--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 09:59:52 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/bfrA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -669.35 -673.17
2 -669.53 -673.36
--------------------------------------
TOTAL -669.43 -673.27
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.869765 0.087917 0.345811 1.454291 0.836653 1409.92 1418.26 1.000
r(A<->C){all} 0.132670 0.014971 0.000012 0.383816 0.096269 217.66 243.64 1.000
r(A<->G){all} 0.141473 0.016452 0.000042 0.406753 0.105468 136.50 170.82 1.008
r(A<->T){all} 0.227505 0.026161 0.000087 0.534009 0.194074 98.86 176.77 1.006
r(C<->G){all} 0.164854 0.019196 0.000026 0.441694 0.126077 264.42 307.77 1.002
r(C<->T){all} 0.176937 0.021419 0.000024 0.482695 0.142050 199.77 302.81 1.000
r(G<->T){all} 0.156562 0.020062 0.000021 0.445118 0.119117 139.27 181.03 1.001
pi(A){all} 0.243433 0.000379 0.206571 0.282364 0.243091 1377.17 1392.63 1.001
pi(C){all} 0.254135 0.000389 0.215538 0.291861 0.253796 1315.14 1334.26 1.000
pi(G){all} 0.301998 0.000449 0.262198 0.345100 0.302231 1203.63 1234.31 1.001
pi(T){all} 0.200434 0.000342 0.166136 0.237150 0.199712 1001.94 1189.56 1.000
alpha{1,2} 0.284949 0.122287 0.000615 0.931898 0.180849 1223.38 1234.14 1.000
alpha{3} 0.408241 0.247204 0.000134 1.321192 0.238678 1263.21 1284.73 1.000
pinvar{all} 0.992301 0.000040 0.980501 0.999844 0.994056 1393.64 1447.32 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -633.182508
Model 2: PositiveSelection -633.0493
Model 0: one-ratio -633.049293
Model 7: beta -633.182508
Model 8: beta&w>1 -633.0493
Model 0 vs 1 0.26642999999990025
Model 2 vs 1 0.2664159999999356
Model 8 vs 7 0.2664159999999356
>C1
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C2
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C3
MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C4
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C5
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C6
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=159
C1 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C2 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C3 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C4 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C5 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C6 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
*** **********************************************
C1 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C2 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C3 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C4 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C5 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C6 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
**************************************************
C1 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C2 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C3 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C4 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C5 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C6 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
**************************************************
C1 AQCVSRPPS
C2 AQCVSRPPS
C3 AQCVSRPPS
C4 AQCVSRPPS
C5 AQCVSRPPS
C6 AQCVSRPPS
*********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 159 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 159 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4770]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4770]--->[4770]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.469 Mb, Max= 30.694 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C2 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C3 MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C4 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C5 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
C6 MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
*** **********************************************
C1 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C2 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C3 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C4 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C5 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
C6 EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
**************************************************
C1 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C2 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C3 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C4 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C5 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
C6 LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
**************************************************
C1 AQCVSRPPS
C2 AQCVSRPPS
C3 AQCVSRPPS
C4 AQCVSRPPS
C5 AQCVSRPPS
C6 AQCVSRPPS
*********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 99.37 C1 C3 99.37
TOP 2 0 99.37 C3 C1 99.37
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 99.37 C2 C3 99.37
TOP 2 1 99.37 C3 C2 99.37
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 99.37 C3 C4 99.37
TOP 3 2 99.37 C4 C3 99.37
BOT 2 4 99.37 C3 C5 99.37
TOP 4 2 99.37 C5 C3 99.37
BOT 2 5 99.37 C3 C6 99.37
TOP 5 2 99.37 C6 C3 99.37
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 99.87
AVG 1 C2 * 99.87
AVG 2 C3 * 99.37
AVG 3 C4 * 99.87
AVG 4 C5 * 99.87
AVG 5 C6 * 99.87
TOT TOT * 99.79
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C2 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C3 ATGCAAGGTGTTCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C4 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C5 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
C6 ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
**********:***************************************
C1 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C2 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C3 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C4 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C5 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
C6 TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
**************************************************
C1 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C2 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C3 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C4 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C5 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
C6 ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
**************************************************
C1 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C2 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C3 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C4 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C5 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
C6 GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
**************************************************
C1 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C2 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C3 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C4 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C5 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
C6 CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
**************************************************
C1 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C2 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C3 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C4 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C5 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
C6 GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
**************************************************
C1 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C2 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C3 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C4 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C5 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
C6 CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
**************************************************
C1 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C2 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C3 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C4 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C5 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
C6 TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
**************************************************
C1 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C2 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C3 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C4 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C5 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
C6 TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
**************************************************
C1 GCGCAATGCGTCTCCCGGCCGCCGAGT
C2 GCGCAATGCGTCTCCCGGCCGCCGAGT
C3 GCGCAATGCGTCTCCCGGCCGCCGAGT
C4 GCGCAATGCGTCTCCCGGCCGCCGAGT
C5 GCGCAATGCGTCTCCCGGCCGCCGAGT
C6 GCGCAATGCGTCTCCCGGCCGCCGAGT
***************************
>C1
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C2
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C3
ATGCAAGGTGTTCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C4
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C5
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C6
ATGCAAGGTGATCCGGATGTCTTGCGCTTGCTTAACGAGCAACTGACCAG
TGAGCTCACCGCTATCAACCAGTATTTCCTGCATTCAAAGATGCAAGAAA
ACTGGGGCTTTACCGAGTTAGCAGAGCGCACCCGCGTGGAGTCCTTCGAC
GAAATGCGGCACGCCGAGGCGATTACCGATCGCATCTTGCTTCTGGACGG
CTTGCCGAATTACCAGCGCATAGGGTCGTTGCGCGTTGGTCAGACGCTGC
GTGAGCAATTCGAGGCAGACCTGGCGATCGAATACGAGGTGATGAGTCGG
CTCAAGCCCGGAATCATCATGTGCCGGGAAAAGCAGGACAGCACCAGCGC
TGTACTGTTGGAGAAAATCGTGGCTGACGAGGAAGAACACATCGACTACT
TGGAAACGCAACTAGCGCTTATGGGGCAGCTAGGGGAGGAGTTGTACTCG
GCGCAATGCGTCTCCCGGCCGCCGAGT
>C1
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C2
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C3
MQGVPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C4
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C5
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
>C6
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQENWGFTELAERTRVESFD
EMRHAEAITDRILLLDGLPNYQRIGSLRVGQTLREQFEADLAIEYEVMSR
LKPGIIMCREKQDSTSAVLLEKIVADEEEHIDYLETQLALMGQLGEELYS
AQCVSRPPS
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 477 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773508
Setting output file names to "/data/1res/bfrA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 531277281
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8058583201
Seed = 1972366896
Swapseed = 1579773508
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 5 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1070.951502 -- -24.965149
Chain 2 -- -1070.950181 -- -24.965149
Chain 3 -- -1070.950181 -- -24.965149
Chain 4 -- -1070.951669 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1070.950181 -- -24.965149
Chain 2 -- -1070.950119 -- -24.965149
Chain 3 -- -1070.950181 -- -24.965149
Chain 4 -- -1070.951730 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1070.952] (-1070.950) (-1070.950) (-1070.952) * [-1070.950] (-1070.950) (-1070.950) (-1070.952)
500 -- (-679.267) [-676.980] (-671.723) (-675.977) * (-673.575) [-673.539] (-680.677) (-675.855) -- 0:00:00
1000 -- (-681.125) [-675.323] (-673.087) (-675.099) * (-678.819) (-674.176) [-673.991] (-678.234) -- 0:00:00
1500 -- (-672.961) [-674.145] (-673.717) (-674.997) * (-676.851) (-671.999) (-677.029) [-673.590] -- 0:00:00
2000 -- (-674.068) (-686.434) [-675.930] (-676.876) * [-669.817] (-679.751) (-681.801) (-677.601) -- 0:00:00
2500 -- [-680.379] (-681.564) (-672.389) (-684.350) * (-672.279) [-674.532] (-675.265) (-674.623) -- 0:00:00
3000 -- (-675.142) [-671.584] (-679.130) (-673.030) * [-675.435] (-677.775) (-673.972) (-682.322) -- 0:00:00
3500 -- [-672.900] (-672.899) (-670.510) (-670.425) * (-680.496) (-675.718) [-671.488] (-674.830) -- 0:00:00
4000 -- (-673.904) (-675.816) (-672.295) [-672.264] * [-672.639] (-678.260) (-678.122) (-675.225) -- 0:04:09
4500 -- (-674.887) [-670.972] (-671.856) (-678.322) * (-671.795) [-675.285] (-671.659) (-674.044) -- 0:03:41
5000 -- [-675.536] (-679.134) (-672.873) (-674.352) * (-677.924) [-675.901] (-674.298) (-680.789) -- 0:03:19
Average standard deviation of split frequencies: 0.085710
5500 -- (-673.436) (-674.171) (-679.455) [-676.519] * (-676.664) [-673.237] (-674.016) (-676.400) -- 0:03:00
6000 -- (-680.355) (-676.391) [-671.240] (-676.181) * (-679.724) [-673.639] (-676.018) (-671.633) -- 0:02:45
6500 -- (-673.103) (-682.060) (-670.674) [-672.106] * [-670.211] (-675.590) (-679.178) (-677.129) -- 0:02:32
7000 -- (-674.291) (-671.350) (-681.539) [-672.945] * (-680.735) (-695.061) (-677.914) [-670.479] -- 0:02:21
7500 -- (-673.517) (-676.668) [-670.394] (-677.882) * [-669.910] (-680.006) (-688.114) (-679.053) -- 0:02:12
8000 -- [-673.040] (-675.507) (-674.734) (-673.933) * (-679.506) [-673.405] (-680.681) (-677.193) -- 0:02:04
8500 -- (-674.820) (-676.236) [-668.776] (-678.357) * (-669.084) (-681.068) (-671.435) [-673.938] -- 0:01:56
9000 -- (-682.427) [-682.024] (-669.822) (-680.868) * (-669.789) (-684.207) [-672.082] (-679.096) -- 0:01:50
9500 -- [-670.501] (-680.188) (-681.048) (-677.709) * (-672.899) (-677.715) (-673.345) [-673.149] -- 0:01:44
10000 -- (-670.368) (-677.133) (-670.551) [-672.283] * (-668.969) (-677.349) (-672.045) [-671.731] -- 0:01:39
Average standard deviation of split frequencies: 0.074327
10500 -- (-670.960) [-670.704] (-672.694) (-672.883) * (-669.604) (-680.457) (-671.810) [-674.088] -- 0:01:34
11000 -- [-668.834] (-678.874) (-673.222) (-673.706) * (-671.238) [-676.868] (-676.396) (-676.251) -- 0:01:29
11500 -- (-670.340) (-676.231) [-673.114] (-679.915) * (-670.629) (-675.829) (-673.104) [-671.056] -- 0:01:25
12000 -- [-669.848] (-671.800) (-683.234) (-683.307) * (-672.037) (-675.476) [-674.332] (-672.473) -- 0:01:22
12500 -- (-672.349) (-678.245) (-683.845) [-672.167] * (-672.275) [-670.287] (-670.967) (-675.632) -- 0:01:19
13000 -- (-673.214) [-675.303] (-690.637) (-673.150) * (-674.898) [-674.556] (-674.960) (-671.145) -- 0:01:15
13500 -- (-670.868) (-682.018) [-670.057] (-672.457) * (-671.170) (-680.186) (-670.870) [-677.396] -- 0:01:13
14000 -- (-670.627) [-673.096] (-669.923) (-676.340) * (-671.244) [-675.775] (-670.868) (-671.411) -- 0:01:10
14500 -- (-672.779) (-677.048) (-667.402) [-674.398] * (-670.115) (-678.030) [-672.215] (-679.656) -- 0:01:07
15000 -- (-674.408) (-674.637) [-669.333] (-674.220) * (-670.134) (-685.006) (-673.049) [-671.511] -- 0:01:05
Average standard deviation of split frequencies: 0.062199
15500 -- (-672.193) (-677.287) [-672.406] (-674.398) * (-669.179) (-672.312) (-675.944) [-671.671] -- 0:01:03
16000 -- (-669.863) (-681.895) (-669.994) [-675.398] * [-669.741] (-673.753) (-671.589) (-676.988) -- 0:01:01
16500 -- (-674.876) [-673.996] (-668.261) (-680.096) * (-668.700) (-677.309) (-671.744) [-675.553] -- 0:00:59
17000 -- (-667.361) [-669.696] (-673.502) (-674.906) * (-667.610) (-674.136) (-671.497) [-669.211] -- 0:00:57
17500 -- [-669.946] (-682.921) (-668.186) (-671.456) * (-669.518) (-681.955) (-671.278) [-676.033] -- 0:00:56
18000 -- (-669.071) (-672.520) [-669.303] (-675.129) * [-670.121] (-669.627) (-673.321) (-672.772) -- 0:00:54
18500 -- (-669.172) [-672.077] (-672.407) (-680.099) * (-670.862) [-675.544] (-672.002) (-671.736) -- 0:00:53
19000 -- (-669.004) [-676.581] (-670.910) (-675.035) * (-672.675) (-678.417) (-671.576) [-675.661] -- 0:00:51
19500 -- (-670.864) (-672.668) [-667.794] (-675.222) * (-671.903) (-682.851) [-671.340] (-685.367) -- 0:01:40
20000 -- (-676.452) (-670.564) (-667.262) [-675.941] * (-670.781) [-671.295] (-671.015) (-680.817) -- 0:01:38
Average standard deviation of split frequencies: 0.055884
20500 -- (-670.953) (-674.282) [-669.413] (-681.967) * (-673.875) (-678.395) (-674.104) [-670.820] -- 0:01:35
21000 -- (-668.288) [-672.091] (-668.879) (-676.764) * (-668.468) [-672.381] (-674.562) (-675.523) -- 0:01:33
21500 -- (-670.157) (-679.636) (-668.926) [-676.249] * (-668.538) [-670.879] (-668.837) (-670.562) -- 0:01:31
22000 -- [-668.511] (-674.159) (-671.485) (-682.297) * (-668.265) [-680.965] (-673.960) (-672.006) -- 0:01:28
22500 -- (-668.548) (-684.845) (-667.959) [-678.049] * (-668.036) [-676.273] (-669.969) (-672.477) -- 0:01:26
23000 -- (-672.603) (-686.633) (-669.836) [-676.143] * (-670.883) (-679.919) (-669.409) [-680.049] -- 0:01:24
23500 -- (-674.585) [-671.255] (-672.020) (-678.975) * (-674.953) [-673.685] (-670.492) (-677.816) -- 0:01:23
24000 -- (-674.881) (-674.789) [-670.346] (-693.847) * (-668.881) [-674.235] (-672.907) (-681.521) -- 0:01:21
24500 -- (-678.530) (-680.662) [-668.552] (-677.142) * (-668.973) [-671.455] (-671.763) (-672.985) -- 0:01:19
25000 -- (-676.641) [-671.162] (-675.043) (-685.903) * (-671.665) (-678.124) [-672.028] (-680.766) -- 0:01:18
Average standard deviation of split frequencies: 0.040383
25500 -- (-677.105) [-673.561] (-677.176) (-677.264) * (-670.673) (-673.493) (-671.767) [-672.786] -- 0:01:16
26000 -- (-674.133) (-674.053) (-675.284) [-678.491] * (-669.462) (-679.394) [-670.998] (-674.178) -- 0:01:14
26500 -- (-668.789) (-676.404) (-672.906) [-672.069] * [-671.427] (-677.760) (-671.339) (-672.509) -- 0:01:13
27000 -- (-668.209) (-675.657) (-672.093) [-673.485] * [-668.890] (-675.964) (-670.731) (-678.209) -- 0:01:12
27500 -- [-668.642] (-672.457) (-673.167) (-681.719) * (-671.083) (-677.560) (-672.582) [-675.405] -- 0:01:10
28000 -- (-669.722) [-669.142] (-669.847) (-679.407) * (-673.108) (-673.658) [-669.231] (-676.271) -- 0:01:09
28500 -- [-672.174] (-673.095) (-668.870) (-689.223) * [-668.119] (-678.272) (-677.264) (-676.971) -- 0:01:08
29000 -- (-668.235) [-676.682] (-669.760) (-674.402) * (-669.842) (-678.246) [-672.984] (-679.682) -- 0:01:06
29500 -- (-668.726) (-675.557) (-670.241) [-673.051] * (-670.122) (-681.963) [-670.383] (-676.186) -- 0:01:05
30000 -- [-670.989] (-677.470) (-669.211) (-673.677) * [-671.224] (-681.676) (-670.714) (-672.761) -- 0:01:04
Average standard deviation of split frequencies: 0.045262
30500 -- (-672.312) [-673.888] (-668.156) (-670.272) * (-671.686) [-670.929] (-672.793) (-683.752) -- 0:01:03
31000 -- (-670.004) (-682.823) [-671.784] (-669.586) * (-669.306) (-684.120) [-673.428] (-671.599) -- 0:01:02
31500 -- (-672.223) (-671.927) (-668.994) [-668.417] * [-671.039] (-669.992) (-672.389) (-674.994) -- 0:01:01
32000 -- (-672.971) (-673.256) [-668.244] (-668.738) * [-667.927] (-675.198) (-667.764) (-671.250) -- 0:01:00
32500 -- (-673.470) [-672.214] (-671.341) (-669.494) * (-669.384) (-678.753) [-673.250] (-669.994) -- 0:00:59
33000 -- (-672.597) (-672.908) [-670.593] (-669.452) * (-668.626) (-674.519) (-669.449) [-670.103] -- 0:00:58
33500 -- [-671.260] (-672.300) (-671.654) (-669.672) * [-670.801] (-675.964) (-671.339) (-669.500) -- 0:00:57
34000 -- (-671.782) (-669.301) (-671.912) [-670.514] * (-669.537) [-674.753] (-668.590) (-669.960) -- 0:00:56
34500 -- (-674.492) (-670.496) [-669.139] (-672.119) * (-671.610) [-671.532] (-671.070) (-670.332) -- 0:00:55
35000 -- (-671.764) [-669.713] (-671.262) (-671.027) * (-670.630) (-675.757) [-668.768] (-669.094) -- 0:01:22
Average standard deviation of split frequencies: 0.045831
35500 -- (-674.394) [-672.107] (-669.587) (-672.487) * (-670.480) [-677.830] (-672.297) (-671.123) -- 0:01:21
