471 246 | 6/8
20 h-m-p 1.2839 8.0000 37.2913 ++ 633.049390 m 8.0000 257 | 6/8
21 h-m-p 0.7414 3.7072 104.1872 +C 633.049323 0 2.8981 269 | 6/8
22 h-m-p 0.1359 0.6797 124.0133 ++ 633.049300 m 0.6797 280 | 7/8
23 h-m-p 0.5620 8.0000 0.0000 Y 633.049293 0 1.0190 291 | 7/8
24 h-m-p 1.6000 8.0000 0.0000 ----C 633.049293 0 0.0016 307
Out..
lnL = -633.049293
308 lfun, 308 eigenQcodon, 1848 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.029162 0.089302 0.043574 0.032442 0.058972 0.057788 0.000100 0.813083 0.519839
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.666253
np = 9
lnL0 = -677.183644
Iterating by ming2
Initial: fx= 677.183644
x= 0.02916 0.08930 0.04357 0.03244 0.05897 0.05779 0.00011 0.81308 0.51984
1 h-m-p 0.0000 0.0000 354.4027 ++ 676.937830 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 41474.4249 ++ 652.087135 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0000 321.0100 ++ 650.076950 m 0.0000 38 | 3/9
4 h-m-p 0.0000 0.0000 11166.9125 ++ 638.355097 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0000 2929.5744 ++ 637.992431 m 0.0000 62 | 5/9
6 h-m-p 0.0000 0.0000 2140.2253 ++ 633.334747 m 0.0000 74 | 6/9
7 h-m-p 0.0306 0.2173 1.2622 YCCCC 633.258311 4 0.0663 93 | 6/9
8 h-m-p 1.6000 8.0000 0.0431 ++ 633.201644 m 8.0000 105 | 6/9
9 h-m-p 0.2999 1.4997 0.1837 ++ 633.184019 m 1.4997 120 | 7/9
10 h-m-p 1.6000 8.0000 0.0158 YC 633.182508 1 1.0420 136 | 7/9
11 h-m-p 1.6000 8.0000 0.0002 Y 633.182508 0 1.1065 150 | 7/9
12 h-m-p 1.6000 8.0000 0.0000 ---C 633.182508 0 0.0063 167 | 7/9
13 h-m-p 0.0160 8.0000 0.0000 -C 633.182508 0 0.0010 182
Out..
lnL = -633.182508
183 lfun, 549 eigenQcodon, 2196 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.081209 0.060692 0.086675 0.048127 0.101457 0.054717 0.000100 1.209302 0.147235 0.452912 1038.405531
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.057572
np = 11
lnL0 = -658.664957
Iterating by ming2
Initial: fx= 658.664957
x= 0.08121 0.06069 0.08667 0.04813 0.10146 0.05472 0.00011 1.20930 0.14723 0.45291 951.42857
1 h-m-p 0.0000 0.0000 55.8618 ++ 658.640219 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0216 22.6997 +++++ 649.892370 m 0.0216 33 | 2/11
3 h-m-p 0.0001 0.0003 76.6923 ++ 649.166462 m 0.0003 47 | 3/11
4 h-m-p 0.0003 0.0014 54.0742 ++ 648.167755 m 0.0014 61 | 4/11
5 h-m-p 0.0001 0.0003 600.2278 ++ 646.377527 m 0.0003 75 | 5/11
6 h-m-p 0.0006 0.0029 15.7088 ++ 645.377218 m 0.0029 89 | 6/11
7 h-m-p 0.0001 0.0024 436.8092 ++YYCYYCCCCC 633.059305 9 0.0024 121 | 6/11
8 h-m-p 1.5476 7.7381 0.0038 ---C 633.059305 0 0.0052 138 | 6/11
9 h-m-p 0.0160 8.0000 0.0030 +++++ 633.059182 m 8.0000 160 | 6/11
10 h-m-p 0.0206 8.0000 1.1582 +++YYYC 633.055584 3 1.2304 185 | 6/11
11 h-m-p 1.6000 8.0000 0.0689 YC 633.055385 1 1.1558 200 | 6/11
12 h-m-p 0.9315 8.0000 0.0855 C 633.055372 0 1.0383 219 | 6/11
13 h-m-p 1.6000 8.0000 0.0030 ++ 633.055359 m 8.0000 238 | 6/11
14 h-m-p 0.2559 8.0000 0.0953 ++YC 633.055214 1 2.6834 260 | 6/11
15 h-m-p 1.6000 8.0000 0.0345 ++ 633.054080 m 8.0000 279 | 6/11
16 h-m-p 0.2647 7.4774 1.0421 +CC 633.051257 1 1.4545 301 | 6/11
17 h-m-p 1.6000 8.0000 0.4027 CY 633.050278 1 1.6688 317 | 6/11
18 h-m-p 1.1872 8.0000 0.5660 YC 633.049690 1 2.6747 337 | 6/11
19 h-m-p 1.6000 8.0000 0.4362 YC 633.049460 1 2.6119 357 | 6/11
20 h-m-p 1.0208 5.1038 0.5866 YC 633.049365 1 2.2780 377 | 6/11
21 h-m-p 0.6945 3.4726 0.4791 +Y 633.049325 0 2.9243 397 | 6/11
22 h-m-p 0.0938 0.4689 0.5589 ++ 633.049319 m 0.4689 416 | 7/11
23 h-m-p 0.2188 8.0000 1.1945 +Y 633.049307 0 1.6606 436 | 7/11
24 h-m-p 1.6000 8.0000 0.3040 C 633.049303 0 2.1829 450 | 7/11
25 h-m-p 1.3806 8.0000 0.4806 +C 633.049301 0 5.1672 469 | 7/11
26 h-m-p 1.6000 8.0000 0.4036 C 633.049301 0 1.4013 487 | 7/11
27 h-m-p 1.3493 8.0000 0.4191 ++ 633.049300 m 8.0000 505 | 7/11
28 h-m-p 1.6000 8.0000 0.3641 Y 633.049300 0 1.2338 523 | 7/11
29 h-m-p 1.0280 8.0000 0.4370 ++ 633.049300 m 8.0000 541 | 7/11
30 h-m-p 1.6000 8.0000 0.3329 C 633.049300 0 1.7854 559 | 7/11
31 h-m-p 1.0911 8.0000 0.5448 Y 633.049300 0 1.9402 577 | 7/11
32 h-m-p 0.5753 8.0000 1.8373 ++ 633.049300 m 8.0000 595 | 7/11
33 h-m-p 0.6792 4.7032 21.6420 ++ 633.049300 m 4.7032 609 | 7/11
34 h-m-p -0.0000 -0.0000 971.9381
h-m-p: -0.00000000e+00 -0.00000000e+00 9.71938127e+02 633.049300
.. | 7/11
35 h-m-p 0.0160 8.0000 0.0012 --C 633.049300 0 0.0002 636 | 7/11
36 h-m-p 0.6658 8.0000 0.0000 --Y 633.049300 0 0.0058 656
Out..
lnL = -633.049300
657 lfun, 2628 eigenQcodon, 11826 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -637.992350 S = -636.553497 -2.367423
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:04
did 20 / 53 patterns 0:04
did 30 / 53 patterns 0:04
did 40 / 53 patterns 0:04
did 50 / 53 patterns 0:04
did 53 / 53 patterns 0:04
Time used: 0:04
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.022529 0.089867 0.062826 0.041391 0.059779 0.028421 0.000100 0.737192 1.337861
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 18.745187
np = 9
lnL0 = -673.233746
Iterating by ming2
Initial: fx= 673.233746
x= 0.02253 0.08987 0.06283 0.04139 0.05978 0.02842 0.00011 0.73719 1.33786
1 h-m-p 0.0000 0.0000 321.8258 ++ 673.123596 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0006 124.7583 ++YCYYYYYYCC 667.231480 10 0.0005 41 | 1/9
3 h-m-p 0.0008 0.0042 79.2321 ++ 649.638352 m 0.0042 53 | 2/9
4 h-m-p 0.0000 0.0001 104.3879 ++ 647.194149 m 0.0001 65 | 3/9
5 h-m-p 0.0001 0.0009 85.6814 ++ 643.488783 m 0.0009 77 | 4/9
6 h-m-p 0.0001 0.0003 80.2334 ++ 638.881524 m 0.0003 89 | 5/9
7 h-m-p 0.0003 0.0022 61.6634 ++ 633.939923 m 0.0022 101 | 6/9
8 h-m-p 0.7328 3.6641 0.1362 YCCCC 633.651928 4 1.3837 120 | 6/9
9 h-m-p 0.3016 5.9024 0.6246 YCCCC 633.514640 4 0.1609 142 | 6/9
10 h-m-p 0.6254 8.0000 0.1607 ++ 633.212765 m 8.0000 157 | 6/9
11 h-m-p 0.0275 0.1376 0.6641 ++ 633.197246 m 0.1376 172
QuantileBeta(0.85, 0.86736, 0.00494) = 1.000000e+00 2000 rounds
| 7/9
12 h-m-p 0.9395 8.0000 0.0256 CYC 633.182509 2 1.1623 190 | 7/9
13 h-m-p 1.6000 8.0000 0.0000 C 633.182508 0 1.3487 204 | 7/9
14 h-m-p 1.6000 8.0000 0.0000 ------C 633.182508 0 0.0001 224
Out..
lnL = -633.182508
225 lfun, 2475 eigenQcodon, 13500 P(t)
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.080255 0.066914 0.015114 0.057755 0.025415 0.095032 0.000100 0.900000 1.144154 1.761105 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.104310
np = 11
lnL0 = -650.047075
Iterating by ming2
Initial: fx= 650.047075
x= 0.08026 0.06691 0.01511 0.05776 0.02541 0.09503 0.00011 0.90000 1.14415 1.76111 951.42857
1 h-m-p 0.0000 0.0000 120.9360 ++ 649.755026 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0002 573.9858 ++YYYYYYYYCC 638.403573 10 0.0002 43 | 1/11
3 h-m-p 0.0007 0.0036 8.0354 YCCC 638.390879 3 0.0004 62 | 1/11
4 h-m-p 0.0036 0.1801 0.9028 +++ 637.558742 m 0.1801 77 | 2/11
5 h-m-p 0.0015 0.0077 19.3482 CCC 637.555740 2 0.0013 105 | 2/11
6 h-m-p 0.0137 0.6762 1.8569 ++CYYYC 637.123531 4 0.4383 127 | 2/11
7 h-m-p 0.0394 0.1970 0.3595 --------------.. | 2/11
8 h-m-p 0.0000 0.0001 109.8870 CYCCC 637.010797 4 0.0000 183 | 2/11
9 h-m-p 0.0000 0.0016 87.1727 +++YCCC 635.546280 3 0.0014 205 | 2/11
10 h-m-p 0.0000 0.0002 19.3744 ++ 635.464292 m 0.0002 219 | 3/11
11 h-m-p 0.0011 0.0137 3.4661 ++ 635.228216 m 0.0137 233 | 4/11
12 h-m-p 0.0032 0.0162 1.2562 ++ 635.028789 m 0.0162 247 | 5/11
13 h-m-p 0.0021 0.0104 3.7218 ++ 634.318928 m 0.0104 261 | 6/11
14 h-m-p 0.0160 8.0000 0.4271 +++CYCC 634.251805 3 0.8747 283 | 6/11
15 h-m-p 1.3862 6.9308 0.0806 ++ 633.586505 m 6.9308 302 | 6/11
16 h-m-p 0.0000 0.0000 584.7983
h-m-p: 0.00000000e+00 0.00000000e+00 5.84798262e+02 633.586505
.. | 6/11
17 h-m-p 0.0000 0.0002 1225.3474 +CYCYC 633.052979 4 0.0001 340 | 6/11
18 h-m-p 0.1585 8.0000 0.6914 -----C 633.052968 0 0.0000 359 | 6/11
19 h-m-p 1.6000 8.0000 0.0000 ++ 633.052967 m 8.0000 378 | 6/11
20 h-m-p 0.0160 8.0000 0.0752 ++++CC 633.051530 1 3.8094 403 | 6/11
21 h-m-p 1.6000 8.0000 0.0531 CC 633.050506 1 2.3467 424 | 6/11
22 h-m-p 1.6000 8.0000 0.0653 ++ 633.049809 m 8.0000 443 | 6/11
23 h-m-p 1.3605 6.8027 0.2195 +CC 633.049475 1 4.6412 465 | 6/11
24 h-m-p 0.2487 1.2437 0.3815 ++ 633.049301 m 1.2437 484 | 7/11
25 h-m-p 1.6000 8.0000 0.0380 Y 633.049300 0 0.9067 503 | 7/11
26 h-m-p 1.6000 8.0000 0.0007 ---Y 633.049300 0 0.0040 524
Out..