36000 -- [-669.525] (-670.786) (-675.204) (-671.807) * (-669.991) (-672.919) (-671.208) [-667.599] -- 0:01:20
36500 -- (-669.001) (-668.855) (-669.999) [-669.350] * (-669.911) (-680.564) [-673.392] (-671.633) -- 0:01:19
37000 -- (-670.852) [-668.818] (-669.711) (-671.026) * (-670.469) (-674.022) [-671.879] (-675.629) -- 0:01:18
37500 -- (-677.437) (-669.632) [-671.033] (-671.234) * (-675.024) (-679.911) [-670.430] (-669.040) -- 0:01:17
38000 -- (-671.825) (-669.055) [-670.736] (-671.751) * (-674.065) [-676.204] (-670.650) (-673.162) -- 0:01:15
38500 -- (-669.013) [-669.514] (-675.285) (-674.020) * [-672.308] (-670.390) (-668.888) (-668.986) -- 0:01:14
39000 -- [-673.850] (-675.567) (-672.004) (-671.666) * (-672.277) [-672.217] (-667.233) (-668.420) -- 0:01:13
39500 -- (-670.189) [-668.757] (-672.136) (-672.271) * (-670.082) (-682.052) (-670.519) [-671.562] -- 0:01:12
40000 -- (-673.242) [-669.594] (-667.325) (-669.795) * [-672.471] (-678.046) (-671.517) (-671.269) -- 0:01:12
Average standard deviation of split frequencies: 0.036708
40500 -- (-672.496) (-670.059) [-668.273] (-670.283) * (-671.698) [-671.770] (-673.390) (-671.506) -- 0:01:11
41000 -- (-674.408) (-670.338) (-669.247) [-669.938] * (-670.492) (-674.436) [-669.211] (-671.480) -- 0:01:10
41500 -- (-669.470) (-669.281) (-670.447) [-670.146] * (-670.967) (-670.589) [-669.691] (-671.209) -- 0:01:09
42000 -- (-672.025) (-670.697) [-668.918] (-670.789) * (-671.513) [-676.054] (-669.298) (-672.162) -- 0:01:08
42500 -- [-671.811] (-673.601) (-668.675) (-672.076) * (-677.150) [-670.920] (-667.844) (-670.360) -- 0:01:07
43000 -- (-671.198) (-672.912) (-668.839) [-671.332] * (-671.526) [-679.363] (-670.258) (-671.219) -- 0:01:06
43500 -- (-671.588) (-671.993) [-668.647] (-675.166) * (-670.297) [-674.642] (-670.058) (-670.568) -- 0:01:05
44000 -- [-670.705] (-677.339) (-669.611) (-670.875) * (-671.856) (-673.104) [-669.627] (-670.014) -- 0:01:05
44500 -- (-671.236) (-677.772) (-672.082) [-673.306] * (-671.044) (-678.949) (-670.923) [-670.998] -- 0:01:04
45000 -- (-672.146) (-675.535) (-670.010) [-674.319] * (-669.432) (-677.964) (-670.766) [-672.422] -- 0:01:03
Average standard deviation of split frequencies: 0.036380
45500 -- (-668.616) (-675.646) (-670.229) [-671.143] * (-669.577) [-673.245] (-673.884) (-671.115) -- 0:01:02
46000 -- (-675.652) (-676.313) [-669.664] (-672.215) * [-672.364] (-671.297) (-669.643) (-669.411) -- 0:01:02
46500 -- (-671.127) [-670.595] (-671.271) (-670.773) * (-675.256) (-674.922) (-670.897) [-669.634] -- 0:01:01
47000 -- (-670.393) (-671.596) (-669.264) [-672.660] * (-668.914) (-675.286) [-670.970] (-670.253) -- 0:01:00
47500 -- [-672.088] (-671.346) (-672.030) (-671.410) * (-670.209) (-672.410) (-669.142) [-671.592] -- 0:01:00
48000 -- (-671.719) (-671.584) (-671.188) [-668.425] * (-671.990) [-678.339] (-669.889) (-669.067) -- 0:00:59
48500 -- (-672.305) (-672.033) [-669.927] (-672.354) * (-669.535) [-676.941] (-668.774) (-667.528) -- 0:00:58
49000 -- (-674.211) [-673.621] (-668.708) (-674.550) * (-670.516) (-683.609) (-670.134) [-668.961] -- 0:00:58
49500 -- (-673.944) (-672.399) (-671.071) [-671.987] * [-668.624] (-674.346) (-672.422) (-671.548) -- 0:00:57
50000 -- (-673.320) [-672.977] (-674.778) (-675.341) * (-668.236) [-673.274] (-669.095) (-673.161) -- 0:00:57
Average standard deviation of split frequencies: 0.036370
50500 -- [-671.346] (-671.076) (-668.068) (-672.309) * [-670.891] (-676.340) (-674.529) (-674.580) -- 0:01:15
51000 -- [-671.877] (-669.535) (-669.034) (-673.151) * [-670.709] (-675.075) (-668.226) (-672.394) -- 0:01:14
51500 -- [-670.035] (-669.493) (-667.843) (-671.109) * (-669.693) [-670.684] (-668.803) (-673.451) -- 0:01:13
52000 -- (-670.067) (-672.064) [-668.221] (-673.173) * [-672.211] (-670.138) (-676.281) (-670.729) -- 0:01:12
52500 -- (-675.534) (-668.678) (-668.734) [-671.507] * (-669.288) (-676.334) (-669.787) [-670.741] -- 0:01:12
53000 -- [-670.278] (-672.475) (-668.507) (-671.837) * [-669.027] (-688.149) (-669.063) (-670.819) -- 0:01:11
53500 -- [-669.313] (-670.944) (-670.361) (-670.597) * (-671.807) [-675.289] (-668.852) (-673.308) -- 0:01:10
54000 -- (-668.932) (-674.312) (-671.263) [-671.311] * (-668.459) [-675.143] (-671.069) (-671.760) -- 0:01:10
54500 -- (-671.970) [-668.946] (-671.478) (-673.146) * [-671.755] (-672.674) (-670.808) (-673.448) -- 0:01:09
55000 -- (-673.220) (-669.452) [-669.339] (-672.581) * (-669.444) [-673.256] (-671.990) (-668.338) -- 0:01:08
Average standard deviation of split frequencies: 0.031900
55500 -- (-670.518) [-670.873] (-669.912) (-672.479) * (-667.900) [-678.090] (-674.670) (-672.229) -- 0:01:08
56000 -- (-668.536) [-670.044] (-668.336) (-672.890) * [-669.977] (-692.439) (-669.705) (-672.325) -- 0:01:07
56500 -- (-671.934) [-669.083] (-670.068) (-670.868) * (-668.538) (-683.406) (-670.707) [-669.636] -- 0:01:06
57000 -- [-669.141] (-671.181) (-669.780) (-674.340) * (-668.273) (-673.134) (-671.604) [-673.427] -- 0:01:06
57500 -- (-669.776) (-670.890) [-671.302] (-670.819) * [-669.762] (-669.845) (-668.983) (-673.039) -- 0:01:05
58000 -- (-672.439) (-671.441) (-670.435) [-668.993] * [-670.270] (-670.642) (-669.381) (-674.389) -- 0:01:04
58500 -- (-673.020) (-671.378) [-669.888] (-668.562) * (-670.252) (-668.353) (-667.910) [-668.230] -- 0:01:04
59000 -- (-670.804) [-671.279] (-670.355) (-672.187) * (-670.645) (-669.665) (-678.021) [-668.895] -- 0:01:03
59500 -- (-670.827) [-670.232] (-669.719) (-668.838) * [-669.653] (-674.660) (-667.847) (-670.656) -- 0:01:03
60000 -- (-669.474) (-672.227) (-670.413) [-668.962] * [-670.017] (-672.363) (-670.717) (-670.527) -- 0:01:02
Average standard deviation of split frequencies: 0.032377
60500 -- (-673.076) [-671.536] (-668.463) (-674.275) * (-670.677) (-670.366) (-668.308) [-670.013] -- 0:01:02
61000 -- (-668.541) (-671.322) (-667.816) [-673.146] * [-668.746] (-671.820) (-670.411) (-670.237) -- 0:01:01
61500 -- [-669.861] (-671.784) (-669.573) (-671.844) * (-671.707) (-672.184) (-670.729) [-670.734] -- 0:01:01
62000 -- (-670.343) [-668.902] (-670.844) (-669.498) * (-671.423) (-675.512) [-668.641] (-671.421) -- 0:01:00
62500 -- (-671.003) (-670.997) (-670.503) [-672.106] * (-671.102) (-671.363) (-670.726) [-668.344] -- 0:01:00
63000 -- [-672.869] (-670.394) (-674.904) (-669.788) * (-670.825) [-668.115] (-669.937) (-669.562) -- 0:00:59
63500 -- (-675.014) (-669.984) (-671.702) [-671.477] * (-668.328) (-672.047) (-671.009) [-673.378] -- 0:00:58
64000 -- (-673.826) [-670.132] (-671.929) (-671.591) * (-670.466) (-669.797) (-672.296) [-671.283] -- 0:00:58
64500 -- (-669.422) (-669.056) [-669.133] (-672.729) * (-670.775) (-673.005) (-670.392) [-672.216] -- 0:00:58
65000 -- [-670.154] (-672.153) (-671.213) (-672.650) * (-671.662) (-670.725) [-669.295] (-675.880) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
65500 -- (-667.955) (-669.473) (-672.742) [-672.749] * [-669.162] (-669.604) (-673.522) (-672.513) -- 0:01:11
66000 -- (-669.330) [-668.796] (-676.594) (-672.063) * (-671.079) [-669.732] (-670.458) (-671.749) -- 0:01:10
66500 -- (-670.549) (-670.091) (-671.998) [-670.823] * [-669.839] (-672.229) (-670.671) (-671.958) -- 0:01:10
67000 -- (-673.400) (-673.451) [-671.853] (-672.532) * [-670.953] (-670.258) (-669.337) (-670.371) -- 0:01:09
67500 -- (-669.407) [-669.103] (-670.763) (-671.983) * (-670.197) (-668.813) [-672.717] (-671.750) -- 0:01:09
68000 -- (-674.865) (-668.320) (-671.417) [-671.162] * (-670.389) (-671.071) [-671.241] (-671.257) -- 0:01:08
68500 -- (-674.521) (-669.977) [-672.013] (-672.260) * (-671.490) (-670.917) (-669.420) [-679.562] -- 0:01:07
69000 -- (-673.101) (-670.744) [-666.671] (-671.163) * [-673.051] (-669.500) (-668.850) (-676.170) -- 0:01:07
69500 -- [-671.598] (-669.861) (-674.252) (-670.470) * (-672.419) [-668.355] (-675.263) (-669.431) -- 0:01:06
70000 -- [-672.683] (-669.419) (-671.169) (-670.313) * (-670.898) [-667.948] (-674.609) (-668.091) -- 0:01:06
Average standard deviation of split frequencies: 0.033354
70500 -- (-669.113) (-669.912) (-671.739) [-670.422] * (-672.115) (-670.220) [-669.202] (-672.510) -- 0:01:05
71000 -- (-669.711) (-670.999) [-671.287] (-670.467) * (-674.169) [-670.670] (-670.315) (-670.646) -- 0:01:05
71500 -- (-670.569) [-670.311] (-672.289) (-672.789) * (-680.526) (-669.918) [-670.426] (-670.564) -- 0:01:04
72000 -- (-672.643) (-673.457) [-673.235] (-671.345) * [-673.777] (-671.602) (-669.154) (-668.981) -- 0:01:04
72500 -- (-673.470) (-670.335) (-675.673) [-671.462] * (-674.583) (-674.964) (-668.568) [-668.588] -- 0:01:03
73000 -- (-673.398) [-670.056] (-675.424) (-670.290) * (-672.145) (-669.983) (-671.233) [-670.439] -- 0:01:03
73500 -- (-672.771) (-670.636) (-673.295) [-670.889] * (-671.393) (-672.830) [-670.446] (-669.720) -- 0:01:03
74000 -- (-672.170) (-670.121) (-673.222) [-671.785] * (-670.765) (-668.629) [-671.461] (-670.671) -- 0:01:02
74500 -- (-672.013) (-670.009) [-676.359] (-670.679) * (-674.419) (-668.259) [-667.606] (-668.523) -- 0:01:02
75000 -- (-671.676) [-674.583] (-669.548) (-670.327) * (-671.023) (-669.470) [-672.113] (-668.569) -- 0:01:01
Average standard deviation of split frequencies: 0.030324
75500 -- (-672.317) (-673.408) (-667.898) [-672.868] * (-670.357) (-671.590) (-669.683) [-672.519] -- 0:01:01
76000 -- (-672.333) (-670.670) [-669.414] (-668.722) * (-672.633) (-670.155) [-667.993] (-671.891) -- 0:01:00
76500 -- (-671.918) (-674.120) [-670.137] (-669.826) * (-672.632) (-671.928) (-670.113) [-670.789] -- 0:01:00
77000 -- (-672.573) (-673.743) (-668.615) [-670.264] * (-670.951) [-669.658] (-667.736) (-671.098) -- 0:00:59
77500 -- (-671.910) (-671.936) [-672.287] (-668.336) * (-672.078) [-669.052] (-669.494) (-669.528) -- 0:00:59
78000 -- (-672.439) (-669.831) [-669.814] (-668.339) * [-671.902] (-672.300) (-670.747) (-669.086) -- 0:00:59
78500 -- (-673.591) (-673.320) [-671.881] (-671.095) * (-671.421) [-669.584] (-667.067) (-675.929) -- 0:00:58
79000 -- (-674.417) [-671.148] (-670.144) (-668.694) * (-669.651) (-669.576) (-671.038) [-668.446] -- 0:00:58
79500 -- (-671.368) (-670.640) [-668.885] (-675.441) * (-670.428) (-670.829) [-670.641] (-673.322) -- 0:00:57
80000 -- [-672.265] (-670.244) (-668.613) (-669.595) * [-670.692] (-671.620) (-672.249) (-669.672) -- 0:00:57
Average standard deviation of split frequencies: 0.025528
80500 -- (-673.684) (-669.555) (-670.441) [-670.354] * (-668.367) (-673.411) [-669.500] (-669.757) -- 0:00:57
81000 -- (-672.920) (-673.542) (-673.604) [-670.108] * (-668.701) (-673.181) (-672.668) [-669.426] -- 0:00:56
81500 -- [-676.646] (-671.544) (-671.849) (-669.619) * (-667.326) [-672.843] (-669.005) (-678.466) -- 0:01:07
82000 -- (-668.268) (-671.379) [-669.593] (-670.007) * [-669.718] (-672.903) (-667.937) (-681.465) -- 0:01:07
82500 -- (-667.945) (-675.413) (-673.518) [-668.416] * (-669.566) [-668.330] (-669.946) (-671.173) -- 0:01:06
83000 -- (-671.454) (-674.969) (-673.788) [-668.612] * (-670.629) [-669.152] (-668.290) (-669.747) -- 0:01:06
83500 -- (-672.681) (-673.391) (-668.808) [-667.413] * (-672.961) (-670.251) [-668.656] (-668.822) -- 0:01:05
84000 -- (-669.370) [-672.825] (-679.340) (-667.834) * (-671.490) [-669.445] (-668.879) (-667.910) -- 0:01:05
84500 -- [-668.196] (-672.311) (-673.608) (-668.052) * (-670.885) (-674.667) (-672.258) [-670.624] -- 0:01:05
85000 -- (-670.408) (-672.388) (-672.766) [-669.278] * [-673.317] (-678.661) (-670.936) (-671.572) -- 0:01:04
Average standard deviation of split frequencies: 0.023080
85500 -- (-669.451) [-670.609] (-677.011) (-672.282) * (-673.311) (-679.339) (-673.347) [-669.445] -- 0:01:04
86000 -- (-672.587) (-671.579) [-669.777] (-671.860) * (-669.705) (-671.507) (-677.330) [-668.785] -- 0:01:03
86500 -- (-666.894) (-674.120) (-668.410) [-670.496] * (-672.281) (-675.934) (-674.410) [-668.824] -- 0:01:03
87000 -- (-672.151) (-671.805) [-667.993] (-667.636) * [-669.490] (-671.565) (-671.095) (-675.327) -- 0:01:02
87500 -- (-669.396) (-670.659) (-671.681) [-668.679] * (-669.154) [-670.867] (-676.362) (-669.476) -- 0:01:02
88000 -- (-667.745) (-672.173) [-671.218] (-669.895) * [-670.916] (-670.926) (-677.292) (-670.205) -- 0:01:02
88500 -- (-667.183) [-668.326] (-668.723) (-674.365) * (-669.790) (-671.834) (-669.923) [-669.857] -- 0:01:01
89000 -- (-667.150) [-668.261] (-667.556) (-669.212) * (-670.524) (-670.376) [-672.157] (-667.587) -- 0:01:01
89500 -- (-669.739) (-670.502) [-671.067] (-669.801) * (-670.164) [-670.235] (-673.671) (-668.119) -- 0:01:01
90000 -- [-667.522] (-670.549) (-671.151) (-668.238) * (-668.568) (-670.061) [-673.183] (-669.764) -- 0:01:00
Average standard deviation of split frequencies: 0.024628
90500 -- [-668.747] (-669.033) (-670.055) (-670.992) * (-672.849) [-669.765] (-671.697) (-670.333) -- 0:01:00
91000 -- (-668.532) (-671.644) [-668.522] (-672.244) * (-672.402) (-672.185) [-671.604] (-674.795) -- 0:00:59
91500 -- [-668.744] (-670.767) (-669.147) (-669.108) * [-672.250] (-669.157) (-672.939) (-671.240) -- 0:00:59
92000 -- (-669.545) (-677.098) [-672.685] (-669.455) * [-669.374] (-669.248) (-669.817) (-672.233) -- 0:00:59
92500 -- [-670.429] (-668.571) (-669.936) (-671.476) * (-671.247) (-672.876) [-669.212] (-669.798) -- 0:00:58
93000 -- (-671.901) [-669.331] (-679.359) (-672.688) * [-671.606] (-672.830) (-668.241) (-671.431) -- 0:00:58
93500 -- (-669.938) [-672.516] (-670.596) (-671.809) * (-672.576) (-673.070) (-667.643) [-669.454] -- 0:00:58
94000 -- (-669.029) [-671.442] (-669.935) (-669.778) * (-669.514) (-671.857) (-668.897) [-667.351] -- 0:00:57
94500 -- [-667.644] (-672.981) (-668.698) (-670.471) * (-670.247) [-669.542] (-669.834) (-668.432) -- 0:00:57
95000 -- (-668.748) (-670.117) (-668.470) [-675.251] * (-667.167) (-670.037) [-668.963] (-673.704) -- 0:00:57
Average standard deviation of split frequencies: 0.021361
95500 -- [-669.588] (-670.423) (-670.118) (-670.566) * (-674.075) (-670.103) [-668.318] (-670.801) -- 0:00:56
96000 -- (-671.650) (-672.548) (-670.120) [-670.622] * [-671.985] (-670.089) (-668.177) (-669.282) -- 0:00:56
96500 -- (-670.094) (-671.238) (-671.213) [-670.524] * [-670.137] (-671.429) (-669.843) (-669.612) -- 0:00:56
97000 -- [-670.048] (-671.172) (-668.176) (-671.812) * [-670.603] (-671.462) (-671.468) (-670.299) -- 0:01:05
97500 -- [-668.628] (-671.979) (-671.836) (-671.386) * (-670.536) [-675.056] (-672.181) (-670.417) -- 0:01:04
98000 -- (-669.752) (-673.205) [-669.721] (-670.976) * [-672.611] (-675.446) (-673.246) (-668.992) -- 0:01:04
98500 -- (-671.422) (-673.961) [-672.607] (-670.681) * [-669.616] (-674.719) (-669.312) (-668.574) -- 0:01:04
99000 -- (-672.723) [-672.163] (-671.088) (-669.928) * (-676.075) (-670.323) (-671.671) [-668.888] -- 0:01:03
99500 -- (-672.442) [-671.585] (-673.189) (-670.947) * [-674.277] (-671.074) (-672.746) (-670.952) -- 0:01:03
100000 -- (-672.642) [-670.549] (-670.170) (-669.203) * (-670.423) (-667.862) [-668.067] (-668.885) -- 0:01:02
Average standard deviation of split frequencies: 0.019224
100500 -- (-671.374) (-670.706) (-670.147) [-673.328] * (-668.307) (-669.458) [-668.887] (-669.587) -- 0:01:02
101000 -- [-669.674] (-670.740) (-672.627) (-671.148) * (-668.121) (-670.961) [-670.549] (-674.891) -- 0:01:02
101500 -- (-668.585) [-672.768] (-669.440) (-670.481) * [-669.119] (-671.317) (-668.661) (-671.201) -- 0:01:01
102000 -- (-672.311) (-673.203) [-668.269] (-668.753) * [-670.364] (-672.198) (-670.905) (-668.676) -- 0:01:01
102500 -- (-672.265) (-674.020) (-669.311) [-669.194] * [-672.132] (-669.264) (-669.693) (-669.238) -- 0:01:01
103000 -- [-670.860] (-671.231) (-668.064) (-670.990) * (-671.866) [-669.828] (-671.352) (-669.285) -- 0:01:00
103500 -- (-669.652) [-668.631] (-668.038) (-671.602) * [-668.410] (-671.848) (-669.958) (-669.381) -- 0:01:00
104000 -- (-671.315) (-671.966) [-669.974] (-670.647) * [-666.030] (-668.776) (-671.529) (-668.968) -- 0:01:00
104500 -- [-668.794] (-672.360) (-670.564) (-670.679) * (-673.125) (-670.795) (-670.049) [-673.059] -- 0:00:59
105000 -- (-670.350) (-671.396) [-667.978] (-673.554) * (-669.589) (-668.511) [-669.040] (-671.688) -- 0:00:59
Average standard deviation of split frequencies: 0.020832
105500 -- (-669.473) (-674.229) (-669.595) [-670.615] * (-674.240) (-668.140) [-671.924] (-674.795) -- 0:00:59
106000 -- (-671.335) (-671.316) [-669.639] (-672.849) * (-670.032) (-670.687) [-667.527] (-677.271) -- 0:00:59
106500 -- (-671.412) [-672.006] (-669.828) (-670.715) * [-671.111] (-669.284) (-667.962) (-672.200) -- 0:00:58
107000 -- [-670.146] (-672.327) (-670.733) (-671.818) * (-666.807) (-668.681) [-668.862] (-669.098) -- 0:00:58
107500 -- (-669.426) [-672.068] (-671.523) (-669.134) * (-669.914) [-671.014] (-667.122) (-670.685) -- 0:00:58
108000 -- [-674.499] (-672.013) (-667.420) (-670.555) * (-667.651) [-671.115] (-668.559) (-671.154) -- 0:00:57
108500 -- (-674.636) (-676.459) (-670.236) [-669.429] * (-667.644) (-670.171) [-668.243] (-670.727) -- 0:00:57
109000 -- [-673.226] (-674.325) (-670.354) (-669.839) * (-670.879) [-668.832] (-671.221) (-669.096) -- 0:00:57
109500 -- (-672.933) [-671.609] (-669.116) (-672.581) * (-670.733) (-669.047) (-668.001) [-669.053] -- 0:00:56
110000 -- (-669.592) (-672.156) [-668.155] (-668.976) * (-670.871) (-671.904) [-668.787] (-669.229) -- 0:00:56
Average standard deviation of split frequencies: 0.021511
110500 -- [-667.814] (-672.822) (-670.070) (-672.340) * (-669.109) [-669.422] (-675.418) (-669.750) -- 0:00:56
111000 -- (-668.648) (-672.072) [-669.142] (-674.700) * (-671.976) (-671.095) [-671.306] (-673.965) -- 0:00:56
111500 -- (-668.247) (-671.229) (-669.956) [-669.672] * (-672.170) (-672.570) [-674.123] (-667.864) -- 0:00:55
112000 -- (-670.148) (-671.567) (-670.496) [-670.532] * (-670.772) (-676.415) (-672.208) [-672.504] -- 0:00:55
112500 -- [-671.324] (-670.329) (-668.620) (-671.510) * (-669.482) [-672.348] (-673.077) (-672.384) -- 0:01:03
113000 -- (-671.876) (-672.770) (-671.249) [-675.461] * [-668.052] (-673.054) (-672.861) (-670.404) -- 0:01:02
113500 -- (-672.547) [-669.548] (-668.953) (-673.785) * (-667.816) (-668.409) (-671.405) [-673.226] -- 0:01:02
114000 -- (-668.776) [-668.963] (-668.791) (-671.936) * (-666.638) (-668.465) [-677.667] (-670.318) -- 0:01:02
114500 -- (-676.558) (-674.749) [-669.671] (-670.502) * [-668.428] (-672.567) (-675.746) (-668.594) -- 0:01:01
115000 -- (-670.495) [-670.666] (-669.581) (-670.880) * (-669.840) (-670.988) [-672.165] (-670.837) -- 0:01:01
Average standard deviation of split frequencies: 0.018084
115500 -- (-674.759) (-671.273) (-669.833) [-670.414] * (-669.781) [-667.749] (-670.510) (-672.350) -- 0:01:01
116000 -- (-670.900) [-673.550] (-669.729) (-670.851) * (-670.610) [-671.351] (-668.691) (-673.488) -- 0:01:00
116500 -- (-671.354) [-672.675] (-670.250) (-671.975) * (-673.192) [-669.662] (-671.114) (-672.305) -- 0:01:00
117000 -- (-669.996) (-674.859) [-668.625] (-671.375) * [-670.378] (-668.803) (-668.705) (-670.485) -- 0:01:00
117500 -- (-669.034) (-671.693) [-670.945] (-675.057) * (-671.970) (-669.508) (-669.810) [-671.211] -- 0:01:00
118000 -- [-671.886] (-671.404) (-670.763) (-669.825) * [-668.005] (-666.920) (-671.984) (-671.921) -- 0:00:59
118500 -- (-667.976) (-669.479) [-671.790] (-670.487) * (-668.691) (-668.634) (-668.917) [-672.130] -- 0:00:59
119000 -- [-669.905] (-670.350) (-668.942) (-670.686) * (-670.212) [-667.825] (-668.453) (-671.866) -- 0:00:59
119500 -- (-671.807) (-676.706) [-675.187] (-671.746) * [-668.393] (-669.777) (-670.564) (-670.092) -- 0:00:58
120000 -- (-669.749) (-670.911) [-672.215] (-672.300) * (-669.889) (-668.383) (-670.575) [-673.622] -- 0:00:58
Average standard deviation of split frequencies: 0.017477
120500 -- [-671.365] (-669.716) (-671.501) (-671.675) * [-668.045] (-668.230) (-669.334) (-672.561) -- 0:00:58
121000 -- (-671.039) (-673.321) (-670.524) [-670.295] * (-668.301) (-671.746) (-671.935) [-671.845] -- 0:00:58
121500 -- [-671.688] (-671.478) (-670.217) (-671.085) * (-668.685) (-671.681) (-669.495) [-672.596] -- 0:00:57
122000 -- (-671.993) [-669.139] (-672.943) (-669.056) * (-670.598) (-669.166) [-670.171] (-670.107) -- 0:00:57
122500 -- [-674.135] (-670.285) (-671.770) (-671.114) * (-669.079) (-669.676) [-674.334] (-670.943) -- 0:00:57
123000 -- (-672.164) [-670.569] (-670.571) (-671.437) * (-670.394) (-674.723) (-671.193) [-669.692] -- 0:00:57
123500 -- (-668.845) (-673.141) (-671.500) [-668.226] * (-669.694) (-667.958) (-669.841) [-670.330] -- 0:00:56
124000 -- (-670.303) [-668.430] (-670.418) (-669.346) * (-671.784) (-670.231) (-670.638) [-668.185] -- 0:00:56
124500 -- (-672.709) [-668.813] (-671.741) (-670.129) * [-667.486] (-675.534) (-670.250) (-672.231) -- 0:00:56
125000 -- [-668.432] (-669.274) (-670.404) (-668.888) * (-673.068) (-667.970) [-671.853] (-669.521) -- 0:00:56
Average standard deviation of split frequencies: 0.017958
125500 -- (-669.548) [-668.629] (-672.763) (-669.487) * (-672.691) (-671.890) [-670.876] (-673.912) -- 0:00:55
126000 -- (-669.116) [-672.374] (-674.858) (-673.299) * (-672.579) (-674.542) (-670.888) [-672.041] -- 0:00:55
126500 -- (-671.064) [-669.812] (-671.623) (-669.371) * (-674.142) [-669.650] (-681.976) (-671.794) -- 0:00:55
127000 -- (-671.468) (-671.334) [-670.316] (-671.990) * (-669.694) (-668.896) (-672.523) [-671.378] -- 0:00:54
127500 -- [-668.772] (-669.749) (-671.911) (-670.721) * (-676.420) [-671.828] (-672.076) (-668.739) -- 0:01:01
128000 -- [-669.030] (-670.322) (-672.247) (-670.896) * (-672.727) (-671.076) [-674.512] (-669.588) -- 0:01:01
128500 -- (-671.331) [-669.403] (-675.918) (-672.903) * (-669.672) (-671.886) (-673.692) [-669.224] -- 0:01:01
129000 -- [-670.006] (-670.324) (-670.174) (-673.638) * (-671.706) [-669.122] (-672.838) (-672.313) -- 0:01:00
129500 -- (-667.687) [-668.402] (-671.378) (-671.487) * (-671.823) (-672.871) [-672.113] (-670.700) -- 0:01:00
130000 -- [-670.715] (-670.238) (-670.763) (-671.957) * (-672.747) (-676.339) (-671.723) [-667.747] -- 0:01:00
Average standard deviation of split frequencies: 0.017497
130500 -- (-672.428) (-671.655) (-670.173) [-671.376] * (-671.545) (-669.945) (-675.282) [-668.951] -- 0:00:59
131000 -- (-670.445) (-669.782) (-673.910) [-669.651] * [-671.930] (-668.581) (-671.871) (-671.727) -- 0:00:59
131500 -- (-668.165) (-672.433) (-673.648) [-668.948] * (-669.380) (-671.374) [-672.580] (-672.091) -- 0:00:59
132000 -- (-668.190) (-669.370) (-672.814) [-667.886] * (-671.841) [-671.473] (-672.950) (-675.009) -- 0:00:59
132500 -- (-668.470) (-670.061) (-671.498) [-671.667] * (-667.916) (-670.566) [-671.139] (-673.149) -- 0:00:58
133000 -- (-672.833) [-670.495] (-672.819) (-672.696) * (-671.142) (-670.736) [-672.070] (-672.062) -- 0:00:58
133500 -- (-671.032) [-671.169] (-673.762) (-673.897) * (-671.444) [-671.646] (-670.428) (-670.747) -- 0:00:58
134000 -- [-671.652] (-669.663) (-672.666) (-672.244) * (-670.291) (-669.999) (-669.788) [-670.615] -- 0:00:58
134500 -- (-671.153) (-671.273) (-670.843) [-674.172] * (-670.881) [-672.102] (-670.381) (-668.979) -- 0:00:57
135000 -- [-672.745] (-669.146) (-672.195) (-672.567) * (-669.400) (-670.267) (-671.024) [-668.168] -- 0:00:57
Average standard deviation of split frequencies: 0.016054
135500 -- [-671.655] (-669.561) (-673.763) (-672.677) * [-671.399] (-672.839) (-671.571) (-672.574) -- 0:00:57
136000 -- (-670.924) (-670.529) (-671.831) [-671.793] * (-671.876) (-673.422) [-673.389] (-669.738) -- 0:00:57
136500 -- (-672.568) (-670.430) (-672.472) [-669.216] * (-670.933) (-674.615) [-669.575] (-670.066) -- 0:00:56
137000 -- (-670.095) [-669.830] (-671.228) (-669.300) * (-672.777) (-673.715) [-669.641] (-670.910) -- 0:00:56
137500 -- (-673.953) (-672.349) (-674.362) [-671.786] * [-670.901] (-669.059) (-671.719) (-668.759) -- 0:00:56
138000 -- [-668.938] (-671.802) (-677.575) (-671.095) * [-671.711] (-672.439) (-669.838) (-670.663) -- 0:00:56
138500 -- (-673.555) [-669.406] (-674.702) (-670.686) * (-669.538) (-671.667) [-673.350] (-668.901) -- 0:00:55
139000 -- (-671.926) (-671.056) (-674.273) [-670.569] * [-672.559] (-670.464) (-673.346) (-669.679) -- 0:00:55
139500 -- (-672.052) (-671.913) (-677.838) [-672.511] * (-672.714) (-671.178) [-671.743] (-668.190) -- 0:00:55
140000 -- (-673.385) (-671.830) (-672.044) [-670.669] * (-671.818) (-667.516) [-668.415] (-669.335) -- 0:00:55
Average standard deviation of split frequencies: 0.018246
140500 -- (-671.951) [-670.706] (-669.987) (-670.653) * (-670.305) (-671.058) (-673.358) [-672.511] -- 0:00:55
141000 -- (-671.822) [-667.060] (-673.828) (-670.685) * (-674.353) (-670.746) [-672.998] (-672.693) -- 0:00:54
141500 -- (-669.819) (-670.432) (-671.166) [-671.273] * (-670.006) (-673.419) (-669.531) [-669.359] -- 0:00:54
142000 -- [-669.906] (-672.273) (-676.893) (-673.413) * (-670.845) (-669.188) [-670.472] (-672.326) -- 0:00:54
142500 -- [-668.892] (-672.396) (-670.901) (-675.006) * (-669.979) [-669.656] (-670.116) (-671.384) -- 0:00:54
143000 -- (-672.925) [-672.042] (-673.537) (-677.455) * (-673.869) [-668.022] (-668.375) (-668.635) -- 0:00:59
143500 -- [-670.927] (-669.902) (-675.505) (-673.904) * (-672.390) (-671.531) (-671.420) [-668.815] -- 0:00:59
144000 -- (-670.208) (-670.486) (-672.630) [-675.700] * [-668.027] (-668.441) (-670.046) (-670.147) -- 0:00:59
144500 -- (-670.659) [-670.665] (-670.574) (-671.428) * (-673.681) (-670.364) (-670.828) [-671.087] -- 0:00:59
145000 -- (-670.297) (-668.673) (-672.289) [-669.514] * [-672.249] (-671.562) (-667.348) (-674.769) -- 0:00:58
Average standard deviation of split frequencies: 0.017597
145500 -- (-668.292) (-670.481) (-669.821) [-669.472] * [-669.695] (-674.061) (-669.808) (-674.042) -- 0:00:58
146000 -- (-671.445) (-670.741) [-669.971] (-677.500) * (-674.282) (-675.213) [-671.904] (-668.608) -- 0:00:58
146500 -- [-671.880] (-669.967) (-669.170) (-671.922) * (-670.625) (-669.371) (-671.084) [-672.188] -- 0:00:58
147000 -- [-668.401] (-671.468) (-675.326) (-671.476) * (-670.910) [-671.053] (-670.901) (-671.603) -- 0:00:58
147500 -- (-669.147) [-671.144] (-671.940) (-668.817) * [-671.621] (-671.063) (-671.799) (-670.930) -- 0:00:57
148000 -- (-669.828) [-671.573] (-672.647) (-671.770) * (-670.644) (-671.557) [-668.530] (-671.090) -- 0:00:57
148500 -- [-668.918] (-676.539) (-670.509) (-672.648) * [-672.185] (-669.979) (-668.038) (-672.797) -- 0:00:57
149000 -- [-669.011] (-673.663) (-670.102) (-674.967) * (-670.681) (-668.951) [-667.611] (-673.832) -- 0:00:57
149500 -- (-668.935) (-672.819) [-668.412] (-670.750) * (-670.077) (-670.875) (-671.941) [-670.994] -- 0:00:56
150000 -- (-670.181) (-677.562) (-671.252) [-668.214] * [-668.744] (-672.737) (-670.192) (-671.015) -- 0:00:56
Average standard deviation of split frequencies: 0.015315
150500 -- (-671.560) (-678.254) [-671.913] (-675.054) * (-670.922) (-670.016) [-669.039] (-674.397) -- 0:00:56
151000 -- [-669.221] (-670.898) (-671.074) (-670.065) * [-672.208] (-671.540) (-668.624) (-672.783) -- 0:00:56
151500 -- [-669.188] (-669.702) (-672.910) (-669.071) * (-671.322) (-669.885) (-670.075) [-676.481] -- 0:00:56
152000 -- [-669.515] (-666.892) (-669.277) (-669.512) * [-672.868] (-669.852) (-670.582) (-669.507) -- 0:00:55
152500 -- [-669.600] (-671.365) (-671.015) (-670.836) * (-673.657) (-671.473) (-670.155) [-671.528] -- 0:00:55
153000 -- (-669.173) (-674.406) (-670.593) [-670.870] * (-669.395) [-669.101] (-671.523) (-671.223) -- 0:00:55
153500 -- (-669.127) (-668.905) [-668.278] (-668.807) * (-670.405) (-669.711) [-668.841] (-671.691) -- 0:00:55
154000 -- (-669.336) (-669.825) (-671.300) [-670.308] * [-674.704] (-670.455) (-670.284) (-669.145) -- 0:00:54
154500 -- [-668.627] (-674.318) (-669.273) (-671.304) * (-673.549) [-671.095] (-670.151) (-669.931) -- 0:00:54
155000 -- (-670.186) (-671.703) (-669.740) [-666.840] * (-674.796) (-671.356) (-670.309) [-673.239] -- 0:00:54
Average standard deviation of split frequencies: 0.015109
155500 -- [-668.034] (-672.911) (-671.822) (-668.824) * (-668.091) (-671.110) [-668.449] (-670.605) -- 0:00:54
156000 -- (-670.047) (-673.719) (-669.206) [-670.127] * (-670.239) (-670.835) [-669.418] (-670.889) -- 0:00:54
156500 -- (-673.793) [-672.310] (-670.070) (-667.304) * (-669.838) (-671.391) (-672.517) [-668.635] -- 0:00:53
157000 -- (-671.195) (-669.522) (-674.976) [-670.987] * [-668.839] (-672.124) (-673.298) (-668.760) -- 0:00:53
157500 -- (-674.285) [-668.773] (-674.458) (-669.474) * [-671.286] (-669.698) (-671.267) (-670.301) -- 0:00:53
158000 -- [-673.865] (-674.452) (-673.134) (-672.044) * [-667.870] (-671.264) (-671.282) (-669.474) -- 0:00:53
158500 -- (-675.215) [-673.202] (-670.341) (-670.509) * (-672.578) (-671.493) [-669.700] (-668.062) -- 0:00:58
159000 -- (-676.586) (-673.007) [-673.768] (-670.724) * (-671.530) (-669.204) [-672.136] (-670.945) -- 0:00:58
159500 -- (-675.755) [-671.722] (-671.018) (-671.262) * (-669.874) (-674.929) (-671.086) [-670.111] -- 0:00:57
160000 -- (-668.373) (-669.579) [-670.661] (-667.693) * [-671.985] (-670.538) (-671.697) (-671.319) -- 0:00:57
Average standard deviation of split frequencies: 0.017604
160500 -- [-669.546] (-671.450) (-669.805) (-670.922) * (-668.739) (-670.215) [-669.644] (-671.267) -- 0:00:57
161000 -- (-668.751) (-673.134) [-669.368] (-671.431) * [-673.565] (-671.574) (-674.677) (-671.094) -- 0:00:57
161500 -- (-672.779) (-670.767) [-672.958] (-671.492) * (-671.458) [-668.540] (-671.369) (-672.227) -- 0:00:57
162000 -- [-669.259] (-669.247) (-673.975) (-671.668) * [-671.078] (-669.512) (-668.558) (-670.236) -- 0:00:56
162500 -- [-668.667] (-670.797) (-676.791) (-669.853) * [-671.748] (-670.572) (-670.206) (-668.477) -- 0:00:56
163000 -- (-672.250) (-668.987) (-675.038) [-667.039] * (-671.861) [-670.075] (-668.402) (-671.689) -- 0:00:56
163500 -- (-671.075) (-670.614) (-677.601) [-668.646] * (-668.578) [-669.468] (-670.332) (-671.352) -- 0:00:56
164000 -- (-668.747) [-672.862] (-676.141) (-670.048) * (-669.915) (-671.168) [-670.552] (-672.401) -- 0:00:56
164500 -- (-668.352) (-669.630) (-677.442) [-670.421] * [-670.320] (-672.131) (-669.964) (-670.714) -- 0:00:55
165000 -- (-671.805) [-671.230] (-670.013) (-670.973) * (-669.040) [-669.266] (-672.478) (-670.309) -- 0:00:55
Average standard deviation of split frequencies: 0.017039
165500 -- (-671.113) (-676.395) [-669.474] (-669.612) * (-671.567) (-671.356) [-671.553] (-669.168) -- 0:00:55
166000 -- (-671.076) (-672.993) (-669.381) [-670.141] * (-672.638) (-671.654) (-670.266) [-672.544] -- 0:00:55
166500 -- (-671.508) (-672.311) [-670.321] (-668.985) * (-673.463) (-673.487) [-671.506] (-670.041) -- 0:00:55
167000 -- [-671.745] (-673.729) (-672.300) (-671.437) * (-669.280) (-675.666) [-669.443] (-672.616) -- 0:00:54
167500 -- (-672.549) [-671.847] (-672.467) (-671.116) * (-670.586) [-673.239] (-674.789) (-672.075) -- 0:00:54
168000 -- (-670.241) (-670.256) [-671.993] (-673.766) * (-670.693) [-671.693] (-670.750) (-668.489) -- 0:00:54
168500 -- (-671.407) (-669.801) (-671.096) [-670.563] * (-673.959) (-672.014) (-670.471) [-671.164] -- 0:00:54
169000 -- (-672.001) [-669.691] (-670.391) (-667.808) * (-670.999) (-673.948) [-668.408] (-672.725) -- 0:00:54
169500 -- (-668.799) (-670.122) (-671.463) [-667.925] * (-671.460) (-674.450) [-667.938] (-670.805) -- 0:00:53
170000 -- (-671.146) [-671.657] (-669.290) (-670.408) * [-672.818] (-670.180) (-668.819) (-669.490) -- 0:00:53
Average standard deviation of split frequencies: 0.016419
170500 -- (-671.229) [-671.414] (-671.456) (-673.016) * (-673.052) (-671.615) [-671.057] (-668.256) -- 0:00:53
171000 -- [-668.910] (-671.551) (-669.060) (-672.672) * (-671.697) (-669.389) (-674.513) [-671.814] -- 0:00:53
171500 -- (-669.113) (-674.996) [-668.964] (-669.042) * (-670.593) (-676.570) (-673.140) [-671.577] -- 0:00:53
172000 -- [-670.442] (-669.339) (-669.557) (-669.719) * (-667.808) [-674.757] (-672.206) (-669.172) -- 0:00:52
172500 -- (-666.805) (-671.407) (-671.662) [-667.512] * (-671.872) (-672.596) [-673.274] (-669.057) -- 0:00:52
173000 -- [-667.659] (-671.434) (-669.692) (-669.642) * (-670.724) (-670.836) [-670.730] (-669.437) -- 0:00:52
173500 -- (-670.645) (-672.851) [-669.056] (-669.526) * [-671.440] (-672.493) (-671.129) (-673.022) -- 0:00:52
174000 -- (-669.724) [-669.265] (-669.283) (-668.063) * (-670.982) (-673.708) (-671.530) [-669.500] -- 0:00:56
174500 -- (-669.339) (-671.549) [-667.466] (-668.598) * [-674.535] (-676.424) (-674.135) (-669.724) -- 0:00:56
175000 -- (-669.591) (-671.300) [-667.943] (-670.204) * (-671.510) (-671.785) [-668.392] (-671.722) -- 0:00:56
Average standard deviation of split frequencies: 0.017678
175500 -- (-674.518) (-670.750) [-667.478] (-669.232) * [-672.934] (-672.093) (-674.819) (-672.236) -- 0:00:56
176000 -- (-671.301) (-675.175) [-669.562] (-671.168) * (-672.137) (-669.535) [-671.508] (-669.992) -- 0:00:56
176500 -- (-670.794) [-672.191] (-669.481) (-679.737) * (-671.476) [-674.271] (-671.598) (-670.535) -- 0:00:55
177000 -- [-671.055] (-671.648) (-669.825) (-671.789) * (-670.735) (-672.067) (-671.025) [-670.851] -- 0:00:55
177500 -- [-669.378] (-672.497) (-669.749) (-671.430) * (-672.071) (-672.838) [-669.028] (-668.147) -- 0:00:55
178000 -- (-669.967) [-672.554] (-668.478) (-671.797) * (-672.265) (-672.239) (-671.251) [-671.258] -- 0:00:55
178500 -- (-668.129) [-670.324] (-669.503) (-672.400) * (-670.421) (-675.213) [-671.823] (-672.413) -- 0:00:55
179000 -- (-673.072) [-671.439] (-669.521) (-670.745) * (-676.475) (-673.435) [-671.651] (-674.040) -- 0:00:55
179500 -- [-671.882] (-669.729) (-669.983) (-672.912) * (-671.622) [-671.497] (-672.855) (-676.062) -- 0:00:54
180000 -- (-670.363) (-671.177) [-669.006] (-670.810) * (-674.483) (-673.053) [-671.329] (-672.404) -- 0:00:54
Average standard deviation of split frequencies: 0.016205
180500 -- (-667.736) (-669.820) (-670.689) [-668.634] * (-671.131) (-677.606) (-671.328) [-668.204] -- 0:00:54
181000 -- (-670.591) (-676.318) [-678.084] (-669.947) * (-671.748) (-671.240) [-669.239] (-667.830) -- 0:00:54
181500 -- [-667.952] (-671.999) (-677.226) (-669.667) * (-672.812) (-672.242) (-670.247) [-669.948] -- 0:00:54
182000 -- (-670.866) [-673.171] (-670.356) (-672.654) * (-671.254) [-672.533] (-670.042) (-668.391) -- 0:00:53
182500 -- (-670.790) (-676.232) [-672.268] (-673.283) * (-672.119) [-673.331] (-668.737) (-670.890) -- 0:00:53
183000 -- (-670.108) [-673.268] (-669.697) (-672.038) * (-671.688) [-670.660] (-669.538) (-669.540) -- 0:00:53
183500 -- (-669.230) [-671.777] (-671.969) (-670.241) * (-674.252) (-672.040) [-669.714] (-670.150) -- 0:00:53
184000 -- (-672.884) (-671.969) (-674.028) [-670.246] * (-670.649) (-670.879) (-670.378) [-669.397] -- 0:00:53
184500 -- (-673.275) [-672.164] (-671.842) (-669.596) * (-672.323) (-670.714) (-670.885) [-668.306] -- 0:00:53
185000 -- (-674.576) [-671.282] (-672.742) (-673.249) * (-670.775) (-673.621) [-670.083] (-668.503) -- 0:00:52
Average standard deviation of split frequencies: 0.013339
185500 -- (-669.620) (-671.417) [-669.235] (-672.463) * (-674.926) (-669.660) [-669.452] (-671.280) -- 0:00:52
186000 -- (-672.043) (-671.699) [-669.738] (-669.753) * (-676.330) (-670.963) [-670.340] (-671.669) -- 0:00:52
186500 -- (-670.874) [-671.101] (-670.910) (-670.396) * (-673.176) [-671.848] (-670.698) (-670.259) -- 0:00:52
187000 -- (-670.291) (-673.348) (-670.782) [-668.621] * (-673.296) (-670.756) [-670.800] (-670.493) -- 0:00:52
187500 -- [-668.005] (-672.203) (-672.309) (-673.498) * (-677.896) [-669.034] (-669.993) (-667.929) -- 0:00:52
188000 -- (-671.163) [-670.836] (-672.228) (-678.010) * (-672.487) [-670.127] (-670.496) (-672.314) -- 0:00:51
188500 -- (-673.391) (-671.281) [-670.098] (-677.596) * (-674.052) [-670.534] (-671.246) (-674.239) -- 0:00:51
189000 -- (-672.086) [-671.932] (-672.525) (-671.743) * (-673.764) [-671.134] (-672.989) (-667.902) -- 0:00:51
189500 -- (-672.838) (-671.195) (-670.109) [-672.485] * (-671.663) [-670.660] (-672.086) (-669.559) -- 0:00:55
190000 -- (-670.206) [-669.208] (-670.365) (-671.438) * [-669.402] (-669.118) (-669.446) (-672.110) -- 0:00:55
Average standard deviation of split frequencies: 0.014980
190500 -- (-671.221) [-668.213] (-672.065) (-673.311) * (-673.381) (-669.991) (-670.111) [-669.590] -- 0:00:55
191000 -- (-671.972) (-669.743) [-670.684] (-670.997) * (-670.980) [-674.458] (-669.811) (-671.984) -- 0:00:55
191500 -- (-671.098) (-677.452) (-674.130) [-670.852] * (-670.200) (-676.807) [-670.219] (-673.739) -- 0:00:54
192000 -- [-669.431] (-674.219) (-676.005) (-672.020) * (-667.952) (-675.855) (-671.455) [-672.074] -- 0:00:54
192500 -- [-670.473] (-671.009) (-671.880) (-671.746) * [-670.525] (-672.892) (-670.193) (-673.716) -- 0:00:54
193000 -- (-671.438) (-670.803) [-671.282] (-671.578) * [-669.846] (-671.122) (-674.249) (-670.601) -- 0:00:54
193500 -- [-672.269] (-671.616) (-673.084) (-672.797) * (-672.707) (-674.751) [-672.249] (-670.919) -- 0:00:54
194000 -- (-673.112) (-668.652) [-671.954] (-671.287) * (-670.011) (-673.931) (-672.020) [-670.562] -- 0:00:54
194500 -- (-672.353) (-672.641) [-669.508] (-672.906) * [-669.584] (-673.439) (-670.448) (-669.199) -- 0:00:53
195000 -- [-669.788] (-672.584) (-669.959) (-672.679) * (-673.410) [-670.000] (-670.959) (-671.064) -- 0:00:53
Average standard deviation of split frequencies: 0.013829
195500 -- [-669.260] (-673.730) (-670.540) (-675.203) * (-669.584) [-669.931] (-673.052) (-675.005) -- 0:00:53
196000 -- [-673.383] (-672.229) (-669.255) (-673.204) * [-672.092] (-668.221) (-669.781) (-670.371) -- 0:00:53
196500 -- (-681.201) [-668.317] (-670.876) (-671.256) * (-671.690) (-670.279) [-668.767] (-671.289) -- 0:00:53
197000 -- [-672.029] (-670.118) (-670.680) (-671.571) * [-673.293] (-668.525) (-672.848) (-675.430) -- 0:00:52
197500 -- (-671.836) (-669.913) [-672.632] (-671.319) * (-671.962) (-668.130) (-668.853) [-677.352] -- 0:00:52
198000 -- [-670.150] (-670.820) (-675.803) (-673.281) * [-669.008] (-670.767) (-672.470) (-670.279) -- 0:00:52
198500 -- (-672.533) [-671.342] (-672.369) (-672.970) * (-672.598) (-671.302) [-670.256] (-670.714) -- 0:00:52
199000 -- (-671.015) (-669.645) [-671.159] (-670.374) * (-671.526) [-670.161] (-671.206) (-668.707) -- 0:00:52
199500 -- (-670.424) (-670.547) (-671.735) [-673.174] * (-669.984) (-671.969) [-668.352] (-670.093) -- 0:00:52
200000 -- (-670.105) [-670.641] (-669.944) (-668.972) * [-667.806] (-668.016) (-670.362) (-670.909) -- 0:00:51
Average standard deviation of split frequencies: 0.013312
200500 -- (-672.166) (-669.769) (-670.592) [-668.373] * (-671.821) [-672.995] (-671.991) (-673.019) -- 0:00:51
201000 -- (-672.395) [-671.837] (-672.660) (-668.740) * (-673.880) [-667.957] (-669.010) (-670.146) -- 0:00:51
201500 -- (-672.591) (-670.877) [-670.381] (-672.631) * (-673.184) (-672.778) [-670.339] (-670.504) -- 0:00:51
202000 -- (-672.985) [-673.627] (-670.969) (-671.610) * (-673.781) [-668.111] (-677.849) (-671.226) -- 0:00:51
202500 -- [-668.835] (-673.493) (-671.317) (-669.848) * (-671.237) [-668.909] (-672.693) (-670.759) -- 0:00:51
203000 -- (-674.567) [-673.549] (-672.911) (-668.322) * (-669.213) (-672.719) (-673.345) [-669.734] -- 0:00:51
203500 -- (-672.803) [-669.525] (-672.960) (-668.626) * (-670.321) (-670.653) [-667.830] (-669.675) -- 0:00:50