lnL = -633.049300
525 lfun, 6300 eigenQcodon, 34650 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -637.730194 S = -636.552435 -1.981237
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 53 patterns 0:17
did 20 / 53 patterns 0:17
did 30 / 53 patterns 0:17
did 40 / 53 patterns 0:17
did 50 / 53 patterns 0:17
did 53 / 53 patterns 0:18
Time used: 0:18
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=159
NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
NC_002677_1_NP_302363_1_1235_bfrA MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
NZ_CP029543_1_WP_010908683_1_2193_bfr MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
NZ_AP014567_1_WP_010908683_1_2254_bfr MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
*** **********************************************
NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
NC_002677_1_NP_302363_1_1235_bfrA EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
NZ_CP029543_1_WP_010908683_1_2193_bfr EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
NZ_AP014567_1_WP_010908683_1_2254_bfr EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
**************************************************
NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
NC_002677_1_NP_302363_1_1235_bfrA LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
NZ_CP029543_1_WP_010908683_1_2193_bfr LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
NZ_AP014567_1_WP_010908683_1_2254_bfr LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
**************************************************
NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 AQCVSRPPS
NC_002677_1_NP_302363_1_1235_bfrA AQCVSRPPS
NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 AQCVSRPPS
NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 AQCVSRPPS
NZ_CP029543_1_WP_010908683_1_2193_bfr AQCVSRPPS
NZ_AP014567_1_WP_010908683_1_2254_bfr AQCVSRPPS
*********
>NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT >NC_002677_1_NP_302363_1_1235_bfrA ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT >NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 ATGCAAGGTGTTCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT >NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT >NZ_CP029543_1_WP_010908683_1_2193_bfr ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT >NZ_AP014567_1_WP_010908683_1_2254_bfr ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG GCGCAATGCGTCTCCCGGCCGCCGAGT
>NC_011896_1_WP_010908683_1_2172_MLBR_RS10310 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS >NC_002677_1_NP_302363_1_1235_bfrA MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS >NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS >NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS >NZ_CP029543_1_WP_010908683_1_2193_bfr MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS >NZ_AP014567_1_WP_010908683_1_2254_bfr MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS AQCVSRPPS
#NEXUS
[ID: 8058583201]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908683_1_2172_MLBR_RS10310
NC_002677_1_NP_302363_1_1235_bfrA
NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940
NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330
NZ_CP029543_1_WP_010908683_1_2193_bfr
NZ_AP014567_1_WP_010908683_1_2254_bfr
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908683_1_2172_MLBR_RS10310,
2 NC_002677_1_NP_302363_1_1235_bfrA,
3 NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940,
4 NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330,
5 NZ_CP029543_1_WP_010908683_1_2193_bfr,
6 NZ_AP014567_1_WP_010908683_1_2254_bfr
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06223747,2:0.06104991,3:0.119119,4:0.05929587,5:0.06089969,6:0.05942605);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06223747,2:0.06104991,3:0.119119,4:0.05929587,5:0.06089969,6:0.05942605);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -669.35 -673.17
2 -669.53 -673.36
--------------------------------------
TOTAL -669.43 -673.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.869765 0.087917 0.345811 1.454291 0.836653 1409.92 1418.26 1.000
r(A<->C){all} 0.132670 0.014971 0.000012 0.383816 0.096269 217.66 243.64 1.000
r(A<->G){all} 0.141473 0.016452 0.000042 0.406753 0.105468 136.50 170.82 1.008
r(A<->T){all} 0.227505 0.026161 0.000087 0.534009 0.194074 98.86 176.77 1.006
r(C<->G){all} 0.164854 0.019196 0.000026 0.441694 0.126077 264.42 307.77 1.002
r(C<->T){all} 0.176937 0.021419 0.000024 0.482695 0.142050 199.77 302.81 1.000
r(G<->T){all} 0.156562 0.020062 0.000021 0.445118 0.119117 139.27 181.03 1.001
pi(A){all} 0.243433 0.000379 0.206571 0.282364 0.243091 1377.17 1392.63 1.001
pi(C){all} 0.254135 0.000389 0.215538 0.291861 0.253796 1315.14 1334.26 1.000
pi(G){all} 0.301998 0.000449 0.262198 0.345100 0.302231 1203.63 1234.31 1.001
pi(T){all} 0.200434 0.000342 0.166136 0.237150 0.199712 1001.94 1189.56 1.000
alpha{1,2} 0.284949 0.122287 0.000615 0.931898 0.180849 1223.38 1234.14 1.000
alpha{3} 0.408241 0.247204 0.000134 1.321192 0.238678 1263.21 1284.73 1.000
pinvar{all} 0.992301 0.000040 0.980501 0.999844 0.994056 1393.64 1447.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/bfrA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 159
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 2 2 2 2 2 2 | TAC 4 4 4 4 4 4 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 8 8 8 8 8 8 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 1 1 1 1 1 1
CTC 2 2 2 2 2 2 | CCC 1 1 1 1 1 1 | CAC 2 2 2 2 2 2 | CGC 6 6 6 6 6 6
CTA 2 2 2 2 2 2 | CCA 0 0 0 0 0 0 | Gln CAA 6 6 6 6 6 6 | CGA 0 0 0 0 0 0
CTG 6 6 6 6 6 6 | CCG 4 4 4 4 4 4 | CAG 5 5 5 5 5 5 | CGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 0 0 0 0 0 0 | Asn AAT 1 1 1 1 1 1 | Ser AGT 3 3 3 3 3 3
ATC 7 7 7 7 7 7 | ACC 6 6 6 6 6 6 | AAC 3 3 3 3 3 3 | AGC 2 2 2 2 2 2
ATA 1 1 1 1 1 1 | ACA 0 0 0 0 0 0 | Lys AAA 1 1 1 1 1 1 | Arg AGA 0 0 0 0 0 0
Met ATG 6 6 6 6 6 6 | ACG 2 2 2 2 2 2 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 1 1 2 1 1 1 | Ala GCT 3 3 3 3 3 3 | Asp GAT 3 3 2 3 3 3 | Gly GGT 2 2 2 2 2 2
GTC 2 2 2 2 2 2 | GCC 1 1 1 1 1 1 | GAC 6 6 6 6 6 6 | GGC 2 2 2 2 2 2
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 7 7 7 7 7 7 | GGA 1 1 1 1 1 1
GTG 3 3 3 3 3 3 | GCG 4 4 4 4 4 4 | GAG 13 13 13 13 13 13 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908683_1_2172_MLBR_RS10310
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30189 C:0.17610 A:0.35220 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19916 C:0.25577 A:0.24109 G:0.30398
#2: NC_002677_1_NP_302363_1_1235_bfrA
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30189 C:0.17610 A:0.35220 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19916 C:0.25577 A:0.24109 G:0.30398
#3: NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30818 C:0.17610 A:0.34591 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.20126 C:0.25577 A:0.23899 G:0.30398
#4: NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30189 C:0.17610 A:0.35220 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19916 C:0.25577 A:0.24109 G:0.30398
#5: NZ_CP029543_1_WP_010908683_1_2193_bfr
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30189 C:0.17610 A:0.35220 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19916 C:0.25577 A:0.24109 G:0.30398
#6: NZ_AP014567_1_WP_010908683_1_2254_bfr
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30189 C:0.17610 A:0.35220 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19916 C:0.25577 A:0.24109 G:0.30398
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 18 | TCC 12 | TAC 24 | TGC 12
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 48 | TCG 12 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 6
CTC 12 | CCC 6 | CAC 12 | CGC 36
CTA 12 | CCA 0 | Gln Q CAA 36 | CGA 0
CTG 36 | CCG 24 | CAG 30 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 0 | Asn N AAT 6 | Ser S AGT 18
ATC 42 | ACC 36 | AAC 18 | AGC 12
ATA 6 | ACA 0 | Lys K AAA 6 | Arg R AGA 0
Met M ATG 36 | ACG 12 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 7 | Ala A GCT 18 | Asp D GAT 17 | Gly G GGT 12
GTC 12 | GCC 6 | GAC 36 | GGC 12
GTA 6 | GCA 12 | Glu E GAA 42 | GGA 6
GTG 18 | GCG 24 | GAG 78 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16352 C:0.27044 A:0.22642 G:0.33962
position 2: T:0.30294 C:0.17610 A:0.35115 G:0.16981
position 3: T:0.13208 C:0.32075 A:0.14465 G:0.40252
Average T:0.19951 C:0.25577 A:0.24074 G:0.30398
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 8): -633.049293 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006248 0.000004 0.000004 0.000004 0.000100 999.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006268