204000 -- (-673.193) [-669.158] (-672.462) (-672.039) * (-670.386) (-671.128) [-669.499] (-671.418) -- 0:00:50
204500 -- [-670.404] (-671.939) (-676.496) (-671.193) * [-671.660] (-671.538) (-670.940) (-672.952) -- 0:00:50
205000 -- (-673.014) (-679.604) [-679.272] (-670.338) * [-670.847] (-668.652) (-669.695) (-672.876) -- 0:00:54
Average standard deviation of split frequencies: 0.013192
205500 -- (-671.696) (-674.291) (-672.575) [-670.546] * (-673.366) (-670.184) [-669.366] (-672.583) -- 0:00:54
206000 -- (-670.100) (-670.344) [-672.619] (-669.439) * (-676.787) [-667.908] (-670.146) (-670.903) -- 0:00:53
206500 -- (-672.167) (-671.673) [-673.257] (-671.762) * (-670.102) (-670.178) [-669.063] (-669.299) -- 0:00:53
207000 -- (-667.993) (-669.038) (-673.728) [-672.123] * (-670.055) (-671.708) [-669.469] (-669.535) -- 0:00:53
207500 -- [-669.292] (-668.215) (-671.047) (-671.189) * [-671.999] (-671.094) (-675.646) (-670.048) -- 0:00:53
208000 -- (-672.237) (-670.172) (-673.351) [-669.780] * [-670.920] (-674.515) (-668.412) (-673.416) -- 0:00:53
208500 -- (-671.512) (-668.492) [-669.672] (-670.281) * (-668.626) [-670.377] (-669.190) (-672.722) -- 0:00:53
209000 -- (-671.767) [-671.398] (-672.590) (-670.243) * (-670.770) [-669.271] (-668.819) (-670.416) -- 0:00:52
209500 -- [-668.972] (-671.505) (-669.477) (-668.518) * [-669.251] (-668.684) (-671.941) (-671.489) -- 0:00:52
210000 -- (-668.324) (-674.253) [-669.736] (-668.372) * (-672.843) (-667.787) (-668.258) [-672.178] -- 0:00:52
Average standard deviation of split frequencies: 0.013163
210500 -- (-672.278) (-670.049) [-670.359] (-672.633) * (-669.836) [-669.361] (-669.578) (-673.389) -- 0:00:52
211000 -- (-668.469) (-668.482) [-669.994] (-674.003) * (-668.955) (-674.242) (-667.268) [-672.431] -- 0:00:52
211500 -- (-668.814) (-672.335) (-672.661) [-669.363] * (-669.818) (-671.143) [-666.583] (-669.480) -- 0:00:52
212000 -- [-671.843] (-669.864) (-670.935) (-671.572) * (-670.763) (-670.375) (-668.496) [-668.078] -- 0:00:52
212500 -- (-670.771) (-671.450) [-670.190] (-674.781) * (-669.061) (-669.299) [-669.626] (-671.524) -- 0:00:51
213000 -- (-671.713) (-671.528) [-670.006] (-674.598) * (-672.252) [-670.913] (-672.054) (-681.547) -- 0:00:51
213500 -- (-669.616) (-671.955) [-668.562] (-677.513) * (-669.295) (-677.921) (-670.076) [-672.817] -- 0:00:51
214000 -- [-671.980] (-669.488) (-670.122) (-671.367) * (-669.603) (-681.078) (-669.774) [-671.818] -- 0:00:51
214500 -- [-671.416] (-672.757) (-670.856) (-671.418) * (-668.418) (-671.818) [-669.342] (-671.393) -- 0:00:51
215000 -- (-668.644) (-671.061) [-670.081] (-671.154) * (-670.899) (-672.680) [-670.604] (-670.381) -- 0:00:51
Average standard deviation of split frequencies: 0.013640
215500 -- [-671.123] (-671.935) (-670.710) (-669.699) * (-670.363) [-671.805] (-674.023) (-674.558) -- 0:00:50
216000 -- [-669.429] (-671.171) (-668.976) (-671.433) * (-669.999) [-672.642] (-673.229) (-670.345) -- 0:00:50
216500 -- (-670.029) (-670.423) [-669.592] (-673.836) * [-669.876] (-669.890) (-670.141) (-676.168) -- 0:00:50
217000 -- (-671.206) (-676.326) [-668.525] (-672.940) * (-669.918) (-672.008) [-668.702] (-678.832) -- 0:00:50
217500 -- [-670.564] (-672.023) (-670.322) (-671.989) * (-669.332) (-669.950) [-670.734] (-673.279) -- 0:00:50
218000 -- (-670.686) (-675.432) [-670.738] (-672.644) * (-669.047) [-671.869] (-670.833) (-672.407) -- 0:00:50
218500 -- [-671.124] (-669.018) (-671.572) (-672.150) * (-669.023) (-671.267) [-669.267] (-670.603) -- 0:00:50
219000 -- (-673.258) [-671.069] (-671.920) (-669.353) * [-669.530] (-669.916) (-672.249) (-669.786) -- 0:00:49
219500 -- [-672.598] (-674.995) (-670.892) (-671.711) * (-670.824) [-667.523] (-672.199) (-670.524) -- 0:00:49
220000 -- (-671.482) (-674.974) [-670.929] (-670.029) * [-671.687] (-670.905) (-670.803) (-669.365) -- 0:00:49
Average standard deviation of split frequencies: 0.013752
220500 -- [-670.139] (-673.014) (-673.366) (-669.983) * (-669.060) (-669.042) [-667.313] (-668.624) -- 0:00:53
221000 -- (-671.630) [-670.417] (-673.118) (-672.717) * (-668.457) (-668.073) [-668.713] (-668.034) -- 0:00:52
221500 -- [-670.407] (-669.989) (-674.240) (-671.683) * (-675.185) [-670.044] (-669.981) (-669.575) -- 0:00:52
222000 -- (-672.204) (-669.040) (-669.365) [-673.929] * (-673.479) (-669.182) (-669.591) [-671.260] -- 0:00:52
222500 -- [-674.274] (-673.243) (-674.094) (-671.015) * [-668.213] (-668.894) (-669.829) (-668.577) -- 0:00:52
223000 -- [-672.758] (-672.931) (-673.855) (-670.060) * (-668.577) (-670.224) [-668.512] (-668.415) -- 0:00:52
223500 -- (-671.908) (-673.964) (-671.092) [-670.631] * [-674.032] (-672.538) (-669.019) (-669.106) -- 0:00:52
224000 -- [-669.158] (-674.905) (-670.543) (-669.779) * [-670.067] (-672.933) (-669.414) (-672.475) -- 0:00:51
224500 -- [-673.233] (-673.192) (-670.781) (-670.466) * (-672.108) (-671.542) (-668.989) [-668.782] -- 0:00:51
225000 -- (-670.668) [-670.966] (-670.329) (-672.685) * [-670.166] (-668.735) (-669.682) (-670.327) -- 0:00:51
Average standard deviation of split frequencies: 0.012515
225500 -- (-674.511) [-672.368] (-671.464) (-671.607) * (-677.031) (-668.522) [-667.922] (-672.791) -- 0:00:51
226000 -- [-669.927] (-671.247) (-672.041) (-672.672) * (-668.196) (-668.771) [-671.058] (-669.655) -- 0:00:51
226500 -- (-669.395) [-669.841] (-671.613) (-672.259) * [-667.192] (-670.569) (-668.573) (-671.557) -- 0:00:51
227000 -- (-670.724) [-667.449] (-677.474) (-672.372) * [-669.229] (-669.524) (-672.116) (-672.943) -- 0:00:51
227500 -- (-671.431) (-669.590) (-670.634) [-670.627] * (-670.352) [-669.928] (-670.851) (-670.048) -- 0:00:50
228000 -- (-670.382) [-672.355] (-670.437) (-671.111) * (-673.488) (-669.858) (-672.131) [-668.863] -- 0:00:50
228500 -- (-671.469) [-668.242] (-671.638) (-671.793) * (-673.330) (-670.125) [-668.133] (-669.138) -- 0:00:50
229000 -- [-670.109] (-670.160) (-671.876) (-671.937) * (-667.113) (-671.552) (-671.226) [-669.244] -- 0:00:50
229500 -- [-670.172] (-669.278) (-674.057) (-670.981) * [-668.516] (-668.705) (-667.547) (-667.924) -- 0:00:50
230000 -- [-670.032] (-670.075) (-672.571) (-671.185) * (-667.638) [-668.206] (-669.437) (-668.412) -- 0:00:50
Average standard deviation of split frequencies: 0.012382
230500 -- (-668.968) (-673.779) (-667.639) [-668.874] * (-668.818) (-668.738) [-667.694] (-670.370) -- 0:00:50
231000 -- [-672.493] (-671.852) (-670.854) (-669.188) * (-670.380) (-671.170) [-669.088] (-669.829) -- 0:00:49
231500 -- (-669.289) (-670.859) (-671.036) [-667.719] * [-668.596] (-669.926) (-669.705) (-670.383) -- 0:00:49
232000 -- (-671.967) (-672.494) [-668.514] (-670.405) * (-669.532) [-670.941] (-671.629) (-669.538) -- 0:00:49
232500 -- (-671.667) (-670.650) [-669.009] (-669.411) * [-670.305] (-668.449) (-671.702) (-670.811) -- 0:00:49
233000 -- (-671.496) (-671.922) (-669.530) [-671.520] * (-668.981) (-669.115) (-670.245) [-670.903] -- 0:00:49
233500 -- [-669.726] (-672.985) (-668.456) (-677.491) * (-667.850) [-671.835] (-670.339) (-673.794) -- 0:00:49
234000 -- (-670.360) (-677.756) (-669.422) [-670.204] * (-676.223) (-672.109) (-669.651) [-668.385] -- 0:00:49
234500 -- [-670.355] (-670.631) (-671.736) (-674.696) * (-669.366) (-668.943) [-667.710] (-669.255) -- 0:00:48
235000 -- [-669.824] (-672.124) (-675.017) (-670.121) * (-672.770) (-670.504) [-668.724] (-670.557) -- 0:00:48
Average standard deviation of split frequencies: 0.011515
235500 -- (-670.929) [-674.369] (-673.148) (-675.611) * (-669.865) (-672.538) [-670.069] (-669.072) -- 0:00:51
236000 -- (-669.584) [-671.257] (-673.771) (-669.837) * [-666.697] (-670.880) (-673.314) (-668.807) -- 0:00:51
236500 -- (-671.116) (-672.645) [-668.196] (-667.522) * (-670.225) [-671.045] (-671.425) (-668.243) -- 0:00:51
237000 -- (-669.901) (-673.521) (-671.881) [-669.685] * (-671.328) [-670.836] (-671.262) (-671.131) -- 0:00:51
237500 -- [-669.215] (-672.306) (-670.558) (-671.706) * (-671.129) [-671.440] (-673.019) (-668.875) -- 0:00:51
238000 -- (-672.617) (-669.637) (-672.154) [-670.064] * [-669.742] (-670.564) (-673.482) (-670.412) -- 0:00:51
238500 -- (-670.185) [-671.240] (-670.028) (-670.904) * (-669.667) (-674.403) (-674.321) [-668.464] -- 0:00:51
239000 -- (-674.060) [-670.451] (-670.121) (-670.218) * (-668.376) (-672.873) [-668.932] (-668.956) -- 0:00:50
239500 -- (-675.357) [-671.883] (-670.751) (-668.700) * (-672.089) [-671.282] (-677.603) (-672.197) -- 0:00:50
240000 -- (-673.172) (-668.787) [-671.711] (-670.085) * (-674.691) (-671.838) (-679.386) [-670.590] -- 0:00:50
Average standard deviation of split frequencies: 0.011983
240500 -- (-671.671) (-670.238) [-670.460] (-669.894) * (-673.936) (-670.687) (-669.483) [-671.973] -- 0:00:50
241000 -- (-673.174) (-669.906) [-669.207] (-671.580) * [-669.997] (-671.285) (-668.878) (-670.454) -- 0:00:50
241500 -- (-670.432) [-668.581] (-670.569) (-669.756) * [-667.498] (-672.100) (-669.846) (-670.149) -- 0:00:50
242000 -- [-671.910] (-671.981) (-669.608) (-670.130) * [-670.133] (-672.356) (-669.735) (-671.304) -- 0:00:50
242500 -- (-673.370) [-668.953] (-671.188) (-668.811) * (-672.374) (-672.229) (-667.560) [-669.055] -- 0:00:49
243000 -- (-670.353) [-669.694] (-670.065) (-670.457) * [-670.929] (-672.624) (-670.756) (-668.889) -- 0:00:49
243500 -- (-671.018) [-667.504] (-671.134) (-674.352) * (-673.952) [-670.672] (-670.254) (-668.819) -- 0:00:49
244000 -- (-672.357) [-668.893] (-671.563) (-674.892) * [-671.521] (-671.406) (-668.486) (-667.432) -- 0:00:49
244500 -- [-671.872] (-668.626) (-671.241) (-673.520) * (-669.675) (-675.711) [-667.752] (-669.050) -- 0:00:49
245000 -- (-671.376) [-670.912] (-670.028) (-671.132) * (-669.977) (-670.793) (-667.605) [-668.848] -- 0:00:49
Average standard deviation of split frequencies: 0.010709
245500 -- [-669.806] (-670.339) (-668.602) (-672.382) * [-667.722] (-673.420) (-667.816) (-668.727) -- 0:00:49
246000 -- (-669.888) (-671.801) [-673.486] (-670.945) * [-668.867] (-674.226) (-666.687) (-671.087) -- 0:00:49
246500 -- (-671.691) [-670.951] (-673.949) (-671.200) * (-672.635) (-673.806) [-668.276] (-668.701) -- 0:00:48
247000 -- (-672.781) [-670.990] (-674.225) (-675.035) * (-671.507) [-669.919] (-668.307) (-673.523) -- 0:00:48
247500 -- (-671.736) (-668.288) (-672.403) [-670.386] * [-671.146] (-672.519) (-670.303) (-677.066) -- 0:00:48
248000 -- (-673.462) (-668.328) [-672.107] (-673.338) * (-669.684) (-673.340) [-667.478] (-672.685) -- 0:00:48
248500 -- (-671.725) (-667.294) [-670.148] (-672.473) * (-669.733) (-672.693) [-669.242] (-671.313) -- 0:00:48
249000 -- (-671.167) (-670.101) (-672.956) [-667.692] * (-670.842) (-669.932) (-675.210) [-668.376] -- 0:00:48
249500 -- (-669.413) (-670.578) [-673.631] (-671.575) * (-670.279) (-668.382) [-667.955] (-669.400) -- 0:00:48
250000 -- (-673.139) [-669.546] (-671.860) (-672.392) * (-671.224) (-673.010) (-669.688) [-668.601] -- 0:00:48
Average standard deviation of split frequencies: 0.010761
250500 -- (-668.930) [-668.836] (-672.553) (-672.543) * (-675.775) (-672.068) (-669.529) [-670.791] -- 0:00:47
251000 -- (-667.719) (-667.831) (-671.998) [-669.666] * (-672.111) (-671.999) (-672.914) [-668.515] -- 0:00:50
251500 -- (-669.948) [-668.113] (-670.351) (-675.320) * (-672.395) (-671.407) (-673.889) [-671.397] -- 0:00:50
252000 -- (-673.094) [-670.198] (-670.841) (-672.173) * (-671.711) (-668.476) [-668.028] (-671.131) -- 0:00:50
252500 -- (-673.052) (-670.128) (-672.656) [-672.490] * (-671.103) (-672.242) (-667.387) [-668.942] -- 0:00:50
253000 -- (-669.484) (-668.765) (-675.418) [-672.467] * (-670.895) (-672.034) [-668.205] (-670.923) -- 0:00:50
253500 -- (-674.432) [-668.501] (-673.357) (-674.708) * (-669.313) [-671.027] (-670.736) (-669.399) -- 0:00:50
254000 -- (-669.523) [-673.323] (-671.829) (-673.864) * (-670.538) (-669.765) (-672.456) [-669.947] -- 0:00:49
254500 -- (-671.015) [-668.047] (-671.765) (-674.604) * (-668.915) (-672.896) (-672.720) [-668.488] -- 0:00:49
255000 -- (-671.280) (-670.657) [-672.915] (-671.330) * (-671.350) (-672.053) [-671.613] (-672.826) -- 0:00:49
Average standard deviation of split frequencies: 0.011049
255500 -- [-669.014] (-670.167) (-672.455) (-671.726) * (-670.844) [-667.894] (-671.658) (-673.725) -- 0:00:49
256000 -- [-669.921] (-674.307) (-673.024) (-670.591) * (-669.670) [-671.431] (-670.217) (-677.191) -- 0:00:49
256500 -- (-668.357) (-670.469) [-670.721] (-669.712) * (-674.623) (-667.586) (-669.356) [-668.698] -- 0:00:49
257000 -- [-668.672] (-669.101) (-671.791) (-668.968) * (-669.553) (-671.873) [-669.170] (-672.235) -- 0:00:49
257500 -- (-671.101) (-667.895) [-672.665] (-674.698) * (-672.500) (-673.326) (-669.821) [-670.613] -- 0:00:49
258000 -- (-670.194) (-668.273) [-670.029] (-671.686) * [-672.801] (-670.218) (-669.160) (-670.637) -- 0:00:48
258500 -- [-671.045] (-668.539) (-674.595) (-668.375) * [-672.092] (-669.931) (-672.957) (-669.073) -- 0:00:48
259000 -- [-670.598] (-669.787) (-671.684) (-671.490) * (-670.596) (-669.565) (-672.144) [-670.970] -- 0:00:48
259500 -- (-677.146) (-668.499) [-671.568] (-669.170) * (-669.785) (-673.209) (-670.727) [-668.232] -- 0:00:48
260000 -- (-674.410) (-669.047) (-671.341) [-670.642] * (-671.183) (-671.959) (-675.007) [-670.402] -- 0:00:48
Average standard deviation of split frequencies: 0.011064
260500 -- (-674.648) (-670.365) [-669.245] (-673.065) * (-669.050) (-668.717) (-671.158) [-672.136] -- 0:00:48
261000 -- (-669.865) (-670.388) (-671.342) [-669.810] * (-669.216) [-670.227] (-679.831) (-672.956) -- 0:00:48
261500 -- (-669.662) (-671.117) (-671.430) [-668.401] * (-668.738) (-668.405) [-676.702] (-669.805) -- 0:00:48
262000 -- (-670.454) (-670.428) (-674.564) [-671.649] * (-673.020) (-670.535) [-669.370] (-674.814) -- 0:00:47
262500 -- [-670.411] (-668.504) (-668.788) (-673.715) * [-674.251] (-671.852) (-669.916) (-673.010) -- 0:00:47
263000 -- [-673.635] (-667.092) (-673.176) (-674.757) * (-676.324) (-673.622) [-670.849] (-672.706) -- 0:00:47
263500 -- (-670.456) [-670.846] (-669.388) (-671.894) * (-668.207) [-670.633] (-670.497) (-671.442) -- 0:00:47
264000 -- (-670.700) (-671.243) (-671.231) [-668.707] * (-670.945) (-668.687) [-669.206] (-671.573) -- 0:00:47
264500 -- (-667.859) (-667.759) [-672.223] (-671.813) * (-670.384) (-675.081) [-671.816] (-670.295) -- 0:00:47
265000 -- (-674.240) [-668.273] (-671.275) (-670.328) * (-670.723) (-675.992) [-669.443] (-673.341) -- 0:00:47
Average standard deviation of split frequencies: 0.011676
265500 -- (-670.247) [-667.826] (-675.964) (-669.631) * (-669.142) (-672.160) (-669.471) [-670.316] -- 0:00:47
266000 -- (-667.017) (-668.983) (-672.354) [-669.506] * (-668.152) (-668.809) (-678.934) [-670.466] -- 0:00:46
266500 -- [-668.532] (-669.230) (-669.827) (-671.870) * [-670.758] (-669.993) (-676.508) (-670.281) -- 0:00:49
267000 -- (-671.494) (-669.814) (-674.324) [-671.447] * (-670.410) (-668.147) [-675.485] (-669.579) -- 0:00:49
267500 -- (-673.847) (-671.517) [-669.791] (-668.559) * (-670.738) (-671.018) [-668.299] (-672.375) -- 0:00:49
268000 -- [-671.822] (-669.413) (-670.413) (-670.094) * (-672.860) (-672.476) [-670.589] (-672.543) -- 0:00:49
268500 -- [-670.905] (-671.399) (-668.341) (-668.594) * [-672.029] (-673.416) (-670.507) (-672.031) -- 0:00:49
269000 -- (-668.352) (-676.616) (-670.203) [-668.834] * [-672.291] (-674.077) (-668.659) (-672.952) -- 0:00:48
269500 -- [-666.693] (-675.944) (-672.403) (-673.467) * (-671.916) (-669.676) (-672.395) [-667.654] -- 0:00:48
270000 -- (-672.379) (-667.132) (-670.744) [-669.513] * (-668.479) (-670.138) (-674.797) [-669.915] -- 0:00:48
Average standard deviation of split frequencies: 0.011224
270500 -- (-672.417) (-666.803) (-673.170) [-670.038] * (-675.397) (-670.066) (-668.803) [-667.951] -- 0:00:48
271000 -- (-668.584) [-670.171] (-670.735) (-670.387) * (-672.809) (-671.091) [-672.166] (-672.300) -- 0:00:48
271500 -- [-667.720] (-668.474) (-670.076) (-669.709) * (-678.637) [-668.562] (-672.448) (-672.221) -- 0:00:48
272000 -- (-671.389) (-670.379) (-670.722) [-667.746] * (-670.961) [-670.640] (-670.410) (-671.369) -- 0:00:48
272500 -- (-668.130) (-668.978) [-675.899] (-672.077) * (-672.858) [-668.942] (-671.086) (-672.956) -- 0:00:48
273000 -- [-669.040] (-666.511) (-670.811) (-669.468) * (-669.649) (-669.868) [-671.588] (-670.806) -- 0:00:47
273500 -- [-669.869] (-670.058) (-671.918) (-672.052) * (-669.811) (-668.513) (-671.462) [-677.119] -- 0:00:47
274000 -- (-671.198) [-671.881] (-670.665) (-667.404) * (-671.202) (-670.802) (-672.688) [-674.028] -- 0:00:47
274500 -- [-667.681] (-670.931) (-669.396) (-669.825) * (-671.526) (-676.618) [-670.460] (-670.363) -- 0:00:47
275000 -- (-669.567) [-671.637] (-671.501) (-671.087) * (-670.363) (-680.583) (-673.249) [-671.117] -- 0:00:47
Average standard deviation of split frequencies: 0.011102
275500 -- (-669.769) [-668.882] (-669.339) (-671.065) * (-670.935) [-674.126] (-670.191) (-672.684) -- 0:00:47
276000 -- (-668.471) (-671.016) (-672.911) [-670.365] * (-673.590) (-673.316) [-669.317] (-669.865) -- 0:00:47
276500 -- [-668.243] (-668.066) (-672.670) (-674.830) * (-673.061) [-672.549] (-672.631) (-672.946) -- 0:00:47
277000 -- (-670.060) (-670.199) (-671.699) [-670.280] * [-678.022] (-669.316) (-672.457) (-674.023) -- 0:00:46
277500 -- (-668.751) (-670.830) (-671.290) [-670.305] * (-675.104) [-670.898] (-676.384) (-674.122) -- 0:00:46
278000 -- (-671.095) (-671.969) [-669.763] (-668.778) * (-671.329) [-668.315] (-667.862) (-672.147) -- 0:00:46
278500 -- [-670.739] (-669.097) (-672.358) (-669.262) * (-671.951) (-672.794) [-669.897] (-672.342) -- 0:00:46
279000 -- (-668.612) (-668.591) (-670.635) [-669.150] * (-669.762) [-671.640] (-674.045) (-674.544) -- 0:00:46
279500 -- [-668.473] (-669.135) (-672.709) (-672.883) * (-670.596) (-674.099) [-671.356] (-675.252) -- 0:00:46
280000 -- (-670.683) (-671.429) (-672.069) [-674.067] * (-675.767) [-671.427] (-671.682) (-671.885) -- 0:00:46
Average standard deviation of split frequencies: 0.010078
280500 -- [-668.343] (-670.576) (-672.542) (-677.593) * (-671.069) [-672.702] (-671.105) (-669.826) -- 0:00:46
281000 -- (-670.291) (-671.683) (-669.956) [-671.087] * (-670.310) (-673.297) [-670.827] (-672.455) -- 0:00:46
281500 -- [-667.674] (-671.659) (-670.369) (-672.546) * [-667.221] (-670.477) (-670.276) (-668.794) -- 0:00:45
282000 -- [-670.552] (-668.766) (-670.790) (-675.086) * (-669.506) (-676.011) [-668.848] (-670.172) -- 0:00:45
282500 -- (-671.985) (-672.115) (-668.622) [-672.386] * [-671.248] (-671.472) (-669.133) (-673.150) -- 0:00:48
283000 -- (-673.420) (-670.294) [-668.600] (-671.070) * (-671.002) (-672.389) (-669.069) [-671.592] -- 0:00:48
283500 -- (-670.585) [-671.835] (-670.459) (-671.503) * (-670.463) [-671.398] (-673.911) (-674.064) -- 0:00:48
284000 -- (-668.967) (-668.419) (-670.690) [-671.488] * [-669.556] (-669.992) (-672.401) (-674.295) -- 0:00:47
284500 -- (-670.293) (-669.666) [-671.854] (-669.352) * (-671.216) (-670.625) (-670.564) [-670.617] -- 0:00:47
285000 -- (-673.548) (-670.590) [-673.153] (-670.086) * (-671.182) (-673.237) (-670.962) [-670.715] -- 0:00:47
Average standard deviation of split frequencies: 0.010665
285500 -- [-671.091] (-669.852) (-669.451) (-672.748) * (-671.326) (-671.769) [-671.122] (-670.038) -- 0:00:47
286000 -- [-669.349] (-673.268) (-668.424) (-670.396) * (-672.809) (-671.085) (-669.975) [-671.202] -- 0:00:47
286500 -- (-667.389) [-668.585] (-671.295) (-669.957) * (-672.839) (-673.172) [-670.508] (-674.433) -- 0:00:47