(1: 0.000004, 2: 0.000004, 3: 0.006248, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908683_1_2172_MLBR_RS10310: 0.000004, NC_002677_1_NP_302363_1_1235_bfrA: 0.000004, NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940: 0.006248, NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330: 0.000004, NZ_CP029543_1_WP_010908683_1_2193_bfr: 0.000004, NZ_AP014567_1_WP_010908683_1_2254_bfr: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
omega (dN/dS) = 999.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.8 72.2 999.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 404.8 72.2 999.0000 0.0000 0.0000 0.0 0.0
7..3 0.006 404.8 72.2 999.0000 0.0025 0.0000 1.0 0.0
7..4 0.000 404.8 72.2 999.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 404.8 72.2 999.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 404.8 72.2 999.0000 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0025
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -633.182508 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006442 0.000004 0.000004 0.000004 0.000100 0.418956 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006462
(1: 0.000004, 2: 0.000004, 3: 0.006442, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908683_1_2172_MLBR_RS10310: 0.000004, NC_002677_1_NP_302363_1_1235_bfrA: 0.000004, NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940: 0.006442, NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330: 0.000004, NZ_CP029543_1_WP_010908683_1_2193_bfr: 0.000004, NZ_AP014567_1_WP_010908683_1_2254_bfr: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.41896 0.58104
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.006 404.8 72.2 1.0000 0.0021 0.0021 0.9 0.2
7..4 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -633.049300 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006248 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 1.000000 952.779007
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006268
(1: 0.000004, 2: 0.000004, 3: 0.006248, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908683_1_2172_MLBR_RS10310: 0.000004, NC_002677_1_NP_302363_1_1235_bfrA: 0.000004, NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940: 0.006248, NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330: 0.000004, NZ_CP029543_1_WP_010908683_1_2193_bfr: 0.000004, NZ_AP014567_1_WP_010908683_1_2254_bfr: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 1.00000 1.00000 952.77901
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.8 72.2 952.7790 0.0000 0.0000 0.0 0.0
7..2 0.000 404.8 72.2 952.7790 0.0000 0.0000 0.0 0.0
7..3 0.006 404.8 72.2 952.7790 0.0025 0.0000 1.0 0.0
7..4 0.000 404.8 72.2 952.7790 0.0000 0.0000 0.0 0.0
7..5 0.000 404.8 72.2 952.7790 0.0000 0.0000 0.0 0.0
7..6 0.000 404.8 72.2 952.7790 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908683_1_2172_MLBR_RS10310)
Pr(w>1) post mean +- SE for w
1 M 1.000** 952.779
2 Q 1.000** 952.779
3 G 1.000** 952.779
4 D 1.000** 952.779
5 P 1.000** 952.779
6 D 1.000** 952.779
7 V 1.000** 952.779
8 L 1.000** 952.779
9 R 1.000** 952.779
10 L 1.000** 952.779
11 L 1.000** 952.779
12 N 1.000** 952.779
13 E 1.000** 952.779
14 Q 1.000** 952.779
15 L 1.000** 952.779
16 T 1.000** 952.779
17 S 1.000** 952.779
18 E 1.000** 952.779
19 L 1.000** 952.779
20 T 1.000** 952.779
21 A 1.000** 952.779
22 I 1.000** 952.779
23 N 1.000** 952.779
24 Q 1.000** 952.779
25 Y 1.000** 952.779
26 F 1.000** 952.779
27 L 1.000** 952.779
28 H 1.000** 952.779
29 S 1.000** 952.779
30 K 1.000** 952.779
31 M 1.000** 952.779
32 Q 1.000** 952.779
33 E 1.000** 952.779
34 N 1.000** 952.779
35 W 1.000** 952.779
36 G 1.000** 952.779
37 F 1.000** 952.779
38 T 1.000** 952.779
39 E 1.000** 952.779
40 L 1.000** 952.779
41 A 1.000** 952.779
42 E 1.000** 952.779
43 R 1.000** 952.779
44 T 1.000** 952.779
45 R 1.000** 952.779
46 V 1.000** 952.779
47 E 1.000** 952.779
48 S 1.000** 952.779
49 F 1.000** 952.779
50 D 1.000** 952.779
51 E 1.000** 952.779
52 M 1.000** 952.779
53 R 1.000** 952.779
54 H 1.000** 952.779
55 A 1.000** 952.779
56 E 1.000** 952.779
57 A 1.000** 952.779
58 I 1.000** 952.779
59 T 1.000** 952.779
60 D 1.000** 952.779
61 R 1.000** 952.779
62 I 1.000** 952.779
63 L 1.000** 952.779
64 L 1.000** 952.779
65 L 1.000** 952.779
66 D 1.000** 952.779
67 G 1.000** 952.779
68 L 1.000** 952.779
69 P 1.000** 952.779
70 N 1.000** 952.779
71 Y 1.000** 952.779
72 Q 1.000** 952.779
73 R 1.000** 952.779
74 I 1.000** 952.779
75 G 1.000** 952.779
76 S 1.000** 952.779
77 L 1.000** 952.779
78 R 1.000** 952.779
79 V 1.000** 952.779
80 G 1.000** 952.779
81 Q 1.000** 952.779
82 T 1.000** 952.779
83 L 1.000** 952.779