287000 -- (-672.727) (-669.250) (-669.417) [-671.338] * [-670.661] (-674.684) (-671.867) (-671.714) -- 0:00:47
287500 -- (-667.747) [-670.129] (-669.422) (-670.763) * (-670.877) (-671.859) (-669.064) [-669.700] -- 0:00:47
288000 -- (-668.063) [-669.513] (-669.023) (-669.914) * (-670.508) (-671.446) (-670.813) [-670.328] -- 0:00:46
288500 -- (-672.256) (-671.132) (-670.643) [-674.940] * (-672.320) (-673.723) (-673.925) [-670.476] -- 0:00:46
289000 -- (-671.214) [-670.768] (-669.119) (-671.514) * (-670.929) (-674.283) (-673.636) [-672.112] -- 0:00:46
289500 -- [-672.308] (-672.743) (-671.798) (-670.588) * (-671.377) [-672.716] (-671.818) (-673.131) -- 0:00:46
290000 -- (-675.614) [-670.497] (-671.222) (-670.018) * (-674.246) [-670.383] (-672.146) (-671.240) -- 0:00:46
Average standard deviation of split frequencies: 0.008968
290500 -- (-672.154) (-669.465) [-669.413] (-668.551) * (-673.735) (-674.048) (-673.661) [-670.017] -- 0:00:46
291000 -- [-670.075] (-670.040) (-669.863) (-677.031) * (-671.405) [-671.061] (-672.504) (-672.019) -- 0:00:46
291500 -- [-670.639] (-671.846) (-672.092) (-674.933) * [-671.220] (-673.293) (-671.652) (-670.532) -- 0:00:46
292000 -- (-670.570) [-670.162] (-670.863) (-671.069) * (-671.435) [-673.346] (-671.013) (-672.196) -- 0:00:46
292500 -- (-670.519) (-667.670) [-669.721] (-672.487) * (-673.283) (-672.421) [-669.359] (-671.511) -- 0:00:45
293000 -- (-669.123) (-671.944) [-669.232] (-671.363) * (-672.057) (-672.606) (-669.684) [-674.227] -- 0:00:45
293500 -- [-669.649] (-671.413) (-667.205) (-671.318) * (-669.581) (-672.658) [-672.091] (-676.591) -- 0:00:45
294000 -- (-670.927) [-669.072] (-671.216) (-670.549) * (-672.712) (-671.155) [-671.509] (-672.656) -- 0:00:45
294500 -- (-669.854) (-673.740) (-673.475) [-671.858] * [-671.827] (-672.542) (-673.412) (-671.055) -- 0:00:45
295000 -- (-671.935) [-672.738] (-670.720) (-672.495) * (-670.838) [-673.637] (-670.671) (-669.262) -- 0:00:45
Average standard deviation of split frequencies: 0.009257
295500 -- (-672.041) (-673.200) (-670.904) [-671.968] * [-673.051] (-671.938) (-671.586) (-670.470) -- 0:00:45
296000 -- (-673.780) (-669.049) (-672.575) [-670.726] * (-672.740) (-672.440) [-669.673] (-670.882) -- 0:00:45
296500 -- (-672.450) (-672.781) (-670.685) [-668.212] * [-671.037] (-671.828) (-674.864) (-672.112) -- 0:00:45
297000 -- (-669.615) (-671.054) [-667.989] (-670.259) * [-671.861] (-672.428) (-669.993) (-669.642) -- 0:00:44
297500 -- [-670.537] (-671.025) (-670.953) (-672.365) * [-675.218] (-672.774) (-669.104) (-673.913) -- 0:00:44
298000 -- (-671.011) (-670.888) [-671.163] (-669.554) * (-671.403) [-671.357] (-672.481) (-673.606) -- 0:00:47
298500 -- (-669.005) (-672.052) [-669.816] (-671.459) * (-672.582) (-671.887) (-676.175) [-670.544] -- 0:00:47
299000 -- (-668.811) (-676.402) [-671.146] (-673.954) * (-670.520) (-672.258) (-672.864) [-670.567] -- 0:00:46
299500 -- (-670.669) [-670.950] (-669.361) (-674.374) * (-671.017) (-675.389) [-673.014] (-675.589) -- 0:00:46
300000 -- (-671.000) [-672.024] (-671.158) (-671.557) * (-673.687) (-674.170) [-672.007] (-674.567) -- 0:00:46
Average standard deviation of split frequencies: 0.009799
300500 -- (-673.609) [-668.387] (-669.672) (-669.662) * (-673.294) (-670.439) (-674.690) [-671.676] -- 0:00:46
301000 -- [-669.135] (-672.154) (-671.219) (-675.136) * (-671.926) (-672.970) (-672.116) [-670.871] -- 0:00:46
301500 -- [-671.071] (-673.745) (-670.884) (-670.768) * (-674.189) (-669.317) (-671.556) [-669.187] -- 0:00:46
302000 -- [-672.011] (-667.264) (-669.557) (-671.830) * [-671.844] (-671.760) (-672.267) (-670.589) -- 0:00:46
302500 -- (-670.998) [-667.850] (-669.226) (-670.113) * (-672.640) [-675.392] (-674.859) (-671.883) -- 0:00:46
303000 -- (-671.443) (-670.564) [-670.278] (-671.788) * [-670.085] (-676.727) (-674.723) (-671.415) -- 0:00:46
303500 -- [-670.504] (-668.762) (-668.946) (-671.354) * (-671.291) (-671.678) [-670.625] (-672.578) -- 0:00:45
304000 -- [-672.502] (-671.061) (-670.961) (-673.181) * [-671.757] (-670.414) (-669.673) (-674.538) -- 0:00:45
304500 -- (-674.037) [-667.624] (-671.742) (-672.048) * [-671.496] (-670.310) (-674.572) (-672.787) -- 0:00:45
305000 -- [-670.094] (-670.772) (-669.257) (-672.736) * (-670.137) (-673.015) [-670.612] (-673.240) -- 0:00:45
Average standard deviation of split frequencies: 0.010698
305500 -- (-669.965) (-672.891) (-669.304) [-671.589] * [-670.652] (-671.103) (-669.177) (-675.072) -- 0:00:45
306000 -- (-670.106) (-669.987) (-670.973) [-667.630] * (-672.731) (-672.859) (-672.466) [-669.645] -- 0:00:45
306500 -- (-666.602) (-669.876) [-671.467] (-669.420) * [-674.867] (-673.054) (-670.723) (-671.880) -- 0:00:45
307000 -- (-667.568) (-671.279) [-671.733] (-668.351) * (-674.672) (-672.222) [-671.944] (-670.093) -- 0:00:45
307500 -- (-668.907) (-672.386) [-668.705] (-670.055) * (-673.085) [-671.818] (-671.548) (-672.756) -- 0:00:45
308000 -- [-667.810] (-670.163) (-671.567) (-669.282) * (-670.536) (-670.348) (-670.723) [-670.752] -- 0:00:44
308500 -- [-671.556] (-669.732) (-669.387) (-669.881) * (-671.881) (-675.778) (-670.514) [-671.794] -- 0:00:44
309000 -- (-670.758) [-668.804] (-670.346) (-671.721) * [-671.017] (-670.395) (-673.933) (-672.957) -- 0:00:44
309500 -- (-670.501) [-670.692] (-672.728) (-670.188) * (-669.514) [-671.667] (-673.249) (-670.019) -- 0:00:44
310000 -- (-671.011) (-672.156) (-670.441) [-669.482] * [-670.105] (-672.703) (-671.434) (-669.281) -- 0:00:44
Average standard deviation of split frequencies: 0.010200
310500 -- (-668.727) (-669.092) [-667.555] (-672.673) * (-673.086) (-674.256) [-668.582] (-671.373) -- 0:00:44
311000 -- (-669.099) (-671.427) [-667.544] (-671.467) * (-671.118) (-673.621) (-670.348) [-668.766] -- 0:00:44
311500 -- (-671.545) (-669.678) [-676.302] (-671.186) * (-670.073) (-670.449) [-670.220] (-671.625) -- 0:00:44
312000 -- (-669.215) [-672.541] (-674.047) (-672.981) * (-669.550) (-673.160) [-671.719] (-672.294) -- 0:00:44
312500 -- [-670.538] (-670.734) (-671.266) (-680.488) * (-669.264) [-671.126] (-670.872) (-668.415) -- 0:00:44
313000 -- (-673.636) [-672.214] (-669.785) (-674.115) * (-669.750) (-673.007) (-674.134) [-667.310] -- 0:00:43
313500 -- (-672.321) (-670.565) (-669.601) [-671.190] * [-669.906] (-673.385) (-673.861) (-667.815) -- 0:00:45
314000 -- (-673.873) (-668.981) [-671.738] (-672.385) * (-669.080) (-671.064) [-669.126] (-668.492) -- 0:00:45
314500 -- (-668.976) (-668.636) [-672.592] (-674.679) * (-671.274) (-669.471) [-668.183] (-674.005) -- 0:00:45
315000 -- (-670.905) (-672.577) (-669.813) [-676.309] * (-668.444) [-670.284] (-668.027) (-678.067) -- 0:00:45
Average standard deviation of split frequencies: 0.011496
315500 -- (-672.344) (-669.853) (-672.638) [-668.618] * (-668.914) [-669.918] (-670.098) (-670.695) -- 0:00:45
316000 -- (-678.169) [-670.936] (-668.333) (-670.872) * (-670.672) (-669.212) (-670.278) [-669.029] -- 0:00:45
316500 -- (-673.874) (-672.263) [-670.754] (-671.913) * (-671.937) [-668.039] (-671.169) (-670.730) -- 0:00:45
317000 -- (-672.270) (-672.400) (-670.863) [-671.963] * (-671.243) (-669.849) [-669.407] (-670.666) -- 0:00:45
317500 -- (-670.457) (-673.315) [-670.725] (-671.744) * [-668.917] (-669.860) (-671.025) (-670.934) -- 0:00:45
318000 -- (-672.531) (-672.970) (-672.045) [-670.064] * [-668.682] (-669.751) (-676.781) (-669.465) -- 0:00:45
318500 -- (-671.781) [-671.621] (-671.779) (-669.928) * (-677.412) [-672.159] (-677.453) (-668.897) -- 0:00:44
319000 -- (-671.080) (-670.217) (-669.858) [-670.616] * (-671.053) (-674.492) (-674.525) [-667.805] -- 0:00:44
319500 -- (-670.352) (-670.865) [-668.709] (-670.614) * [-670.102] (-674.264) (-672.979) (-671.260) -- 0:00:44
320000 -- (-673.019) [-670.886] (-668.524) (-671.958) * [-670.440] (-670.977) (-670.471) (-671.252) -- 0:00:44
Average standard deviation of split frequencies: 0.010377
320500 -- [-671.065] (-671.056) (-669.785) (-672.801) * (-679.624) (-672.788) [-670.266] (-669.284) -- 0:00:44
321000 -- (-672.457) (-669.724) (-668.769) [-669.787] * (-674.947) (-671.763) [-669.813] (-673.357) -- 0:00:44
321500 -- (-671.638) (-670.835) (-669.337) [-673.465] * (-671.175) [-670.134] (-670.644) (-671.524) -- 0:00:44
322000 -- (-673.190) (-673.866) (-669.295) [-675.541] * (-669.269) (-668.435) [-674.210] (-669.816) -- 0:00:44
322500 -- (-673.114) [-670.895] (-667.512) (-675.341) * [-670.605] (-669.267) (-667.717) (-670.112) -- 0:00:44
323000 -- (-676.609) (-671.903) (-671.158) [-671.819] * (-672.126) (-668.976) (-670.985) [-669.731] -- 0:00:44
323500 -- (-674.351) (-672.408) [-668.992] (-670.173) * (-670.634) (-669.943) (-672.667) [-672.693] -- 0:00:43
324000 -- (-673.831) (-671.516) [-668.746] (-671.403) * (-671.868) (-670.955) [-670.396] (-672.704) -- 0:00:43
324500 -- (-673.417) (-670.465) [-671.128] (-672.499) * (-672.987) (-669.736) [-670.061] (-670.548) -- 0:00:43
325000 -- [-670.162] (-674.828) (-669.091) (-671.166) * (-672.078) (-669.567) [-668.472] (-672.339) -- 0:00:43
Average standard deviation of split frequencies: 0.011649
325500 -- (-672.236) (-671.243) (-672.070) [-670.982] * (-670.225) (-672.149) (-669.212) [-670.930] -- 0:00:43
326000 -- (-674.447) (-671.735) (-671.652) [-669.694] * [-672.230] (-668.939) (-670.314) (-675.586) -- 0:00:43
326500 -- (-670.845) [-668.574] (-672.017) (-669.814) * (-675.059) (-668.399) (-671.315) [-672.366] -- 0:00:43
327000 -- (-680.837) (-671.782) (-669.847) [-670.474] * (-669.860) (-668.868) (-670.690) [-671.747] -- 0:00:43
327500 -- (-668.936) [-670.638] (-668.713) (-672.695) * [-672.401] (-669.048) (-670.900) (-671.125) -- 0:00:43
328000 -- [-670.814] (-670.432) (-670.831) (-675.317) * (-669.663) (-675.677) (-669.486) [-671.760] -- 0:00:43
328500 -- (-672.191) (-671.514) [-668.410] (-672.417) * [-671.238] (-672.771) (-670.562) (-672.140) -- 0:00:42
329000 -- [-670.233] (-668.092) (-667.765) (-672.661) * (-672.244) (-673.103) [-675.668] (-672.249) -- 0:00:44
329500 -- (-670.885) (-673.501) (-669.643) [-671.351] * (-672.353) [-671.399] (-670.322) (-673.173) -- 0:00:44
330000 -- (-675.322) (-671.918) (-669.903) [-670.800] * [-672.415] (-670.667) (-671.191) (-671.419) -- 0:00:44
Average standard deviation of split frequencies: 0.010455
330500 -- (-674.118) (-671.443) [-671.281] (-670.102) * (-673.703) (-668.447) (-671.774) [-673.773] -- 0:00:44
331000 -- (-672.213) (-673.332) (-669.012) [-667.927] * (-672.184) (-668.857) [-668.688] (-673.866) -- 0:00:44
331500 -- (-672.460) (-671.572) [-670.442] (-671.182) * (-674.369) [-669.722] (-671.675) (-671.958) -- 0:00:44
332000 -- [-671.404] (-670.734) (-672.214) (-676.388) * [-674.116] (-672.034) (-670.196) (-672.334) -- 0:00:44
332500 -- [-672.295] (-668.899) (-671.501) (-673.234) * (-671.136) (-668.849) [-671.059] (-670.644) -- 0:00:44
333000 -- (-674.899) (-670.588) [-669.374] (-670.307) * (-670.642) (-670.329) [-670.386] (-670.579) -- 0:00:44
333500 -- (-672.173) (-671.928) (-670.502) [-668.993] * (-672.378) [-670.657] (-672.573) (-670.404) -- 0:00:43
334000 -- (-671.125) (-676.726) (-670.593) [-673.897] * [-671.189] (-672.780) (-672.126) (-669.711) -- 0:00:43
334500 -- (-672.007) [-675.974] (-672.288) (-672.277) * [-669.542] (-670.019) (-672.570) (-674.399) -- 0:00:43
335000 -- (-669.926) (-670.444) (-671.569) [-672.281] * [-668.475] (-668.101) (-671.320) (-671.288) -- 0:00:43
Average standard deviation of split frequencies: 0.011059
335500 -- (-671.260) (-668.657) [-672.379] (-677.930) * (-670.285) (-670.214) [-669.292] (-672.039) -- 0:00:43
336000 -- (-669.924) (-669.723) [-670.175] (-671.544) * (-671.436) [-673.789] (-667.062) (-671.298) -- 0:00:43
336500 -- (-672.802) (-669.705) (-669.442) [-668.140] * (-670.749) [-673.797] (-671.522) (-675.618) -- 0:00:43
337000 -- (-673.908) (-671.127) (-668.260) [-671.114] * (-672.629) [-668.526] (-668.056) (-675.040) -- 0:00:43
337500 -- (-674.912) (-669.094) [-671.299] (-669.825) * (-670.228) (-667.687) (-668.338) [-670.077] -- 0:00:43
338000 -- (-672.182) [-668.940] (-671.400) (-672.611) * (-671.649) (-670.538) [-668.643] (-668.543) -- 0:00:43
338500 -- (-671.380) (-673.041) (-674.678) [-668.056] * (-673.364) (-676.007) [-669.422] (-674.329) -- 0:00:42
339000 -- [-670.870] (-677.544) (-671.075) (-671.495) * [-671.632] (-676.469) (-667.674) (-671.432) -- 0:00:42
339500 -- [-670.605] (-668.824) (-671.090) (-674.582) * (-670.998) (-670.691) [-669.642] (-670.851) -- 0:00:42
340000 -- [-673.459] (-670.020) (-672.587) (-669.455) * (-669.715) [-668.591] (-669.511) (-678.794) -- 0:00:42
Average standard deviation of split frequencies: 0.011330
340500 -- [-672.292] (-669.583) (-670.812) (-669.881) * (-671.281) (-671.908) [-669.402] (-674.835) -- 0:00:42
341000 -- (-671.829) [-670.414] (-672.176) (-670.200) * (-670.874) (-672.034) (-668.255) [-674.787] -- 0:00:42
341500 -- (-671.839) (-671.632) (-670.614) [-670.535] * (-671.338) (-672.139) (-671.714) [-673.792] -- 0:00:42
342000 -- (-672.562) (-672.730) (-675.296) [-670.223] * (-670.470) [-669.342] (-671.050) (-674.116) -- 0:00:42
342500 -- (-671.045) [-671.817] (-672.854) (-672.471) * (-672.690) [-674.078] (-671.720) (-673.998) -- 0:00:42
343000 -- [-672.589] (-672.016) (-671.531) (-669.739) * (-671.745) (-670.700) [-668.217] (-670.471) -- 0:00:42
343500 -- (-670.551) (-671.070) [-669.080] (-672.080) * (-672.746) (-670.241) [-672.827] (-670.927) -- 0:00:42
344000 -- (-669.264) (-670.017) (-673.443) [-671.425] * (-670.619) (-673.424) (-670.819) [-671.075] -- 0:00:41
344500 -- (-670.459) (-671.701) (-670.589) [-666.691] * [-675.731] (-671.038) (-669.355) (-669.619) -- 0:00:43
345000 -- (-671.958) (-671.482) (-669.797) [-667.294] * (-676.480) [-671.098] (-668.138) (-672.702) -- 0:00:43
Average standard deviation of split frequencies: 0.011155
345500 -- (-671.667) (-669.809) (-670.591) [-671.373] * (-669.340) (-671.387) [-668.065] (-674.349) -- 0:00:43
346000 -- (-672.945) [-672.724] (-668.137) (-669.102) * (-670.078) [-667.883] (-671.228) (-674.598) -- 0:00:43
346500 -- (-675.700) (-670.056) [-669.603] (-671.727) * [-671.194] (-670.843) (-672.370) (-674.456) -- 0:00:43
347000 -- [-674.580] (-670.236) (-671.095) (-670.389) * [-670.761] (-671.452) (-668.862) (-672.748) -- 0:00:43
347500 -- (-668.623) [-671.996] (-672.754) (-668.747) * (-674.347) [-670.329] (-668.989) (-676.755) -- 0:00:43
348000 -- (-674.313) (-670.908) [-669.413] (-670.345) * [-668.621] (-671.097) (-672.216) (-669.399) -- 0:00:43
348500 -- [-670.172] (-669.580) (-667.995) (-670.870) * [-669.204] (-675.301) (-669.054) (-670.071) -- 0:00:42
349000 -- (-672.517) (-670.544) [-670.995] (-669.436) * (-669.662) (-671.561) [-668.462] (-671.051) -- 0:00:42
349500 -- [-671.962] (-673.420) (-669.281) (-669.768) * (-669.567) (-672.312) (-668.668) [-672.003] -- 0:00:42
350000 -- (-670.081) (-673.023) [-668.557] (-671.733) * (-672.878) [-671.007] (-668.577) (-670.497) -- 0:00:42
Average standard deviation of split frequencies: 0.012015
350500 -- [-670.320] (-672.498) (-669.809) (-672.656) * (-672.504) (-671.700) [-667.219] (-674.026) -- 0:00:42
351000 -- [-673.432] (-669.743) (-673.241) (-672.831) * (-670.804) (-671.777) [-668.750] (-675.949) -- 0:00:42
351500 -- (-671.959) (-670.306) (-672.464) [-671.166] * (-670.835) (-672.997) [-669.374] (-673.429) -- 0:00:42
352000 -- [-670.768] (-670.707) (-667.844) (-669.858) * [-668.688] (-671.219) (-670.677) (-671.078) -- 0:00:42
352500 -- [-670.458] (-671.839) (-672.929) (-675.888) * (-670.579) (-669.071) (-671.108) [-668.595] -- 0:00:42
353000 -- (-669.020) (-669.670) (-668.462) [-672.270] * (-669.329) (-673.128) [-669.002] (-670.311) -- 0:00:42
353500 -- (-675.154) (-672.274) [-668.574] (-673.752) * [-670.154] (-672.484) (-668.476) (-668.862) -- 0:00:42
354000 -- [-670.958] (-669.114) (-669.215) (-681.436) * (-671.550) (-671.265) (-669.696) [-670.033] -- 0:00:41
354500 -- [-670.649] (-669.742) (-671.771) (-673.958) * (-669.527) (-669.935) [-669.233] (-668.685) -- 0:00:41
355000 -- [-672.950] (-669.649) (-669.170) (-671.006) * (-670.719) (-669.350) (-669.386) [-671.744] -- 0:00:41
Average standard deviation of split frequencies: 0.013065
355500 -- (-672.965) (-669.649) (-671.619) [-667.150] * (-666.937) (-673.338) [-670.152] (-670.618) -- 0:00:41
356000 -- (-671.057) (-669.932) (-671.441) [-668.822] * (-668.646) (-672.017) [-669.120] (-671.394) -- 0:00:41
356500 -- (-670.092) (-673.219) [-672.837] (-667.489) * (-672.356) (-670.363) (-670.768) [-670.851] -- 0:00:41
357000 -- [-669.237] (-669.927) (-673.169) (-668.422) * (-670.553) (-672.952) [-673.936] (-668.773) -- 0:00:41
357500 -- (-675.134) (-672.548) (-672.395) [-668.372] * (-673.727) (-669.973) (-671.499) [-668.891] -- 0:00:41
358000 -- (-669.361) (-675.859) (-670.128) [-669.677] * [-671.763] (-673.891) (-671.507) (-672.220) -- 0:00:41
358500 -- (-669.863) (-673.205) [-672.247] (-668.265) * (-670.901) (-668.324) [-669.020] (-671.492) -- 0:00:41
359000 -- (-669.513) (-673.485) (-671.606) [-669.266] * (-670.511) [-670.785] (-669.080) (-670.287) -- 0:00:41
359500 -- (-670.971) (-670.951) (-672.806) [-669.234] * [-667.993] (-670.178) (-676.128) (-671.041) -- 0:00:40
360000 -- (-671.190) [-672.647] (-672.039) (-668.450) * (-671.368) [-669.086] (-673.627) (-669.734) -- 0:00:42
Average standard deviation of split frequencies: 0.012548
360500 -- (-670.780) [-670.110] (-670.101) (-668.368) * (-667.999) (-668.665) (-672.943) [-670.234] -- 0:00:42
361000 -- (-675.818) [-671.632] (-669.265) (-670.688) * (-671.735) [-669.254] (-672.904) (-673.167) -- 0:00:42
361500 -- (-673.395) (-671.922) (-673.066) [-671.869] * (-668.449) (-670.961) [-673.256] (-670.555) -- 0:00:42
362000 -- (-676.220) [-670.531] (-671.560) (-671.138) * (-669.479) (-670.223) (-670.402) [-669.965] -- 0:00:42
362500 -- [-675.990] (-672.118) (-671.661) (-676.433) * (-668.765) (-668.071) (-670.314) [-669.740] -- 0:00:42
363000 -- [-675.239] (-674.997) (-671.603) (-669.971) * (-672.717) (-673.125) (-670.450) [-668.257] -- 0:00:42
363500 -- (-672.985) [-671.985] (-674.041) (-667.851) * (-673.531) [-668.659] (-673.228) (-667.137) -- 0:00:42
364000 -- (-670.644) (-674.972) [-669.852] (-669.848) * (-670.748) (-673.267) (-674.386) [-668.639] -- 0:00:41
364500 -- (-674.189) (-672.440) [-668.181] (-670.930) * [-670.043] (-674.201) (-669.624) (-668.686) -- 0:00:41
365000 -- [-671.098] (-672.701) (-668.258) (-671.376) * (-671.391) [-668.207] (-670.108) (-667.843) -- 0:00:41
Average standard deviation of split frequencies: 0.013202
365500 -- (-672.369) (-670.054) [-669.656] (-669.610) * (-671.662) (-670.303) (-669.724) [-668.887] -- 0:00:41
366000 -- [-671.374] (-667.970) (-670.089) (-669.916) * (-669.031) (-671.959) [-668.731] (-672.180) -- 0:00:41
366500 -- (-671.947) [-668.702] (-671.744) (-668.232) * (-666.574) (-669.828) (-670.324) [-668.267] -- 0:00:41
367000 -- [-670.057] (-676.344) (-669.549) (-668.756) * [-668.122] (-672.257) (-671.872) (-669.119) -- 0:00:41
367500 -- [-671.195] (-671.120) (-669.294) (-670.295) * (-669.888) (-670.832) [-671.278] (-669.019) -- 0:00:41
368000 -- (-672.443) (-669.906) [-670.702] (-669.703) * [-667.817] (-671.085) (-669.567) (-671.379) -- 0:00:41
368500 -- (-675.785) (-671.248) (-669.909) [-671.720] * (-669.879) (-670.546) (-674.363) [-668.048] -- 0:00:41
369000 -- (-671.133) (-672.300) [-671.948] (-673.822) * (-669.123) [-673.869] (-673.124) (-672.173) -- 0:00:41
369500 -- (-674.055) (-669.160) (-672.530) [-675.759] * [-667.648] (-671.938) (-671.340) (-671.570) -- 0:00:40
370000 -- (-673.363) (-670.754) (-671.838) [-671.684] * (-672.426) (-673.285) [-669.219] (-668.695) -- 0:00:40
Average standard deviation of split frequencies: 0.013036