84 R 1.000** 952.779
85 E 1.000** 952.779
86 Q 1.000** 952.779
87 F 1.000** 952.779
88 E 1.000** 952.779
89 A 1.000** 952.779
90 D 1.000** 952.779
91 L 1.000** 952.779
92 A 1.000** 952.779
93 I 1.000** 952.779
94 E 1.000** 952.779
95 Y 1.000** 952.779
96 E 1.000** 952.779
97 V 1.000** 952.779
98 M 1.000** 952.779
99 S 1.000** 952.779
100 R 1.000** 952.779
101 L 1.000** 952.779
102 K 1.000** 952.779
103 P 1.000** 952.779
104 G 1.000** 952.779
105 I 1.000** 952.779
106 I 1.000** 952.779
107 M 1.000** 952.779
108 C 1.000** 952.779
109 R 1.000** 952.779
110 E 1.000** 952.779
111 K 1.000** 952.779
112 Q 1.000** 952.779
113 D 1.000** 952.779
114 S 1.000** 952.779
115 T 1.000** 952.779
116 S 1.000** 952.779
117 A 1.000** 952.779
118 V 1.000** 952.779
119 L 1.000** 952.779
120 L 1.000** 952.779
121 E 1.000** 952.779
122 K 1.000** 952.779
123 I 1.000** 952.779
124 V 1.000** 952.779
125 A 1.000** 952.779
126 D 1.000** 952.779
127 E 1.000** 952.779
128 E 1.000** 952.779
129 E 1.000** 952.779
130 H 1.000** 952.779
131 I 1.000** 952.779
132 D 1.000** 952.779
133 Y 1.000** 952.779
134 L 1.000** 952.779
135 E 1.000** 952.779
136 T 1.000** 952.779
137 Q 1.000** 952.779
138 L 1.000** 952.779
139 A 1.000** 952.779
140 L 1.000** 952.779
141 M 1.000** 952.779
142 G 1.000** 952.779
143 Q 1.000** 952.779
144 L 1.000** 952.779
145 G 1.000** 952.779
146 E 1.000** 952.779
147 E 1.000** 952.779
148 L 1.000** 952.779
149 Y 1.000** 952.779
150 S 1.000** 952.779
151 A 1.000** 952.779
152 Q 1.000** 952.779
153 C 1.000** 952.779
154 V 1.000** 952.779
155 S 1.000** 952.779
156 R 1.000** 952.779
157 P 1.000** 952.779
158 P 1.000** 952.779
159 S 1.000** 952.779
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908683_1_2172_MLBR_RS10310)
Pr(w>1) post mean +- SE for w
4 D 0.800 6.073 +- 3.440
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.094 0.095 0.097 0.098 0.099 0.101 0.102 0.103 0.105 0.106
w2: 0.040 0.053 0.067 0.080 0.093 0.107 0.120 0.133 0.146 0.160
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.005
0.007 0.005 0.004
0.009 0.007 0.006 0.005 0.004
0.011 0.009 0.008 0.007 0.006 0.005 0.004
0.013 0.011 0.010 0.009 0.008 0.007 0.006 0.005 0.004
0.015 0.013 0.012 0.011 0.010 0.009 0.008 0.007 0.006 0.004 0.004
0.017 0.015 0.014 0.013 0.012 0.011 0.010 0.009 0.008 0.006 0.006 0.004 0.003
0.019 0.017 0.016 0.015 0.014 0.013 0.012 0.011 0.010 0.008 0.008 0.006 0.005 0.004 0.003
0.021 0.019 0.018 0.017 0.016 0.015 0.014 0.013 0.012 0.010 0.010 0.008 0.007 0.006 0.005 0.004 0.003
0.023 0.021 0.020 0.019 0.018 0.017 0.016 0.015 0.014 0.012 0.012 0.010 0.009 0.008 0.007 0.006 0.005 0.004 0.003
sum of density on p0-p1 = 1.000000
Time used: 0:04
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 9): -633.182508 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006442 0.000004 0.000004 0.000004 0.000100 0.837713 0.005000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006462
(1: 0.000004, 2: 0.000004, 3: 0.006442, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908683_1_2172_MLBR_RS10310: 0.000004, NC_002677_1_NP_302363_1_1235_bfrA: 0.000004, NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940: 0.006442, NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330: 0.000004, NZ_CP029543_1_WP_010908683_1_2193_bfr: 0.000004, NZ_AP014567_1_WP_010908683_1_2254_bfr: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.83771 q = 0.00500
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.99995 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.006 404.8 72.2 1.0000 0.0021 0.0021 0.9 0.2
7..4 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 404.8 72.2 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 1
lnL(ntime: 6 np: 11): -633.049300 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.006248 0.000004 0.000004 0.000004 0.000100 0.000010 3.187182 0.977614 951.777362
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.006268
(1: 0.000004, 2: 0.000004, 3: 0.006248, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908683_1_2172_MLBR_RS10310: 0.000004, NC_002677_1_NP_302363_1_1235_bfrA: 0.000004, NZ_LVXE01000003_1_WP_064430303_1_1242_A3216_RS01940: 0.006248, NZ_LYPH01000033_1_WP_010908683_1_1322_A8144_RS06330: 0.000004, NZ_CP029543_1_WP_010908683_1_2193_bfr: 0.000004, NZ_AP014567_1_WP_010908683_1_2254_bfr: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 3.18718 q = 0.97761
(p1 = 0.99999) w = 951.77736