370500 -- (-674.115) (-670.424) [-674.138] (-671.860) * (-674.560) (-669.848) [-669.459] (-673.499) -- 0:00:40
371000 -- (-671.594) (-674.587) [-670.722] (-670.342) * (-669.173) [-671.806] (-671.201) (-673.755) -- 0:00:40
371500 -- (-670.830) (-671.246) (-669.052) [-671.898] * (-670.550) (-669.526) (-670.635) [-674.294] -- 0:00:40
372000 -- [-668.711] (-670.262) (-669.219) (-673.351) * (-671.861) [-670.062] (-672.574) (-669.545) -- 0:00:40
372500 -- (-669.354) (-673.699) (-673.350) [-669.462] * (-668.221) (-672.734) [-670.543] (-669.975) -- 0:00:40
373000 -- (-672.555) (-669.777) [-671.054] (-670.398) * [-668.352] (-675.486) (-669.562) (-669.732) -- 0:00:40
373500 -- (-671.817) [-670.308] (-673.800) (-672.697) * (-672.503) [-671.380] (-669.618) (-669.136) -- 0:00:40
374000 -- (-670.759) (-670.431) [-672.802] (-671.173) * (-673.315) [-669.247] (-673.454) (-671.695) -- 0:00:40
374500 -- (-671.084) (-672.999) (-671.487) [-670.906] * (-669.042) [-672.693] (-673.683) (-671.474) -- 0:00:40
375000 -- (-668.975) (-671.711) (-668.938) [-669.908] * [-668.510] (-671.094) (-672.735) (-668.649) -- 0:00:40
Average standard deviation of split frequencies: 0.012694
375500 -- (-673.006) (-673.263) [-668.490] (-671.342) * (-668.172) (-672.028) (-671.657) [-675.419] -- 0:00:41
376000 -- (-670.378) (-672.329) (-669.838) [-669.782] * (-676.291) [-668.932] (-670.815) (-673.326) -- 0:00:41
376500 -- (-667.803) (-671.181) [-673.885] (-669.760) * (-670.999) (-673.899) [-671.547] (-673.992) -- 0:00:41
377000 -- (-668.358) (-670.839) [-671.875] (-669.267) * (-671.417) [-675.501] (-672.491) (-673.448) -- 0:00:41
377500 -- (-672.525) (-672.436) (-675.115) [-670.107] * (-676.623) [-668.493] (-671.794) (-668.997) -- 0:00:41
378000 -- [-670.853] (-674.721) (-669.459) (-672.065) * (-671.487) (-673.622) (-669.924) [-670.820] -- 0:00:41
378500 -- (-670.063) (-674.773) (-671.822) [-671.026] * (-672.492) (-670.999) (-671.661) [-669.601] -- 0:00:41
379000 -- [-669.098] (-673.881) (-669.705) (-676.655) * (-669.968) [-672.604] (-672.678) (-669.920) -- 0:00:40
379500 -- [-669.526] (-672.656) (-673.587) (-670.469) * (-673.053) [-669.797] (-673.647) (-669.775) -- 0:00:40
380000 -- (-668.749) (-676.855) (-671.313) [-668.691] * (-669.621) (-669.658) (-671.507) [-671.351] -- 0:00:40
Average standard deviation of split frequencies: 0.013235
380500 -- [-668.165] (-674.092) (-671.987) (-672.835) * (-670.069) (-669.336) (-674.174) [-671.445] -- 0:00:40
381000 -- (-668.547) (-670.338) (-670.448) [-668.814] * (-673.192) [-668.151] (-669.954) (-671.411) -- 0:00:40
381500 -- (-670.890) (-670.582) (-668.784) [-668.583] * (-672.061) (-676.837) [-670.435] (-673.253) -- 0:00:40
382000 -- (-670.876) [-669.278] (-671.367) (-671.389) * (-672.304) (-671.130) [-670.950] (-674.056) -- 0:00:40
382500 -- [-672.047] (-670.958) (-671.116) (-671.554) * (-668.768) (-669.977) [-669.603] (-671.277) -- 0:00:40
383000 -- (-672.450) [-671.539] (-668.925) (-670.257) * (-675.292) (-671.369) [-671.433] (-669.094) -- 0:00:40
383500 -- [-667.347] (-670.446) (-671.707) (-674.037) * (-673.177) (-671.596) [-667.399] (-670.319) -- 0:00:40
384000 -- (-671.360) (-672.712) (-674.241) [-669.373] * (-672.507) (-669.272) [-671.298] (-675.563) -- 0:00:40
384500 -- (-669.864) [-671.922] (-676.126) (-672.900) * (-672.128) (-669.538) [-671.570] (-669.214) -- 0:00:40
385000 -- (-671.582) (-673.635) [-668.735] (-670.101) * (-675.186) (-671.700) (-670.136) [-668.453] -- 0:00:39
Average standard deviation of split frequencies: 0.013290
385500 -- (-672.117) (-674.047) [-670.257] (-673.448) * [-670.856] (-671.949) (-670.055) (-667.937) -- 0:00:39
386000 -- (-672.291) [-669.964] (-670.835) (-667.540) * (-671.159) (-671.038) (-673.034) [-670.498] -- 0:00:39
386500 -- (-671.049) [-677.441] (-670.815) (-671.828) * [-669.807] (-671.849) (-672.574) (-669.944) -- 0:00:39
387000 -- (-670.119) (-670.335) (-669.456) [-672.887] * (-670.866) (-670.974) [-669.983] (-667.386) -- 0:00:39
387500 -- (-666.918) [-673.102] (-669.803) (-673.422) * (-674.147) (-667.851) [-668.628] (-671.999) -- 0:00:39
388000 -- [-667.126] (-673.571) (-670.131) (-673.270) * (-672.097) (-675.012) [-668.225] (-670.129) -- 0:00:39
388500 -- (-668.732) (-672.076) (-668.059) [-669.928] * (-669.184) (-673.118) [-668.885] (-672.244) -- 0:00:39
389000 -- (-672.703) [-672.532] (-671.548) (-672.791) * (-671.905) (-667.931) [-670.193] (-670.708) -- 0:00:39
389500 -- (-671.017) (-674.168) (-671.910) [-671.191] * (-672.379) (-672.498) [-669.433] (-672.337) -- 0:00:39
390000 -- (-672.640) (-672.445) (-670.695) [-668.227] * (-670.644) (-671.118) [-670.565] (-669.609) -- 0:00:39
Average standard deviation of split frequencies: 0.013841
390500 -- (-670.184) (-671.654) [-667.940] (-672.398) * [-672.412] (-669.092) (-669.589) (-669.277) -- 0:00:39
391000 -- (-670.053) (-672.897) [-670.433] (-672.132) * (-671.324) (-670.524) (-667.946) [-670.618] -- 0:00:40
391500 -- [-668.874] (-671.269) (-668.272) (-669.139) * (-671.881) (-669.925) [-669.031] (-671.026) -- 0:00:40
392000 -- (-669.852) (-670.211) (-668.128) [-672.865] * [-672.511] (-669.358) (-671.550) (-672.918) -- 0:00:40
392500 -- (-668.812) (-671.048) (-669.578) [-672.746] * (-672.520) [-667.860] (-671.515) (-670.867) -- 0:00:40
393000 -- (-669.455) (-676.243) (-668.934) [-670.293] * (-674.860) (-674.663) [-668.604] (-669.769) -- 0:00:40
393500 -- (-669.566) (-671.324) (-670.757) [-672.496] * (-672.285) [-672.074] (-670.670) (-670.281) -- 0:00:40
394000 -- [-668.564] (-671.805) (-668.091) (-672.139) * (-671.384) (-672.808) (-671.568) [-669.647] -- 0:00:39
394500 -- (-671.658) [-668.924] (-672.252) (-671.241) * (-671.513) (-674.381) (-669.728) [-667.659] -- 0:00:39
395000 -- (-673.643) (-670.844) (-669.305) [-669.601] * (-672.749) (-669.371) (-671.492) [-669.636] -- 0:00:39
Average standard deviation of split frequencies: 0.014136
395500 -- [-670.060] (-671.023) (-670.767) (-673.705) * (-671.253) (-670.200) (-670.351) [-668.356] -- 0:00:39
396000 -- (-667.487) (-671.772) [-670.846] (-672.487) * (-672.407) [-670.892] (-669.483) (-669.319) -- 0:00:39
396500 -- (-669.607) (-672.917) (-673.741) [-670.524] * (-670.460) [-670.125] (-672.656) (-671.322) -- 0:00:39
397000 -- (-671.593) [-671.910] (-671.576) (-670.031) * (-671.195) (-669.089) [-669.527] (-669.255) -- 0:00:39
397500 -- [-666.678] (-671.106) (-671.515) (-668.188) * (-674.333) (-668.094) (-667.870) [-669.550] -- 0:00:39
398000 -- (-668.799) [-670.780] (-672.280) (-670.653) * (-671.943) [-669.983] (-669.919) (-672.932) -- 0:00:39
398500 -- [-669.549] (-669.062) (-671.921) (-670.220) * [-670.584] (-671.325) (-672.308) (-671.035) -- 0:00:39
399000 -- (-668.181) (-670.986) [-671.032] (-669.395) * (-671.590) [-671.551] (-670.353) (-670.174) -- 0:00:39
399500 -- (-668.647) (-671.630) (-670.158) [-670.470] * (-675.451) (-673.806) (-670.512) [-668.152] -- 0:00:39
400000 -- [-668.963] (-673.282) (-671.629) (-673.345) * (-670.678) (-672.958) (-672.527) [-670.534] -- 0:00:39
Average standard deviation of split frequencies: 0.013236
400500 -- (-672.379) (-672.329) (-670.993) [-670.053] * (-667.143) (-669.669) (-668.593) [-670.464] -- 0:00:38
401000 -- (-671.217) [-671.834] (-672.807) (-668.683) * (-669.045) (-671.650) [-670.398] (-672.141) -- 0:00:38
401500 -- (-669.267) [-673.347] (-671.236) (-670.770) * (-669.842) [-669.835] (-667.537) (-671.469) -- 0:00:38
402000 -- (-673.391) (-669.106) (-676.064) [-670.885] * (-668.594) [-669.817] (-668.282) (-672.238) -- 0:00:38
402500 -- [-669.229] (-669.673) (-669.512) (-669.125) * [-669.550] (-671.355) (-669.520) (-670.974) -- 0:00:38
403000 -- (-669.809) (-670.162) [-670.686] (-669.329) * (-670.632) (-668.195) [-669.176] (-670.752) -- 0:00:38
403500 -- [-671.546] (-673.316) (-671.071) (-674.769) * (-670.373) (-673.466) [-670.290] (-667.909) -- 0:00:38
404000 -- (-675.230) [-669.502] (-672.938) (-670.990) * (-670.898) (-673.576) [-668.110] (-669.769) -- 0:00:38
404500 -- (-672.684) (-667.380) [-670.924] (-671.439) * (-671.592) (-673.033) (-669.247) [-669.275] -- 0:00:38
405000 -- (-667.989) [-669.782] (-669.679) (-669.080) * (-673.430) (-669.251) [-668.655] (-677.648) -- 0:00:38
Average standard deviation of split frequencies: 0.013643
405500 -- (-671.117) (-670.081) [-670.846] (-670.380) * (-670.558) (-670.526) [-676.168] (-670.843) -- 0:00:38
406000 -- (-671.281) (-668.295) [-667.999] (-670.861) * (-671.822) (-670.395) (-668.367) [-670.375] -- 0:00:38
406500 -- (-672.339) (-669.317) (-668.924) [-669.941] * [-671.585] (-670.774) (-669.540) (-669.462) -- 0:00:39
407000 -- (-668.673) (-670.896) (-670.037) [-668.521] * (-670.878) [-668.942] (-669.757) (-673.615) -- 0:00:39
407500 -- (-672.689) (-669.037) (-671.045) [-672.329] * (-672.295) (-671.273) (-668.431) [-670.671] -- 0:00:39
408000 -- (-669.251) (-671.951) (-670.351) [-667.738] * (-672.464) (-673.896) (-670.756) [-670.772] -- 0:00:39
408500 -- (-669.264) [-667.845] (-669.934) (-672.427) * [-672.353] (-672.882) (-674.344) (-669.629) -- 0:00:39
409000 -- (-668.196) (-667.991) [-668.458] (-674.147) * [-670.998] (-669.370) (-670.963) (-669.638) -- 0:00:39
409500 -- (-673.345) [-669.749] (-672.410) (-675.591) * (-669.544) (-669.602) [-668.708] (-670.930) -- 0:00:38
410000 -- [-669.819] (-669.782) (-673.842) (-667.723) * [-669.383] (-675.794) (-670.954) (-670.845) -- 0:00:38
Average standard deviation of split frequencies: 0.012770
410500 -- [-669.765] (-670.016) (-669.901) (-674.098) * (-671.622) (-673.277) [-669.419] (-669.807) -- 0:00:38
411000 -- [-670.150] (-672.300) (-675.326) (-667.856) * (-671.196) (-670.505) [-671.668] (-668.565) -- 0:00:38
411500 -- (-669.780) (-672.541) [-671.074] (-669.650) * (-672.663) (-674.861) (-670.839) [-669.356] -- 0:00:38
412000 -- [-667.453] (-671.529) (-672.151) (-669.101) * (-674.778) (-670.670) [-667.146] (-669.508) -- 0:00:38
412500 -- (-667.885) (-673.179) (-671.224) [-669.158] * (-671.390) [-671.095] (-671.468) (-672.046) -- 0:00:38
413000 -- (-670.997) [-670.273] (-674.708) (-669.141) * [-672.475] (-668.531) (-670.203) (-671.039) -- 0:00:38
413500 -- (-669.789) (-671.059) (-672.400) [-673.571] * (-670.441) (-669.657) [-669.643] (-669.033) -- 0:00:38
414000 -- (-668.713) (-669.431) (-673.065) [-670.597] * (-669.745) [-676.831] (-669.263) (-672.063) -- 0:00:38
414500 -- (-667.497) (-668.541) (-673.715) [-668.486] * [-673.479] (-674.068) (-670.151) (-673.288) -- 0:00:38
415000 -- (-668.321) (-671.534) (-672.815) [-670.674] * (-672.196) [-671.959] (-669.483) (-672.621) -- 0:00:38
Average standard deviation of split frequencies: 0.012323
415500 -- (-667.587) (-667.890) (-672.162) [-667.911] * (-669.417) (-672.491) [-669.683] (-671.918) -- 0:00:37
416000 -- (-670.069) (-671.489) [-669.874] (-669.111) * (-669.704) (-673.549) (-670.863) [-669.848] -- 0:00:37
416500 -- (-669.576) (-672.378) (-675.529) [-671.066] * (-671.778) [-672.913] (-669.340) (-669.778) -- 0:00:37
417000 -- (-668.216) (-667.886) (-670.647) [-669.893] * (-669.117) (-670.833) [-670.189] (-667.495) -- 0:00:37
417500 -- (-668.815) (-668.904) (-670.938) [-669.196] * [-669.203] (-671.335) (-672.214) (-673.907) -- 0:00:37
418000 -- (-668.753) (-669.487) [-667.820] (-670.378) * (-671.400) [-671.026] (-668.317) (-671.210) -- 0:00:37
418500 -- [-669.610] (-669.981) (-670.219) (-670.235) * (-668.950) [-670.853] (-671.232) (-671.318) -- 0:00:37
419000 -- (-667.550) (-667.615) (-676.028) [-670.334] * [-668.409] (-675.229) (-673.925) (-671.355) -- 0:00:37
419500 -- (-671.275) (-669.078) [-675.613] (-672.200) * [-670.367] (-676.548) (-672.080) (-670.631) -- 0:00:37
420000 -- (-670.880) (-668.558) (-671.959) [-670.712] * (-671.214) (-673.270) [-670.062] (-670.809) -- 0:00:37
Average standard deviation of split frequencies: 0.013447
420500 -- [-670.394] (-668.738) (-668.882) (-669.988) * [-673.183] (-675.515) (-670.139) (-672.854) -- 0:00:37
421000 -- (-671.108) (-672.326) (-671.595) [-670.555] * (-670.548) [-672.853] (-669.544) (-671.328) -- 0:00:37
421500 -- (-669.417) [-671.108] (-669.654) (-671.427) * (-671.285) (-671.753) [-668.067] (-671.527) -- 0:00:37
422000 -- (-677.651) (-668.006) (-670.762) [-672.161] * (-670.276) (-671.621) (-670.385) [-670.871] -- 0:00:38
422500 -- (-670.137) (-669.326) (-668.376) [-668.314] * (-673.266) (-670.289) (-669.890) [-672.296] -- 0:00:38
423000 -- (-668.736) (-674.612) (-669.659) [-668.910] * (-672.717) (-668.951) (-669.995) [-672.182] -- 0:00:38
423500 -- (-668.005) [-671.240] (-668.515) (-671.064) * (-670.923) (-669.673) [-670.412] (-668.999) -- 0:00:38
424000 -- (-669.916) (-671.817) (-670.128) [-668.324] * [-668.989] (-671.417) (-670.912) (-670.856) -- 0:00:38
424500 -- (-669.860) [-670.225] (-671.533) (-666.861) * (-672.177) (-672.738) [-667.653] (-672.347) -- 0:00:37
425000 -- (-667.179) (-671.704) [-670.725] (-669.544) * [-670.773] (-672.113) (-673.639) (-671.880) -- 0:00:37
Average standard deviation of split frequencies: 0.011688
425500 -- (-672.292) (-672.443) (-673.135) [-669.766] * (-670.796) (-670.354) [-671.218] (-671.116) -- 0:00:37
426000 -- [-668.743] (-674.719) (-671.086) (-670.721) * [-671.022] (-675.179) (-669.174) (-674.496) -- 0:00:37
426500 -- (-671.201) [-668.245] (-671.753) (-673.142) * (-669.069) [-675.373] (-671.655) (-673.229) -- 0:00:37
427000 -- (-670.881) (-669.092) (-667.745) [-672.544] * [-669.872] (-672.733) (-671.440) (-671.668) -- 0:00:37
427500 -- (-668.889) (-672.526) [-667.206] (-673.079) * (-670.847) (-672.292) [-669.719] (-671.284) -- 0:00:37
428000 -- (-671.044) (-672.233) [-667.798] (-671.291) * (-670.011) (-675.161) [-668.418] (-672.648) -- 0:00:37
428500 -- [-670.961] (-671.292) (-668.737) (-671.303) * (-668.417) (-670.889) [-672.705] (-671.906) -- 0:00:37
429000 -- (-671.328) (-668.934) [-670.153] (-671.053) * (-668.013) [-672.657] (-668.881) (-672.565) -- 0:00:37
429500 -- (-674.014) (-672.662) [-672.249] (-674.638) * (-672.735) (-670.371) (-667.237) [-672.477] -- 0:00:37
430000 -- [-670.156] (-669.264) (-672.341) (-670.753) * (-668.731) (-671.521) (-668.384) [-670.391] -- 0:00:37
Average standard deviation of split frequencies: 0.011165
430500 -- [-669.704] (-670.824) (-671.179) (-668.943) * [-669.219] (-671.802) (-667.624) (-670.607) -- 0:00:37
431000 -- [-669.690] (-672.470) (-670.509) (-670.648) * [-670.833] (-673.353) (-670.395) (-670.594) -- 0:00:36
431500 -- (-672.613) (-672.449) [-671.061] (-674.857) * (-670.532) [-673.430] (-669.882) (-670.338) -- 0:00:36
432000 -- (-667.372) (-669.247) (-671.824) [-670.405] * [-671.460] (-670.266) (-670.552) (-670.215) -- 0:00:36
432500 -- (-667.786) (-671.560) [-669.848] (-674.688) * (-673.999) (-670.642) [-668.388] (-673.711) -- 0:00:36
433000 -- [-669.407] (-669.165) (-670.918) (-671.524) * (-674.473) (-668.574) [-668.956] (-672.193) -- 0:00:36
433500 -- (-669.173) (-670.261) [-674.126] (-672.760) * [-672.152] (-671.282) (-669.842) (-672.490) -- 0:00:36
434000 -- (-668.088) (-669.430) [-670.093] (-673.837) * (-672.687) [-673.579] (-670.089) (-672.368) -- 0:00:36
434500 -- (-668.523) (-670.368) [-674.639] (-672.610) * (-671.590) (-674.141) (-671.032) [-674.724] -- 0:00:36
435000 -- (-668.728) [-670.178] (-668.940) (-670.765) * (-670.858) (-670.611) [-668.167] (-672.565) -- 0:00:36
Average standard deviation of split frequencies: 0.011317
435500 -- (-667.278) (-672.111) (-671.177) [-669.342] * (-669.227) (-669.163) [-668.736] (-671.935) -- 0:00:36
436000 -- [-667.815] (-670.366) (-671.485) (-672.902) * (-672.789) [-670.777] (-669.717) (-670.690) -- 0:00:36
436500 -- (-669.674) (-670.373) [-669.168] (-672.839) * (-671.658) (-671.992) (-670.022) [-671.426] -- 0:00:36
437000 -- [-668.858] (-672.187) (-668.770) (-669.611) * (-671.314) (-671.827) (-668.901) [-670.535] -- 0:00:36
437500 -- (-668.344) (-673.388) [-668.470] (-670.661) * (-669.265) [-669.024] (-670.096) (-670.762) -- 0:00:37
438000 -- (-670.522) (-671.692) (-669.615) [-668.938] * [-669.668] (-668.583) (-670.177) (-669.883) -- 0:00:37
438500 -- [-668.866] (-672.126) (-670.452) (-671.509) * (-672.226) (-668.984) (-671.689) [-669.703] -- 0:00:37
439000 -- [-671.064] (-668.911) (-667.407) (-669.637) * [-669.511] (-667.860) (-675.931) (-670.841) -- 0:00:37
439500 -- (-675.891) [-668.563] (-669.958) (-674.437) * (-669.910) (-670.216) [-670.808] (-672.355) -- 0:00:36
440000 -- (-672.437) (-671.469) (-672.426) [-668.160] * (-668.100) (-673.003) [-671.385] (-674.987) -- 0:00:36
Average standard deviation of split frequencies: 0.011553
440500 -- (-672.325) (-668.034) [-673.100] (-670.768) * (-670.834) [-670.955] (-670.322) (-673.742) -- 0:00:36
441000 -- [-667.912] (-671.321) (-668.118) (-673.049) * [-666.098] (-671.494) (-672.671) (-671.641) -- 0:00:36
441500 -- (-669.589) [-673.396] (-669.862) (-671.929) * (-671.786) (-671.239) (-669.203) [-670.940] -- 0:00:36
442000 -- (-674.351) (-670.111) [-671.358] (-671.289) * [-667.525] (-668.825) (-668.029) (-670.141) -- 0:00:36
442500 -- (-670.770) [-669.473] (-672.636) (-669.040) * (-668.844) [-670.223] (-669.136) (-669.526) -- 0:00:36
443000 -- [-668.549] (-671.222) (-670.319) (-670.384) * (-667.443) [-668.975] (-669.832) (-674.016) -- 0:00:36
443500 -- [-669.536] (-669.740) (-667.344) (-671.079) * (-667.728) (-669.433) (-670.688) [-670.585] -- 0:00:36
444000 -- [-670.544] (-670.792) (-671.059) (-671.356) * (-670.194) [-670.029] (-669.036) (-670.028) -- 0:00:36
444500 -- (-670.710) (-668.214) (-672.867) [-669.474] * [-668.609] (-670.353) (-671.141) (-674.383) -- 0:00:36
445000 -- (-673.394) (-667.922) [-670.333] (-671.839) * [-667.629] (-670.288) (-672.510) (-671.408) -- 0:00:36
Average standard deviation of split frequencies: 0.012261
445500 -- (-670.651) [-667.654] (-666.983) (-671.512) * (-668.196) (-670.477) (-672.035) [-669.462] -- 0:00:36
446000 -- (-669.716) (-667.356) (-668.142) [-670.502] * (-667.300) (-672.135) [-670.243] (-670.981) -- 0:00:36
446500 -- (-673.630) [-666.468] (-671.778) (-670.917) * (-674.372) [-672.185] (-678.649) (-676.014) -- 0:00:35
447000 -- [-673.563] (-671.039) (-669.902) (-673.978) * (-673.335) [-670.087] (-671.401) (-669.234) -- 0:00:35
447500 -- (-670.133) [-666.995] (-669.605) (-675.176) * (-669.542) (-669.247) (-670.120) [-670.646] -- 0:00:35
448000 -- [-672.445] (-671.510) (-673.662) (-670.118) * [-670.567] (-670.686) (-672.032) (-673.090) -- 0:00:35
448500 -- (-672.491) [-668.998] (-671.673) (-669.941) * [-668.220] (-670.337) (-672.884) (-671.337) -- 0:00:35
449000 -- (-672.288) (-670.120) (-670.827) [-671.891] * [-666.876] (-668.694) (-673.427) (-671.270) -- 0:00:35
449500 -- (-669.163) (-673.526) [-670.947] (-670.168) * (-676.498) [-670.035] (-669.563) (-674.255) -- 0:00:35
450000 -- (-668.610) (-671.683) [-670.832] (-672.305) * [-670.295] (-673.456) (-669.883) (-671.551) -- 0:00:35
Average standard deviation of split frequencies: 0.012204
450500 -- (-671.082) (-671.450) [-669.393] (-672.383) * [-671.271] (-670.466) (-670.660) (-670.572) -- 0:00:35
451000 -- [-669.034] (-674.711) (-669.448) (-676.075) * (-667.308) (-670.898) [-668.299] (-669.834) -- 0:00:35
451500 -- [-670.442] (-670.928) (-671.113) (-671.694) * (-669.668) (-670.212) (-669.915) [-671.248] -- 0:00:35
452000 -- (-670.820) (-673.086) [-669.059] (-672.100) * (-668.205) (-673.691) [-670.877] (-671.778) -- 0:00:35
452500 -- (-673.117) (-670.257) (-669.107) [-670.353] * [-669.491] (-672.576) (-667.571) (-671.741) -- 0:00:35
453000 -- [-669.722] (-669.618) (-670.245) (-669.529) * (-668.837) (-673.761) [-669.651] (-672.124) -- 0:00:35
453500 -- (-669.171) (-671.604) (-671.832) [-668.983] * (-669.398) [-672.342] (-672.164) (-672.848) -- 0:00:36
454000 -- (-671.525) (-674.125) [-666.845] (-669.375) * [-671.922] (-672.246) (-668.342) (-671.786) -- 0:00:36