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.39490 0.55662 0.65271 0.72472 0.78349 0.83367 0.87774 0.91714 0.95280 0.98520 951.77736
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.8 72.2 951.7679 0.0000 0.0000 0.0 0.0
7..2 0.000 404.8 72.2 951.7679 0.0000 0.0000 0.0 0.0
7..3 0.006 404.8 72.2 951.7679 0.0025 0.0000 1.0 0.0
7..4 0.000 404.8 72.2 951.7679 0.0000 0.0000 0.0 0.0
7..5 0.000 404.8 72.2 951.7679 0.0000 0.0000 0.0 0.0
7..6 0.000 404.8 72.2 951.7679 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908683_1_2172_MLBR_RS10310)
Pr(w>1) post mean +- SE for w
1 M 1.000** 951.768
2 Q 1.000** 951.768
3 G 1.000** 951.768
4 D 1.000** 951.777
5 P 1.000** 951.768
6 D 1.000** 951.768
7 V 1.000** 951.768
8 L 1.000** 951.768
9 R 1.000** 951.768
10 L 1.000** 951.768
11 L 1.000** 951.768
12 N 1.000** 951.768
13 E 1.000** 951.768
14 Q 1.000** 951.768
15 L 1.000** 951.768
16 T 1.000** 951.768
17 S 1.000** 951.768
18 E 1.000** 951.768
19 L 1.000** 951.768
20 T 1.000** 951.768
21 A 1.000** 951.768
22 I 1.000** 951.768
23 N 1.000** 951.768
24 Q 1.000** 951.768
25 Y 1.000** 951.768
26 F 1.000** 951.768
27 L 1.000** 951.768
28 H 1.000** 951.768
29 S 1.000** 951.768
30 K 1.000** 951.768
31 M 1.000** 951.768
32 Q 1.000** 951.768
33 E 1.000** 951.768
34 N 1.000** 951.768
35 W 1.000** 951.768
36 G 1.000** 951.768
37 F 1.000** 951.768
38 T 1.000** 951.768
39 E 1.000** 951.768
40 L 1.000** 951.768
41 A 1.000** 951.768
42 E 1.000** 951.768
43 R 1.000** 951.768
44 T 1.000** 951.768
45 R 1.000** 951.768
46 V 1.000** 951.768
47 E 1.000** 951.768
48 S 1.000** 951.768
49 F 1.000** 951.768
50 D 1.000** 951.768
51 E 1.000** 951.768
52 M 1.000** 951.768
53 R 1.000** 951.768
54 H 1.000** 951.768
55 A 1.000** 951.768
56 E 1.000** 951.768
57 A 1.000** 951.768
58 I 1.000** 951.768
59 T 1.000** 951.768
60 D 1.000** 951.768
61 R 1.000** 951.768
62 I 1.000** 951.768
63 L 1.000** 951.768
64 L 1.000** 951.768
65 L 1.000** 951.768
66 D 1.000** 951.768
67 G 1.000** 951.768
68 L 1.000** 951.768
69 P 1.000** 951.768
70 N 1.000** 951.768
71 Y 1.000** 951.768
72 Q 1.000** 951.768
73 R 1.000** 951.768
74 I 1.000** 951.768
75 G 1.000** 951.768
76 S 1.000** 951.768
77 L 1.000** 951.768
78 R 1.000** 951.768
79 V 1.000** 951.768
80 G 1.000** 951.768
81 Q 1.000** 951.768
82 T 1.000** 951.768
83 L 1.000** 951.768
84 R 1.000** 951.768
85 E 1.000** 951.768
86 Q 1.000** 951.768
87 F 1.000** 951.768
88 E 1.000** 951.768
89 A 1.000** 951.768
90 D 1.000** 951.768
91 L 1.000** 951.768
92 A 1.000** 951.768
93 I 1.000** 951.768
94 E 1.000** 951.768
95 Y 1.000** 951.768
96 E 1.000** 951.768
97 V 1.000** 951.768
98 M 1.000** 951.768
99 S 1.000** 951.768
100 R 1.000** 951.768
101 L 1.000** 951.768
102 K 1.000** 951.768
103 P 1.000** 951.768
104 G 1.000** 951.768
105 I 1.000** 951.768
106 I 1.000** 951.768
107 M 1.000** 951.768
108 C 1.000** 951.768
109 R 1.000** 951.768
110 E 1.000** 951.768
111 K 1.000** 951.768
112 Q 1.000** 951.768
113 D 1.000** 951.768
114 S 1.000** 951.768
115 T 1.000** 951.768
116 S 1.000** 951.768
117 A 1.000** 951.768
118 V 1.000** 951.768
119 L 1.000** 951.768
120 L 1.000** 951.768
121 E 1.000** 951.768
122 K 1.000** 951.768
123 I 1.000** 951.768
124 V 1.000** 951.768
125 A 1.000** 951.768
126 D 1.000** 951.768
127 E 1.000** 951.768
128 E 1.000** 951.768
129 E 1.000** 951.768
130 H 1.000** 951.768
131 I 1.000** 951.768
132 D 1.000** 951.768
133 Y 1.000** 951.768
134 L 1.000** 951.768
135 E 1.000** 951.768
136 T 1.000** 951.768
137 Q 1.000** 951.768
138 L 1.000** 951.768
139 A 1.000** 951.768
140 L 1.000** 951.768
141 M 1.000** 951.768
142 G 1.000** 951.768
143 Q 1.000** 951.768
144 L 1.000** 951.768
145 G 1.000** 951.768
146 E 1.000** 951.768
147 E 1.000** 951.768
148 L 1.000** 951.768
149 Y 1.000** 951.768
150 S 1.000** 951.768
151 A 1.000** 951.768
152 Q 1.000** 951.768
153 C 1.000** 951.768
154 V 1.000** 951.768
155 S 1.000** 951.768
156 R 1.000** 951.768
157 P 1.000** 951.768
158 P 1.000** 951.768
159 S 1.000** 951.768
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908683_1_2172_MLBR_RS10310)
Pr(w>1) post mean +- SE for w
1 M 0.639 4.860 +- 3.856
2 Q 0.639 4.860 +- 3.856
3 G 0.639 4.860 +- 3.856
4 D 0.923 6.858 +- 3.003
5 P 0.639 4.860 +- 3.856
6 D 0.639 4.860 +- 3.856
7 V 0.639 4.860 +- 3.856
8 L 0.639 4.860 +- 3.856
9 R 0.639 4.860 +- 3.856
10 L 0.639 4.860 +- 3.856
11 L 0.639 4.860 +- 3.856
12 N 0.639 4.860 +- 3.856
13 E 0.639 4.860 +- 3.856
14 Q 0.639 4.860 +- 3.856
15 L 0.639 4.860 +- 3.856