454500 -- (-669.967) (-668.591) (-672.597) [-668.069] * (-671.169) (-672.269) (-672.821) [-669.118] -- 0:00:36
455000 -- [-668.522] (-669.506) (-669.686) (-673.509) * [-670.277] (-670.020) (-671.181) (-669.175) -- 0:00:35
Average standard deviation of split frequencies: 0.012405
455500 -- (-669.096) (-671.282) (-670.112) [-672.386] * (-673.584) (-670.535) [-669.810] (-671.143) -- 0:00:35
456000 -- (-672.946) (-668.508) (-668.337) [-669.858] * (-671.808) (-671.840) [-668.574] (-672.446) -- 0:00:35
456500 -- (-671.195) (-671.623) (-669.568) [-671.796] * (-671.608) (-671.947) [-672.628] (-673.942) -- 0:00:35
457000 -- (-671.000) (-671.994) [-675.923] (-668.779) * [-670.393] (-670.614) (-671.467) (-672.513) -- 0:00:35
457500 -- (-671.161) (-669.158) [-668.888] (-669.813) * (-669.851) (-674.310) [-671.037] (-672.398) -- 0:00:35
458000 -- (-671.063) (-673.535) (-670.844) [-669.570] * [-667.564] (-669.863) (-671.635) (-670.984) -- 0:00:35
458500 -- (-670.293) (-672.515) [-668.409] (-668.557) * (-670.610) (-672.429) (-671.248) [-668.083] -- 0:00:35
459000 -- [-672.112] (-670.697) (-670.928) (-668.568) * (-668.894) (-671.406) [-669.551] (-671.640) -- 0:00:35
459500 -- (-672.428) (-670.403) (-668.353) [-666.952] * (-667.467) [-667.387] (-672.257) (-669.480) -- 0:00:35
460000 -- (-673.560) [-671.942] (-668.904) (-669.749) * (-668.976) (-667.893) [-671.435] (-669.082) -- 0:00:35
Average standard deviation of split frequencies: 0.011802
460500 -- [-674.877] (-674.733) (-671.322) (-670.887) * (-670.231) [-670.068] (-670.684) (-671.770) -- 0:00:35
461000 -- (-670.157) (-673.741) (-667.522) [-669.073] * [-668.124] (-670.918) (-670.079) (-673.222) -- 0:00:35
461500 -- (-673.200) (-671.698) (-671.201) [-669.975] * (-674.559) (-674.270) [-668.898] (-674.261) -- 0:00:35
462000 -- (-678.807) (-673.966) [-669.974] (-667.623) * (-671.665) [-668.585] (-669.727) (-672.449) -- 0:00:34
462500 -- (-678.159) [-669.214] (-668.444) (-670.010) * (-671.024) (-670.317) (-669.402) [-668.426] -- 0:00:34
463000 -- (-669.927) (-673.169) [-667.572] (-670.672) * (-673.363) [-669.308] (-671.664) (-671.486) -- 0:00:34
463500 -- (-669.348) (-668.955) (-670.696) [-670.673] * (-668.622) [-669.196] (-672.214) (-669.461) -- 0:00:34
464000 -- (-671.303) (-668.130) (-670.548) [-669.297] * (-672.910) (-669.216) [-669.590] (-672.270) -- 0:00:34
464500 -- (-675.600) (-669.926) [-669.820] (-671.759) * (-673.224) [-669.498] (-670.623) (-669.888) -- 0:00:34
465000 -- (-672.783) (-672.860) [-668.787] (-672.880) * (-670.042) [-668.059] (-671.042) (-670.306) -- 0:00:34
Average standard deviation of split frequencies: 0.012274
465500 -- (-671.081) (-668.516) (-670.153) [-670.513] * (-673.638) (-668.046) [-670.188] (-676.344) -- 0:00:34
466000 -- (-670.427) (-667.231) (-669.361) [-671.074] * (-673.857) [-671.962] (-675.137) (-675.164) -- 0:00:34
466500 -- (-671.054) [-670.138] (-668.935) (-667.951) * (-670.926) (-669.434) (-669.787) [-669.130] -- 0:00:34
467000 -- (-670.949) [-670.615] (-671.700) (-668.502) * (-669.108) [-670.783] (-668.661) (-668.546) -- 0:00:34
467500 -- (-672.377) [-671.595] (-670.249) (-671.010) * (-671.329) [-669.853] (-669.911) (-669.482) -- 0:00:34
468000 -- (-671.826) [-668.973] (-669.492) (-668.404) * [-670.084] (-670.101) (-674.267) (-672.134) -- 0:00:34
468500 -- (-669.207) [-673.497] (-669.266) (-674.084) * [-670.347] (-670.339) (-669.829) (-673.862) -- 0:00:35
469000 -- (-672.139) [-672.718] (-670.589) (-670.916) * (-673.354) [-671.219] (-671.583) (-671.542) -- 0:00:35
469500 -- (-671.499) (-672.680) [-675.069] (-668.878) * [-669.939] (-671.984) (-673.934) (-669.577) -- 0:00:35
470000 -- (-673.297) [-668.837] (-672.511) (-669.090) * [-674.346] (-671.881) (-669.813) (-670.467) -- 0:00:34
Average standard deviation of split frequencies: 0.011551
470500 -- (-672.732) (-673.966) [-669.660] (-676.209) * (-670.872) [-670.210] (-668.582) (-672.640) -- 0:00:34
471000 -- (-676.534) (-672.509) (-670.445) [-669.413] * [-668.476] (-671.083) (-667.919) (-671.430) -- 0:00:34
471500 -- (-672.769) [-669.677] (-671.884) (-670.087) * (-669.327) (-670.121) (-673.372) [-671.522] -- 0:00:34
472000 -- (-670.057) [-671.608] (-673.464) (-667.918) * [-673.406] (-670.994) (-670.349) (-671.330) -- 0:00:34
472500 -- (-669.704) [-667.720] (-672.128) (-669.948) * (-675.291) [-671.789] (-669.807) (-671.849) -- 0:00:34
473000 -- [-672.566] (-668.490) (-671.899) (-672.393) * (-669.145) [-675.045] (-671.326) (-670.753) -- 0:00:34
473500 -- (-668.268) (-669.803) (-670.887) [-671.241] * (-670.274) (-680.375) [-669.657] (-669.401) -- 0:00:34
474000 -- [-670.110] (-670.242) (-669.531) (-670.072) * (-671.198) (-674.601) [-669.384] (-671.541) -- 0:00:34
474500 -- [-669.096] (-667.146) (-669.787) (-672.586) * [-670.656] (-668.296) (-667.915) (-670.470) -- 0:00:34
475000 -- (-671.576) (-668.322) (-669.539) [-669.862] * [-669.193] (-670.015) (-673.186) (-669.517) -- 0:00:34
Average standard deviation of split frequencies: 0.011422
475500 -- (-674.291) [-669.782] (-669.356) (-671.406) * [-669.765] (-670.898) (-669.851) (-669.087) -- 0:00:34
476000 -- [-679.172] (-669.983) (-669.756) (-669.298) * [-675.880] (-673.131) (-670.587) (-668.305) -- 0:00:34
476500 -- (-672.035) [-670.953] (-672.429) (-675.323) * [-672.423] (-672.776) (-668.896) (-670.315) -- 0:00:34
477000 -- (-671.196) [-669.383] (-669.477) (-677.598) * (-673.117) [-671.424] (-668.568) (-670.852) -- 0:00:33
477500 -- (-671.191) (-668.115) (-670.890) [-673.934] * (-668.512) (-669.242) [-671.720] (-670.327) -- 0:00:33
478000 -- (-673.087) [-671.135] (-673.331) (-669.681) * (-672.130) (-671.254) [-670.784] (-675.453) -- 0:00:33
478500 -- (-671.653) (-668.676) (-672.550) [-668.159] * (-670.685) (-671.175) (-670.131) [-670.410] -- 0:00:33
479000 -- [-673.690] (-670.037) (-674.939) (-672.358) * [-669.094] (-671.091) (-670.473) (-669.193) -- 0:00:33
479500 -- [-673.558] (-669.176) (-672.056) (-670.821) * (-671.823) (-671.755) (-673.688) [-669.799] -- 0:00:33
480000 -- [-668.447] (-672.030) (-670.664) (-670.146) * (-671.073) (-671.753) [-676.050] (-670.854) -- 0:00:33
Average standard deviation of split frequencies: 0.010069
480500 -- (-672.192) [-670.572] (-672.414) (-669.344) * (-670.931) (-673.334) (-669.236) [-673.353] -- 0:00:33
481000 -- (-668.794) [-670.390] (-670.951) (-669.782) * (-671.742) (-670.400) (-668.936) [-670.968] -- 0:00:33
481500 -- (-670.288) (-671.550) (-671.563) [-672.633] * (-670.254) (-669.971) [-667.853] (-670.572) -- 0:00:33
482000 -- [-668.611] (-671.731) (-672.061) (-668.633) * (-672.288) (-669.592) [-669.238] (-671.921) -- 0:00:33
482500 -- [-670.963] (-671.221) (-672.575) (-670.466) * [-670.222] (-671.502) (-672.779) (-673.163) -- 0:00:33
483000 -- (-670.029) [-674.529] (-672.089) (-668.559) * (-669.669) [-671.409] (-674.109) (-670.360) -- 0:00:33
483500 -- (-667.966) (-671.456) [-671.407] (-670.785) * (-670.183) (-672.080) (-671.525) [-667.767] -- 0:00:33
484000 -- (-668.886) (-669.477) [-668.912] (-671.942) * (-669.771) [-674.377] (-675.124) (-669.088) -- 0:00:34
484500 -- (-670.045) (-671.894) [-668.593] (-668.934) * (-671.212) (-669.972) (-673.719) [-669.218] -- 0:00:34
485000 -- (-670.725) (-672.434) [-671.579] (-669.139) * (-673.815) (-671.821) [-671.978] (-674.676) -- 0:00:33
Average standard deviation of split frequencies: 0.009958
485500 -- (-669.708) (-667.373) [-669.170] (-671.633) * [-674.192] (-670.547) (-671.599) (-673.777) -- 0:00:33
486000 -- (-669.381) (-674.471) [-670.139] (-668.003) * (-670.039) [-672.202] (-672.264) (-668.232) -- 0:00:33
486500 -- (-668.731) [-673.673] (-668.750) (-672.400) * [-671.322] (-669.891) (-670.886) (-667.778) -- 0:00:33
487000 -- (-668.164) [-669.842] (-672.669) (-669.447) * (-669.979) (-674.448) (-671.105) [-670.044] -- 0:00:33
487500 -- (-668.281) (-669.615) (-668.657) [-670.954] * (-671.579) (-670.472) (-671.470) [-667.345] -- 0:00:33
488000 -- [-669.100] (-673.078) (-669.646) (-669.065) * (-673.189) (-672.248) (-670.833) [-669.189] -- 0:00:33
488500 -- (-666.997) [-669.737] (-668.000) (-673.824) * (-671.731) [-673.881] (-671.744) (-669.947) -- 0:00:33
489000 -- [-670.330] (-671.377) (-671.227) (-668.402) * [-671.520] (-673.792) (-670.373) (-671.387) -- 0:00:33
489500 -- (-670.770) (-673.748) [-671.948] (-668.968) * (-670.662) (-671.427) [-668.075] (-670.154) -- 0:00:33
490000 -- (-670.402) (-670.611) (-669.854) [-672.029] * [-672.075] (-668.156) (-673.296) (-671.001) -- 0:00:33
Average standard deviation of split frequencies: 0.010760
490500 -- (-672.699) [-669.281] (-673.336) (-668.105) * (-668.762) (-674.087) [-668.363] (-670.635) -- 0:00:33
491000 -- (-671.318) (-672.184) [-673.047] (-670.698) * (-670.573) [-672.530] (-668.616) (-669.206) -- 0:00:33
491500 -- (-670.428) (-670.530) [-670.957] (-673.606) * (-668.704) (-669.037) (-668.347) [-667.751] -- 0:00:33
492000 -- (-670.415) [-668.179] (-672.425) (-669.584) * (-669.353) (-668.918) [-667.668] (-669.215) -- 0:00:33
492500 -- [-672.596] (-668.928) (-670.745) (-667.643) * (-671.718) (-670.457) [-669.107] (-671.678) -- 0:00:32
493000 -- (-670.671) (-668.915) [-669.535] (-668.770) * (-670.318) (-671.488) [-671.652] (-672.438) -- 0:00:32
493500 -- (-668.741) [-668.199] (-668.791) (-670.513) * (-674.513) (-671.962) [-669.280] (-670.413) -- 0:00:32
494000 -- [-670.527] (-672.285) (-670.978) (-670.178) * (-678.512) (-669.403) [-669.055] (-670.413) -- 0:00:32
494500 -- (-669.758) (-674.557) [-667.572] (-671.084) * [-669.808] (-668.551) (-672.661) (-670.797) -- 0:00:32
495000 -- [-669.597] (-671.434) (-670.549) (-670.606) * (-671.840) (-668.777) [-673.401] (-668.237) -- 0:00:32
Average standard deviation of split frequencies: 0.010518
495500 -- (-670.008) [-670.888] (-668.864) (-668.725) * (-670.783) (-671.406) [-670.199] (-668.719) -- 0:00:32
496000 -- [-669.247] (-669.968) (-669.159) (-674.265) * [-671.316] (-667.632) (-668.153) (-668.971) -- 0:00:32
496500 -- (-668.850) (-672.549) [-669.169] (-670.779) * (-673.166) [-674.004] (-671.976) (-668.987) -- 0:00:32
497000 -- (-668.662) (-674.994) (-671.556) [-670.667] * (-670.772) (-675.697) (-673.123) [-669.795] -- 0:00:32
497500 -- [-667.214] (-669.078) (-670.667) (-667.879) * [-667.905] (-672.334) (-670.235) (-671.708) -- 0:00:32
498000 -- (-668.223) [-671.921] (-669.743) (-667.801) * [-671.799] (-672.475) (-674.261) (-674.475) -- 0:00:32
498500 -- (-669.822) (-672.426) (-669.803) [-667.342] * (-668.972) (-672.276) [-669.660] (-675.421) -- 0:00:32
499000 -- (-669.453) [-675.900] (-671.163) (-668.844) * (-669.638) [-675.634] (-671.747) (-674.734) -- 0:00:32
499500 -- (-668.820) (-673.221) [-669.460] (-669.223) * (-671.068) (-668.810) (-670.748) [-667.406] -- 0:00:33
500000 -- [-673.338] (-673.233) (-673.279) (-669.053) * (-676.092) (-671.517) (-671.634) [-668.628] -- 0:00:33
Average standard deviation of split frequencies: 0.010106
500500 -- [-672.132] (-671.222) (-670.795) (-669.401) * (-678.454) [-670.853] (-671.279) (-670.364) -- 0:00:32
501000 -- [-670.472] (-674.192) (-671.502) (-669.776) * (-673.160) (-673.487) (-671.766) [-671.269] -- 0:00:32
501500 -- (-670.097) (-673.799) [-669.945] (-671.396) * (-670.293) (-670.622) (-668.869) [-670.559] -- 0:00:32
502000 -- (-669.908) (-673.026) (-671.990) [-670.874] * (-672.786) [-671.349] (-668.322) (-670.315) -- 0:00:32
502500 -- [-672.598] (-675.913) (-675.233) (-672.497) * (-668.690) (-670.020) [-667.698] (-669.846) -- 0:00:32
503000 -- (-670.721) (-679.234) (-673.232) [-675.621] * [-671.757] (-670.501) (-670.450) (-673.254) -- 0:00:32
503500 -- (-670.563) (-675.858) [-672.618] (-668.323) * (-669.189) (-670.776) (-670.516) [-670.210] -- 0:00:32
504000 -- [-668.783] (-673.564) (-673.608) (-669.723) * (-672.968) (-670.578) [-671.490] (-670.645) -- 0:00:32
504500 -- (-672.771) [-673.335] (-673.468) (-671.927) * (-674.394) (-670.872) [-669.252] (-667.056) -- 0:00:32
505000 -- (-673.025) [-671.534] (-670.597) (-668.884) * (-671.870) [-669.866] (-676.710) (-671.023) -- 0:00:32
Average standard deviation of split frequencies: 0.010772
505500 -- (-671.575) [-672.556] (-670.637) (-667.719) * (-671.149) (-671.417) [-669.954] (-667.441) -- 0:00:32
506000 -- (-669.587) (-672.867) (-669.188) [-668.645] * (-670.466) (-671.733) (-669.303) [-667.801] -- 0:00:32
506500 -- (-671.183) [-671.362] (-668.800) (-673.323) * [-669.571] (-681.787) (-667.727) (-672.159) -- 0:00:32
507000 -- (-671.600) (-670.403) [-670.424] (-671.828) * [-672.021] (-671.865) (-672.016) (-671.235) -- 0:00:32
507500 -- (-667.967) [-671.811] (-669.836) (-669.370) * [-669.262] (-670.643) (-669.549) (-674.493) -- 0:00:32
508000 -- (-671.844) (-671.105) [-669.903] (-672.100) * (-671.546) [-671.001] (-669.806) (-673.244) -- 0:00:31
508500 -- [-673.253] (-672.554) (-668.478) (-670.362) * (-670.283) [-669.887] (-672.920) (-669.488) -- 0:00:31
509000 -- (-669.090) (-671.681) (-669.410) [-670.497] * (-670.620) (-669.901) [-672.246] (-670.760) -- 0:00:31
509500 -- (-669.355) (-672.871) (-668.685) [-673.564] * (-670.555) (-670.559) (-670.869) [-667.166] -- 0:00:31
510000 -- (-669.327) (-670.225) [-671.141] (-671.689) * [-671.543] (-671.431) (-669.654) (-669.932) -- 0:00:31
Average standard deviation of split frequencies: 0.010031
510500 -- (-671.525) (-671.859) [-671.165] (-670.467) * [-670.422] (-672.502) (-669.869) (-668.518) -- 0:00:31
511000 -- [-671.197] (-671.047) (-674.075) (-674.426) * [-670.878] (-668.923) (-670.004) (-667.504) -- 0:00:31
511500 -- (-673.008) (-674.437) (-671.585) [-668.877] * (-672.869) (-669.282) [-668.749] (-669.448) -- 0:00:31
512000 -- (-671.245) (-670.089) (-669.291) [-670.898] * (-670.302) (-674.107) (-669.531) [-670.806] -- 0:00:31
512500 -- [-670.043] (-669.090) (-670.196) (-672.819) * (-668.647) (-671.288) (-671.501) [-672.430] -- 0:00:31
513000 -- (-668.654) (-672.311) (-669.279) [-671.646] * [-668.428] (-674.580) (-674.272) (-672.946) -- 0:00:31
513500 -- (-673.875) (-669.894) [-668.008] (-671.412) * (-669.411) (-676.292) [-670.214] (-669.911) -- 0:00:31
514000 -- [-669.769] (-670.639) (-669.694) (-670.711) * [-669.776] (-670.945) (-675.058) (-671.541) -- 0:00:31
514500 -- (-671.086) (-671.854) (-670.817) [-671.233] * (-669.373) [-668.911] (-672.688) (-677.431) -- 0:00:31
515000 -- (-670.663) [-669.512] (-671.633) (-669.456) * (-668.613) (-668.832) [-671.695] (-671.436) -- 0:00:32
Average standard deviation of split frequencies: 0.009988
515500 -- (-669.863) [-673.914] (-669.681) (-667.174) * [-671.021] (-669.805) (-673.310) (-672.364) -- 0:00:31
516000 -- (-671.631) (-672.936) [-670.375] (-668.804) * [-670.085] (-670.089) (-672.909) (-671.823) -- 0:00:31
516500 -- (-671.397) (-676.251) [-669.371] (-668.088) * (-669.599) [-669.338] (-673.177) (-669.715) -- 0:00:31
517000 -- (-669.085) (-670.783) (-670.910) [-668.759] * (-669.443) (-671.413) [-669.303] (-672.600) -- 0:00:31
517500 -- (-673.650) (-671.983) (-671.898) [-667.218] * (-668.752) [-671.034] (-670.804) (-674.250) -- 0:00:31
518000 -- (-670.585) (-668.643) (-670.345) [-668.864] * [-669.990] (-671.920) (-671.502) (-673.780) -- 0:00:31
518500 -- (-669.632) (-669.832) (-671.553) [-671.429] * (-671.887) [-672.330] (-672.455) (-676.348) -- 0:00:31
519000 -- (-672.199) (-669.603) (-668.613) [-668.521] * [-667.705] (-671.506) (-672.826) (-671.248) -- 0:00:31
519500 -- (-669.290) (-672.145) (-672.502) [-669.261] * [-670.211] (-674.052) (-672.212) (-670.521) -- 0:00:31
520000 -- (-671.230) (-673.763) [-673.570] (-671.069) * (-671.362) (-672.616) (-670.324) [-669.874] -- 0:00:31
Average standard deviation of split frequencies: 0.010382
520500 -- (-674.688) (-672.820) [-669.600] (-669.248) * (-671.239) [-670.695] (-670.538) (-670.318) -- 0:00:31
521000 -- (-671.354) (-671.800) [-668.712] (-671.153) * (-669.803) (-669.123) (-673.907) [-670.844] -- 0:00:31
521500 -- (-669.984) (-672.415) (-671.703) [-668.393] * (-670.500) (-669.058) [-672.480] (-671.534) -- 0:00:31
522000 -- (-672.404) (-671.754) [-669.499] (-671.203) * [-668.986] (-667.378) (-671.173) (-669.794) -- 0:00:31
522500 -- (-667.326) [-672.613] (-669.579) (-670.944) * [-668.124] (-671.361) (-671.115) (-670.066) -- 0:00:31
523000 -- (-670.707) (-677.315) [-672.708] (-669.144) * (-673.022) (-672.073) [-671.633] (-670.067) -- 0:00:31
523500 -- (-670.514) (-677.514) (-670.780) [-673.018] * [-669.762] (-668.389) (-671.636) (-671.688) -- 0:00:30
524000 -- [-668.313] (-673.436) (-669.359) (-670.186) * (-674.136) (-672.148) (-672.331) [-670.175] -- 0:00:30
524500 -- (-669.012) (-673.147) (-671.006) [-674.571] * (-668.803) (-673.604) (-674.072) [-668.847] -- 0:00:30
525000 -- [-669.314] (-670.948) (-671.821) (-670.962) * (-669.974) [-670.939] (-669.131) (-670.548) -- 0:00:30
Average standard deviation of split frequencies: 0.010698
525500 -- (-672.711) [-668.216] (-669.912) (-671.352) * (-671.292) (-672.100) (-670.895) [-669.534] -- 0:00:30
526000 -- (-670.248) (-668.038) [-669.593] (-674.781) * (-672.063) (-672.684) (-673.828) [-671.251] -- 0:00:30
526500 -- (-670.512) (-670.186) (-669.098) [-671.533] * [-673.498] (-670.078) (-670.424) (-668.778) -- 0:00:30
527000 -- (-668.290) (-672.704) (-672.109) [-670.496] * (-673.096) [-671.115] (-672.596) (-671.144) -- 0:00:30
527500 -- (-667.690) [-667.647] (-673.447) (-668.935) * (-669.842) [-675.012] (-671.375) (-671.144) -- 0:00:30
528000 -- (-679.908) (-671.094) (-669.567) [-669.131] * (-671.650) (-675.899) (-670.920) [-669.697] -- 0:00:30
528500 -- (-670.020) [-673.714] (-671.191) (-671.533) * (-672.898) (-676.277) (-675.210) [-669.839] -- 0:00:30
529000 -- (-675.125) [-671.168] (-670.922) (-676.040) * [-671.138] (-670.792) (-678.999) (-671.449) -- 0:00:30
529500 -- [-668.900] (-671.567) (-673.729) (-669.203) * (-672.149) (-671.864) [-678.369] (-671.065) -- 0:00:30
530000 -- (-669.857) (-670.304) (-670.815) [-670.400] * (-673.118) (-670.391) (-669.669) [-668.712] -- 0:00:30
Average standard deviation of split frequencies: 0.010555
530500 -- (-669.289) (-669.191) [-667.700] (-674.853) * [-672.988] (-670.292) (-675.681) (-671.367) -- 0:00:30
531000 -- [-670.717] (-671.354) (-671.765) (-671.727) * (-671.853) [-670.688] (-672.346) (-670.441) -- 0:00:30
531500 -- (-671.565) (-670.758) (-669.179) [-673.729] * [-672.213] (-672.966) (-671.846) (-673.215) -- 0:00:30
532000 -- (-672.085) [-671.517] (-671.800) (-672.774) * (-671.032) (-669.834) [-671.929] (-670.639) -- 0:00:30
532500 -- [-671.561] (-670.095) (-676.948) (-671.063) * (-669.949) (-671.831) (-672.163) [-674.054] -- 0:00:30
533000 -- (-668.571) (-669.609) (-672.966) [-669.848] * (-671.294) [-672.424] (-672.548) (-669.946) -- 0:00:30
533500 -- (-670.416) (-672.422) (-671.206) [-672.491] * [-672.165] (-675.084) (-672.803) (-669.501) -- 0:00:30
534000 -- [-669.182] (-673.122) (-672.678) (-673.390) * [-671.399] (-670.403) (-674.955) (-669.356) -- 0:00:30
534500 -- (-669.911) [-674.303] (-671.088) (-670.554) * [-669.647] (-670.687) (-671.823) (-673.776) -- 0:00:30
535000 -- [-670.259] (-672.713) (-671.572) (-668.054) * [-671.244] (-671.007) (-671.232) (-673.430) -- 0:00:30
Average standard deviation of split frequencies: 0.010939
535500 -- (-670.290) [-669.877] (-671.851) (-669.182) * (-668.985) (-671.544) [-671.148] (-672.723) -- 0:00:30
536000 -- (-668.525) (-671.084) (-669.070) [-670.369] * (-674.624) [-674.759] (-670.692) (-669.920) -- 0:00:30
536500 -- (-677.037) (-674.533) (-670.232) [-668.595] * (-676.329) (-671.696) [-671.847] (-671.330) -- 0:00:30
537000 -- (-669.292) (-675.690) [-673.593] (-673.925) * (-670.025) (-671.487) (-670.341) [-669.392] -- 0:00:30