16 T 0.639 4.860 +- 3.856
17 S 0.639 4.860 +- 3.856
18 E 0.639 4.860 +- 3.856
19 L 0.639 4.860 +- 3.856
20 T 0.639 4.860 +- 3.856
21 A 0.639 4.860 +- 3.856
22 I 0.639 4.860 +- 3.856
23 N 0.639 4.860 +- 3.856
24 Q 0.639 4.860 +- 3.856
25 Y 0.639 4.860 +- 3.856
26 F 0.639 4.860 +- 3.856
27 L 0.639 4.860 +- 3.856
28 H 0.639 4.860 +- 3.856
29 S 0.639 4.860 +- 3.856
30 K 0.639 4.860 +- 3.856
31 M 0.639 4.860 +- 3.856
32 Q 0.639 4.860 +- 3.856
33 E 0.639 4.860 +- 3.856
34 N 0.639 4.860 +- 3.856
35 W 0.639 4.860 +- 3.856
36 G 0.639 4.860 +- 3.856
37 F 0.639 4.860 +- 3.856
38 T 0.639 4.860 +- 3.856
39 E 0.639 4.860 +- 3.856
40 L 0.639 4.860 +- 3.856
41 A 0.639 4.860 +- 3.856
42 E 0.639 4.860 +- 3.856
43 R 0.639 4.860 +- 3.856
44 T 0.639 4.860 +- 3.856
45 R 0.639 4.860 +- 3.856
46 V 0.639 4.860 +- 3.856
47 E 0.639 4.860 +- 3.856
48 S 0.639 4.860 +- 3.856
49 F 0.639 4.860 +- 3.856
50 D 0.639 4.860 +- 3.856
51 E 0.639 4.860 +- 3.856
52 M 0.639 4.860 +- 3.856
53 R 0.639 4.860 +- 3.856
54 H 0.639 4.860 +- 3.856
55 A 0.639 4.860 +- 3.856
56 E 0.639 4.860 +- 3.856
57 A 0.639 4.860 +- 3.856
58 I 0.639 4.860 +- 3.856
59 T 0.639 4.860 +- 3.856
60 D 0.639 4.860 +- 3.856
61 R 0.639 4.860 +- 3.856
62 I 0.639 4.860 +- 3.856
63 L 0.639 4.860 +- 3.856
64 L 0.639 4.860 +- 3.856
65 L 0.639 4.860 +- 3.856
66 D 0.639 4.860 +- 3.856
67 G 0.639 4.860 +- 3.856
68 L 0.639 4.860 +- 3.856
69 P 0.639 4.860 +- 3.856
70 N 0.639 4.860 +- 3.856
71 Y 0.639 4.860 +- 3.856
72 Q 0.639 4.860 +- 3.856
73 R 0.639 4.860 +- 3.856
74 I 0.639 4.860 +- 3.856
75 G 0.639 4.860 +- 3.856
76 S 0.639 4.860 +- 3.856
77 L 0.639 4.860 +- 3.856
78 R 0.639 4.860 +- 3.856
79 V 0.639 4.860 +- 3.856
80 G 0.639 4.860 +- 3.856
81 Q 0.639 4.860 +- 3.856
82 T 0.639 4.860 +- 3.856
83 L 0.639 4.860 +- 3.856
84 R 0.639 4.860 +- 3.856
85 E 0.639 4.860 +- 3.856
86 Q 0.639 4.860 +- 3.856
87 F 0.639 4.860 +- 3.856
88 E 0.639 4.860 +- 3.856
89 A 0.639 4.860 +- 3.856
90 D 0.639 4.860 +- 3.856
91 L 0.639 4.860 +- 3.856
92 A 0.639 4.860 +- 3.856
93 I 0.639 4.860 +- 3.856
94 E 0.639 4.860 +- 3.856
95 Y 0.639 4.860 +- 3.856
96 E 0.639 4.860 +- 3.856
97 V 0.639 4.860 +- 3.856
98 M 0.639 4.860 +- 3.856
99 S 0.639 4.860 +- 3.856
100 R 0.639 4.860 +- 3.856
101 L 0.639 4.860 +- 3.856
102 K 0.639 4.860 +- 3.856
103 P 0.639 4.860 +- 3.856
104 G 0.639 4.860 +- 3.856
105 I 0.639 4.860 +- 3.856
106 I 0.639 4.860 +- 3.856
107 M 0.639 4.860 +- 3.856
108 C 0.639 4.860 +- 3.856
109 R 0.639 4.860 +- 3.856
110 E 0.639 4.860 +- 3.856
111 K 0.639 4.860 +- 3.856
112 Q 0.639 4.860 +- 3.856
113 D 0.639 4.860 +- 3.856
114 S 0.639 4.860 +- 3.856
115 T 0.639 4.860 +- 3.856
116 S 0.639 4.860 +- 3.856
117 A 0.639 4.860 +- 3.856
118 V 0.639 4.860 +- 3.856
119 L 0.639 4.860 +- 3.856
120 L 0.639 4.860 +- 3.856
121 E 0.639 4.860 +- 3.856
122 K 0.639 4.860 +- 3.856
123 I 0.639 4.860 +- 3.856
124 V 0.639 4.860 +- 3.856
125 A 0.639 4.860 +- 3.856
126 D 0.639 4.860 +- 3.856
127 E 0.639 4.860 +- 3.856
128 E 0.639 4.860 +- 3.856
129 E 0.639 4.860 +- 3.856
130 H 0.639 4.860 +- 3.856
131 I 0.639 4.860 +- 3.856
132 D 0.639 4.860 +- 3.856
133 Y 0.639 4.860 +- 3.856
134 L 0.639 4.860 +- 3.856
135 E 0.639 4.860 +- 3.856
136 T 0.639 4.860 +- 3.856
137 Q 0.639 4.860 +- 3.856
138 L 0.639 4.860 +- 3.856
139 A 0.639 4.860 +- 3.856
140 L 0.639 4.860 +- 3.856
141 M 0.639 4.860 +- 3.856
142 G 0.639 4.860 +- 3.856
143 Q 0.639 4.860 +- 3.856
144 L 0.639 4.860 +- 3.856
145 G 0.639 4.860 +- 3.856
146 E 0.639 4.860 +- 3.856
147 E 0.639 4.860 +- 3.856
148 L 0.639 4.860 +- 3.856
149 Y 0.639 4.860 +- 3.856
150 S 0.639 4.860 +- 3.856
151 A 0.639 4.860 +- 3.856
152 Q 0.639 4.860 +- 3.856
153 C 0.639 4.860 +- 3.856
154 V 0.639 4.860 +- 3.856
155 S 0.639 4.860 +- 3.856
156 R 0.639 4.860 +- 3.856
157 P 0.639 4.860 +- 3.856
158 P 0.639 4.860 +- 3.856
159 S 0.639 4.860 +- 3.856
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.176 0.159 0.142 0.125 0.109 0.092 0.075 0.058 0.041 0.024
p : 0.095 0.097 0.098 0.100 0.100 0.101 0.102 0.102 0.102 0.103
q : 0.105 0.103 0.102 0.100 0.100 0.099 0.098 0.098 0.098 0.097
ws: 0.031 0.046 0.062 0.077 0.092 0.108 0.123 0.138 0.154 0.169
Time used: 0:18
Model 1: NearlyNeutral -633.182508 Model 2: PositiveSelection -633.0493 Model 0: one-ratio -633.049293 Model 7: beta -633.182508 Model 8: beta&w>1 -633.0493 Model 0 vs 1 0.26642999999990025 Model 2 vs 1 0.2664159999999356 Model 8 vs 7 0.2664159999999356
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