537500 -- (-673.037) (-668.697) (-671.948) [-668.729] * (-673.000) (-672.797) (-674.242) [-668.865] -- 0:00:30
538000 -- (-674.730) (-668.269) [-668.093] (-669.008) * (-671.368) [-672.452] (-674.850) (-672.557) -- 0:00:30
538500 -- (-671.438) [-669.608] (-669.398) (-669.010) * (-672.387) (-669.982) [-671.834] (-674.513) -- 0:00:29
539000 -- (-673.900) (-673.099) (-671.242) [-668.825] * (-670.694) (-669.527) (-672.221) [-671.175] -- 0:00:29
539500 -- (-673.919) (-670.038) [-668.683] (-669.992) * [-668.989] (-671.626) (-673.348) (-674.883) -- 0:00:29
540000 -- (-668.287) (-668.385) (-671.096) [-669.580] * (-671.420) [-672.237] (-673.698) (-673.138) -- 0:00:29
Average standard deviation of split frequencies: 0.009649
540500 -- (-672.849) [-669.706] (-668.864) (-671.655) * [-671.466] (-670.132) (-670.963) (-670.537) -- 0:00:29
541000 -- (-669.587) [-668.577] (-671.166) (-670.565) * (-672.264) (-668.557) (-670.526) [-667.420] -- 0:00:29
541500 -- [-668.480] (-670.025) (-674.867) (-670.431) * [-668.186] (-670.621) (-671.576) (-670.540) -- 0:00:29
542000 -- [-668.273] (-668.321) (-670.909) (-669.850) * [-671.514] (-670.679) (-671.892) (-669.318) -- 0:00:29
542500 -- [-668.904] (-671.622) (-669.858) (-670.719) * (-669.912) [-668.126] (-671.846) (-668.255) -- 0:00:29
543000 -- [-670.794] (-668.771) (-669.902) (-671.133) * (-671.535) (-670.633) (-669.277) [-669.864] -- 0:00:29
543500 -- (-674.180) [-668.125] (-670.088) (-669.604) * (-668.898) (-671.199) (-672.652) [-671.487] -- 0:00:29
544000 -- (-671.488) (-672.072) [-668.767] (-668.464) * (-669.060) (-669.874) [-672.514] (-671.072) -- 0:00:29
544500 -- (-673.311) [-670.878] (-668.878) (-669.941) * (-670.070) (-672.632) [-671.328] (-673.116) -- 0:00:29
545000 -- (-670.302) (-671.848) [-671.912] (-670.569) * (-675.904) [-669.326] (-671.540) (-669.167) -- 0:00:29
Average standard deviation of split frequencies: 0.009324
545500 -- [-673.232] (-670.476) (-673.226) (-673.861) * (-671.191) (-672.812) (-673.552) [-671.128] -- 0:00:29
546000 -- (-675.550) [-670.942] (-670.413) (-670.511) * (-670.917) (-673.738) [-669.840] (-673.399) -- 0:00:29
546500 -- (-669.751) (-672.957) [-668.914] (-674.261) * [-671.295] (-671.240) (-673.649) (-669.597) -- 0:00:29
547000 -- [-673.751] (-669.287) (-669.990) (-673.039) * (-671.375) (-676.006) [-670.171] (-671.073) -- 0:00:29
547500 -- (-673.274) (-674.418) [-667.190] (-676.331) * [-672.608] (-670.558) (-670.942) (-671.920) -- 0:00:29
548000 -- (-673.490) [-674.062] (-671.765) (-671.670) * (-672.794) [-671.106] (-674.169) (-670.752) -- 0:00:29
548500 -- (-673.975) (-669.776) (-671.572) [-668.231] * (-676.667) (-670.245) (-675.227) [-669.390] -- 0:00:29
549000 -- (-671.034) [-673.413] (-670.438) (-670.945) * (-674.269) (-674.146) [-669.727] (-674.257) -- 0:00:29
549500 -- [-671.844] (-672.715) (-668.930) (-672.280) * (-671.942) (-673.771) (-668.929) [-674.265] -- 0:00:29
550000 -- (-674.984) [-671.800] (-669.753) (-669.675) * (-670.753) (-671.700) [-672.182] (-672.315) -- 0:00:29
Average standard deviation of split frequencies: 0.010273
550500 -- (-668.470) [-669.284] (-671.383) (-670.156) * (-673.771) (-667.979) [-673.691] (-673.954) -- 0:00:29
551000 -- (-670.611) [-670.873] (-671.248) (-672.716) * (-668.822) [-670.532] (-673.894) (-671.787) -- 0:00:29
551500 -- (-668.920) [-672.175] (-672.277) (-676.850) * (-668.174) (-670.343) (-671.110) [-669.605] -- 0:00:29
552000 -- (-671.738) [-670.211] (-671.821) (-673.088) * (-668.229) (-674.580) [-668.394] (-668.661) -- 0:00:29
552500 -- [-673.078] (-670.988) (-671.652) (-674.878) * (-670.962) [-668.764] (-668.705) (-671.664) -- 0:00:29
553000 -- (-674.465) (-672.466) [-668.367] (-674.698) * (-668.811) (-671.641) (-668.844) [-671.668] -- 0:00:29
553500 -- [-671.816] (-667.889) (-673.990) (-674.065) * [-670.233] (-668.587) (-672.111) (-676.693) -- 0:00:29
554000 -- (-671.872) [-669.568] (-670.612) (-673.975) * (-673.767) (-669.920) [-669.088] (-667.728) -- 0:00:28
554500 -- (-672.948) [-669.202] (-669.074) (-673.666) * (-673.648) [-669.642] (-672.176) (-672.280) -- 0:00:28
555000 -- (-669.955) (-671.997) [-667.873] (-670.557) * (-671.590) (-670.291) (-669.850) [-670.871] -- 0:00:28
Average standard deviation of split frequencies: 0.009856
555500 -- [-669.219] (-671.848) (-674.330) (-668.896) * [-670.713] (-673.212) (-673.603) (-668.333) -- 0:00:28
556000 -- (-669.768) [-669.772] (-671.056) (-671.372) * (-672.274) (-675.537) (-672.411) [-669.844] -- 0:00:28
556500 -- (-668.312) (-669.686) [-671.903] (-670.460) * (-672.673) [-674.541] (-673.306) (-672.585) -- 0:00:28
557000 -- [-670.205] (-669.712) (-670.382) (-668.626) * (-671.041) [-671.903] (-671.800) (-674.716) -- 0:00:28
557500 -- (-670.456) (-673.571) (-671.315) [-670.220] * [-671.530] (-672.677) (-674.427) (-672.110) -- 0:00:28
558000 -- (-674.575) (-670.040) [-670.350] (-674.475) * (-670.106) (-671.737) (-671.486) [-668.637] -- 0:00:28
558500 -- [-673.608] (-670.971) (-671.979) (-674.257) * (-672.208) (-672.846) (-676.799) [-669.800] -- 0:00:28
559000 -- (-670.535) (-671.411) (-671.753) [-672.103] * (-671.760) (-670.239) (-673.624) [-670.841] -- 0:00:28
559500 -- (-668.697) [-668.876] (-671.803) (-668.125) * [-671.943] (-679.120) (-669.344) (-669.026) -- 0:00:28
560000 -- (-668.148) (-677.251) [-672.492] (-673.818) * (-671.806) [-672.180] (-669.686) (-672.847) -- 0:00:28
Average standard deviation of split frequencies: 0.008968
560500 -- (-672.065) [-671.835] (-671.323) (-670.052) * (-673.937) (-671.814) [-671.228] (-670.490) -- 0:00:28
561000 -- (-668.756) (-671.485) (-674.173) [-671.666] * (-672.256) (-672.722) (-671.953) [-670.869] -- 0:00:28
561500 -- [-670.719] (-669.908) (-673.617) (-676.279) * (-673.917) [-668.912] (-672.354) (-669.059) -- 0:00:28
562000 -- (-670.512) (-670.110) [-678.495] (-667.924) * (-669.768) (-671.222) (-670.672) [-672.640] -- 0:00:28
562500 -- (-675.092) [-672.266] (-673.562) (-668.268) * (-672.324) [-671.561] (-669.487) (-671.194) -- 0:00:28
563000 -- (-674.174) (-673.640) [-671.857] (-670.277) * (-671.060) (-669.810) [-676.076] (-671.614) -- 0:00:28
563500 -- (-672.537) (-669.459) [-670.333] (-669.118) * (-668.756) [-670.784] (-670.771) (-672.382) -- 0:00:28
564000 -- (-673.113) (-668.391) [-674.049] (-669.748) * (-675.546) (-672.592) [-671.517] (-674.223) -- 0:00:28
564500 -- (-672.917) (-672.707) (-672.695) [-674.451] * (-670.767) [-671.212] (-670.595) (-674.293) -- 0:00:28
565000 -- [-672.406] (-671.341) (-670.789) (-671.693) * (-669.834) (-673.878) [-668.446] (-670.218) -- 0:00:28
Average standard deviation of split frequencies: 0.009273
565500 -- (-668.896) (-672.079) (-670.201) [-671.128] * [-671.517] (-674.238) (-669.539) (-671.287) -- 0:00:28
566000 -- (-673.575) [-674.704] (-670.013) (-670.168) * (-670.770) (-672.143) [-671.691] (-673.612) -- 0:00:28
566500 -- (-670.822) (-674.646) [-670.749] (-669.890) * (-671.225) (-671.519) [-669.037] (-669.548) -- 0:00:28
567000 -- (-668.056) (-672.097) [-671.418] (-672.704) * [-669.658] (-670.684) (-673.183) (-671.576) -- 0:00:28
567500 -- [-668.631] (-671.458) (-671.076) (-671.356) * [-672.533] (-672.085) (-672.533) (-668.141) -- 0:00:28
568000 -- (-671.085) (-670.803) (-669.431) [-671.819] * (-671.030) (-675.384) (-675.387) [-669.937] -- 0:00:28
568500 -- (-671.721) (-670.486) [-672.509] (-670.786) * (-671.810) (-671.935) [-671.971] (-669.811) -- 0:00:28
569000 -- (-674.834) (-670.389) [-667.870] (-670.839) * (-671.847) [-669.825] (-670.936) (-672.723) -- 0:00:28
569500 -- (-672.037) [-671.484] (-668.377) (-671.186) * (-671.785) (-671.668) (-673.131) [-672.938] -- 0:00:27
570000 -- (-673.160) [-671.236] (-671.652) (-672.415) * [-668.810] (-671.837) (-671.439) (-671.978) -- 0:00:27
Average standard deviation of split frequencies: 0.009362
570500 -- (-671.894) (-671.055) (-669.754) [-671.113] * (-670.155) (-671.505) (-669.137) [-670.285] -- 0:00:27
571000 -- (-671.054) (-669.936) (-671.958) [-672.514] * (-670.810) [-673.285] (-669.889) (-672.708) -- 0:00:27
571500 -- [-670.076] (-671.794) (-672.890) (-672.210) * (-672.357) (-669.592) (-676.106) [-672.265] -- 0:00:27
572000 -- (-670.484) (-673.519) (-671.368) [-672.374] * (-668.329) (-673.953) [-674.060] (-673.076) -- 0:00:27
572500 -- (-671.116) (-675.230) [-670.562] (-670.596) * [-668.440] (-671.972) (-671.563) (-672.483) -- 0:00:27
573000 -- (-671.343) (-672.035) [-672.327] (-670.168) * (-673.710) [-672.431] (-673.375) (-671.511) -- 0:00:27
573500 -- (-670.918) (-668.532) [-672.368] (-668.935) * [-672.555] (-671.129) (-676.202) (-669.583) -- 0:00:27
574000 -- (-674.292) [-671.125] (-671.116) (-672.385) * (-672.034) (-675.368) [-675.122] (-671.866) -- 0:00:27
574500 -- (-670.192) (-671.742) [-671.687] (-671.648) * [-670.636] (-672.214) (-675.545) (-670.639) -- 0:00:27
575000 -- (-671.193) (-670.690) (-670.926) [-669.401] * (-671.726) [-670.742] (-671.554) (-671.567) -- 0:00:27
Average standard deviation of split frequencies: 0.010332
575500 -- (-672.278) (-671.050) (-670.172) [-668.632] * (-669.704) (-671.471) [-671.341] (-671.389) -- 0:00:27
576000 -- (-672.682) (-669.633) [-668.888] (-670.816) * (-675.123) [-672.956] (-671.549) (-669.999) -- 0:00:27
576500 -- (-671.535) (-670.441) (-676.514) [-671.658] * (-674.096) [-672.535] (-670.762) (-672.506) -- 0:00:27
577000 -- (-672.313) (-672.822) [-670.967] (-669.929) * [-672.452] (-673.976) (-671.873) (-673.086) -- 0:00:27
577500 -- (-671.143) (-673.272) [-666.355] (-673.905) * (-671.195) [-671.554] (-671.466) (-670.792) -- 0:00:27
578000 -- (-671.638) [-672.248] (-670.360) (-670.747) * [-670.307] (-671.335) (-671.088) (-669.613) -- 0:00:27
578500 -- (-670.495) (-670.264) (-672.935) [-670.769] * (-672.167) [-669.823] (-670.565) (-672.209) -- 0:00:27
579000 -- (-670.715) (-674.202) [-670.977] (-673.272) * (-675.002) [-670.503] (-669.677) (-672.762) -- 0:00:27
579500 -- (-670.589) (-670.641) (-669.155) [-668.307] * (-675.097) (-669.854) [-672.306] (-674.736) -- 0:00:27
580000 -- (-670.127) (-674.769) (-670.438) [-675.430] * [-673.739] (-674.400) (-672.242) (-671.342) -- 0:00:27
Average standard deviation of split frequencies: 0.009894
580500 -- (-672.063) [-670.569] (-679.712) (-673.416) * (-670.826) (-673.328) [-669.172] (-672.711) -- 0:00:27
581000 -- (-669.655) (-668.945) (-672.349) [-670.729] * (-671.433) (-670.977) [-668.110] (-669.393) -- 0:00:27
581500 -- [-669.125] (-668.797) (-675.307) (-672.445) * (-671.404) [-670.872] (-672.798) (-669.716) -- 0:00:27
582000 -- (-670.965) [-671.430] (-670.414) (-676.491) * (-670.627) (-670.755) [-670.090] (-669.669) -- 0:00:27
582500 -- (-669.394) (-672.622) (-671.254) [-673.569] * (-672.704) (-671.009) [-669.094] (-673.455) -- 0:00:27
583000 -- (-668.048) [-672.471] (-672.186) (-673.705) * (-671.502) [-668.350] (-670.820) (-674.236) -- 0:00:27
583500 -- (-670.270) [-671.816] (-672.735) (-670.582) * (-672.098) [-672.277] (-669.266) (-675.463) -- 0:00:27
584000 -- (-670.204) (-670.023) (-674.428) [-671.584] * (-671.798) (-668.240) (-670.187) [-670.290] -- 0:00:27
584500 -- (-668.643) [-672.735] (-668.886) (-671.272) * (-673.164) (-671.196) [-670.998] (-672.820) -- 0:00:27
585000 -- (-671.586) [-672.943] (-669.457) (-670.669) * (-674.837) [-668.935] (-671.153) (-671.209) -- 0:00:26
Average standard deviation of split frequencies: 0.009603
585500 -- (-671.292) [-670.738] (-671.067) (-667.873) * (-671.412) (-673.114) [-670.597] (-669.378) -- 0:00:26
586000 -- (-675.793) [-673.894] (-670.471) (-672.001) * [-677.394] (-671.866) (-673.489) (-670.480) -- 0:00:26
586500 -- (-675.043) [-672.389] (-668.261) (-670.367) * (-673.538) (-669.841) [-669.986] (-670.004) -- 0:00:26
587000 -- [-670.416] (-673.720) (-670.992) (-668.646) * [-671.178] (-674.041) (-668.840) (-671.173) -- 0:00:26
587500 -- (-670.583) (-674.240) (-671.582) [-667.410] * (-672.569) (-670.315) (-670.684) [-670.479] -- 0:00:26
588000 -- (-673.967) [-671.595] (-670.248) (-676.924) * (-671.058) (-667.838) [-669.767] (-668.745) -- 0:00:26
588500 -- (-670.501) [-671.330] (-672.084) (-671.262) * (-669.762) [-670.271] (-670.005) (-670.197) -- 0:00:26
589000 -- [-671.501] (-672.334) (-671.284) (-669.229) * [-670.202] (-671.068) (-670.068) (-667.702) -- 0:00:26
589500 -- [-669.779] (-672.261) (-669.045) (-670.450) * (-675.511) (-668.202) [-668.986] (-669.660) -- 0:00:26
590000 -- (-670.546) (-672.503) (-668.727) [-668.656] * (-672.901) (-668.941) (-670.529) [-672.017] -- 0:00:26
Average standard deviation of split frequencies: 0.008194
590500 -- (-670.773) [-671.885] (-671.997) (-669.498) * (-672.840) [-671.764] (-670.033) (-672.526) -- 0:00:26
591000 -- (-669.967) (-676.220) [-670.602] (-667.131) * (-669.370) (-672.708) [-667.547] (-673.479) -- 0:00:26
591500 -- (-671.227) (-668.579) (-672.138) [-670.160] * (-670.800) (-669.017) (-670.691) [-670.953] -- 0:00:26
592000 -- (-670.967) (-672.342) (-671.308) [-670.135] * (-670.993) [-669.014] (-670.802) (-670.544) -- 0:00:26
592500 -- (-670.833) (-671.154) [-670.997] (-677.689) * (-668.707) [-671.786] (-671.898) (-672.038) -- 0:00:26
593000 -- [-669.607] (-669.736) (-671.201) (-669.566) * (-671.960) (-674.520) (-671.023) [-672.581] -- 0:00:26
593500 -- [-670.649] (-671.433) (-673.656) (-668.814) * (-669.676) [-675.681] (-672.769) (-671.975) -- 0:00:26
594000 -- (-670.551) (-671.288) (-672.724) [-667.160] * (-671.696) (-670.779) [-671.220] (-672.962) -- 0:00:26
594500 -- (-670.103) (-675.822) (-671.487) [-667.389] * (-672.634) [-671.787] (-671.461) (-670.410) -- 0:00:26
595000 -- [-670.671] (-669.765) (-672.876) (-676.986) * (-669.644) [-671.495] (-671.916) (-669.774) -- 0:00:26
Average standard deviation of split frequencies: 0.008173
595500 -- (-674.540) (-669.211) [-669.300] (-672.356) * (-670.199) (-669.736) (-675.291) [-669.603] -- 0:00:26
596000 -- (-672.612) (-672.408) (-670.108) [-669.861] * (-669.167) (-671.532) (-675.144) [-672.652] -- 0:00:26
596500 -- (-672.340) (-668.708) [-669.905] (-671.400) * (-670.992) (-673.091) [-668.740] (-671.406) -- 0:00:26
597000 -- (-671.993) [-668.580] (-672.070) (-672.207) * (-672.620) (-673.464) (-668.495) [-670.766] -- 0:00:26
597500 -- (-672.141) [-670.817] (-671.713) (-669.354) * (-668.475) (-668.791) [-671.273] (-673.368) -- 0:00:26
598000 -- (-674.180) (-671.361) (-671.055) [-668.968] * (-670.761) (-669.207) (-676.962) [-670.513] -- 0:00:26
598500 -- (-670.455) (-673.181) (-670.362) [-669.079] * [-668.692] (-668.716) (-671.004) (-672.647) -- 0:00:26
599000 -- (-671.427) (-673.161) (-671.888) [-669.467] * (-673.865) (-669.738) (-669.461) [-669.526] -- 0:00:26
599500 -- (-668.638) (-671.756) (-670.788) [-671.844] * (-670.333) (-671.958) (-672.811) [-668.999] -- 0:00:26
600000 -- (-674.321) [-670.250] (-669.411) (-671.841) * [-667.667] (-670.374) (-671.238) (-671.420) -- 0:00:25
Average standard deviation of split frequencies: 0.008535
600500 -- (-674.550) (-669.316) (-670.567) [-672.312] * (-669.782) (-669.288) [-668.080] (-675.033) -- 0:00:25
601000 -- (-670.736) (-669.558) (-670.308) [-670.550] * [-671.224] (-671.951) (-668.670) (-672.488) -- 0:00:25
601500 -- (-671.293) [-668.575] (-671.651) (-668.944) * (-673.491) (-670.152) (-668.374) [-673.587] -- 0:00:25
602000 -- (-671.340) [-672.087] (-670.337) (-674.636) * (-668.187) [-669.284] (-671.935) (-674.274) -- 0:00:25
602500 -- [-670.774] (-675.205) (-671.063) (-671.012) * (-671.874) (-669.200) (-671.246) [-670.159] -- 0:00:25
603000 -- (-672.256) (-675.946) (-669.764) [-669.608] * [-670.526] (-669.145) (-672.012) (-673.810) -- 0:00:25
603500 -- (-672.386) (-672.101) (-670.826) [-668.517] * (-667.642) (-669.335) (-671.487) [-673.011] -- 0:00:25
604000 -- (-673.429) (-670.545) [-672.698] (-667.951) * [-668.978] (-670.712) (-670.775) (-669.809) -- 0:00:25
604500 -- (-671.759) (-669.282) [-669.315] (-669.158) * [-669.401] (-669.778) (-670.194) (-671.397) -- 0:00:25
605000 -- (-669.369) (-671.280) [-668.508] (-669.860) * (-671.649) [-670.918] (-670.737) (-670.961) -- 0:00:25
Average standard deviation of split frequencies: 0.008654
605500 -- (-669.942) [-670.340] (-669.510) (-667.998) * (-673.708) (-669.019) [-675.537] (-670.995) -- 0:00:25
606000 -- [-670.832] (-671.913) (-671.352) (-669.085) * (-671.339) [-668.320] (-670.273) (-667.586) -- 0:00:25
606500 -- [-671.963] (-671.948) (-669.302) (-672.922) * [-668.267] (-671.210) (-669.323) (-669.156) -- 0:00:25
607000 -- (-669.710) (-673.558) [-670.552] (-672.176) * (-669.525) (-670.470) (-670.515) [-668.411] -- 0:00:25
607500 -- [-671.091] (-670.736) (-670.437) (-671.564) * [-669.946] (-666.690) (-670.457) (-671.371) -- 0:00:25
608000 -- [-672.234] (-672.334) (-670.193) (-677.544) * (-670.141) (-673.783) (-671.925) [-674.068] -- 0:00:25
608500 -- (-674.558) [-668.362] (-670.701) (-672.062) * (-670.029) (-670.169) [-668.752] (-672.633) -- 0:00:25
609000 -- (-673.141) (-670.685) [-674.227] (-675.225) * (-671.524) [-670.015] (-671.471) (-672.647) -- 0:00:25
609500 -- [-673.390] (-672.336) (-670.633) (-668.112) * (-672.192) (-670.871) (-668.944) [-673.326] -- 0:00:25
610000 -- (-670.277) (-674.319) (-672.806) [-673.603] * [-672.505] (-671.943) (-667.595) (-668.291) -- 0:00:25
Average standard deviation of split frequencies: 0.008009
610500 -- [-670.102] (-670.356) (-671.177) (-669.141) * (-672.438) (-669.406) [-669.518] (-670.531) -- 0:00:25
611000 -- [-671.193] (-673.158) (-670.737) (-670.240) * (-673.681) (-669.630) [-667.954] (-670.366) -- 0:00:25
611500 -- (-670.138) [-668.301] (-671.230) (-671.963) * (-674.187) (-676.019) (-671.242) [-670.479] -- 0:00:25
612000 -- [-672.069] (-672.641) (-669.497) (-672.741) * (-668.941) [-669.054] (-668.134) (-669.682) -- 0:00:25
612500 -- (-671.958) (-670.236) (-668.391) [-669.910] * (-669.292) (-668.081) (-669.994) [-668.793] -- 0:00:25
613000 -- (-671.145) (-670.845) (-668.446) [-671.322] * [-670.924] (-669.664) (-674.679) (-673.950) -- 0:00:25
613500 -- [-671.653] (-676.203) (-673.706) (-670.708) * (-670.832) (-672.688) [-668.933] (-668.978) -- 0:00:25
614000 -- (-671.467) (-677.287) [-672.204] (-669.522) * (-669.981) (-672.047) (-667.875) [-669.105] -- 0:00:25
614500 -- [-671.000] (-675.164) (-668.842) (-667.417) * [-672.091] (-669.137) (-668.280) (-669.902) -- 0:00:25
615000 -- (-673.309) (-675.133) (-667.803) [-672.492] * (-672.142) (-672.806) (-670.386) [-670.229] -- 0:00:25
Average standard deviation of split frequencies: 0.008083
615500 -- (-669.927) (-671.451) [-668.015] (-673.550) * [-669.643] (-667.494) (-670.857) (-671.721) -- 0:00:24
616000 -- (-673.635) [-675.103] (-667.443) (-671.102) * [-668.991] (-669.180) (-672.155) (-670.380) -- 0:00:24
616500 -- (-668.279) (-671.522) (-669.072) [-671.849] * (-673.372) (-672.059) [-668.118] (-667.350) -- 0:00:24
617000 -- (-669.509) [-674.923] (-669.148) (-671.120) * [-669.989] (-673.539) (-671.462) (-669.391) -- 0:00:24
617500 -- (-672.508) [-675.200] (-668.845) (-669.124) * (-668.326) (-669.079) (-668.946) [-668.722] -- 0:00:24
618000 -- (-670.576) (-669.791) [-667.575] (-673.041) * [-669.832] (-670.330) (-671.253) (-669.117) -- 0:00:24
618500 -- (-671.975) (-673.352) [-671.329] (-672.590) * (-674.652) (-675.424) [-671.487] (-669.150) -- 0:00:24
619000 -- (-669.256) (-669.313) (-670.577) [-670.614] * [-672.202] (-671.325) (-671.858) (-674.491) -- 0:00:24
619500 -- (-673.597) (-670.665) (-671.581) [-671.967] * [-668.999] (-677.461) (-670.659) (-670.983) -- 0:00:24
620000 -- (-671.309) (-671.079) (-671.192) [-671.725] * [-672.388] (-669.068) (-672.700) (-668.442) -- 0:00:24
Average standard deviation of split frequencies: 0.006937
620500 -- (-670.154) [-669.321] (-669.221) (-676.754) * [-672.961] (-669.801) (-670.699) (-669.530) -- 0:00:24
621000 -- (-669.693) (-668.938) (-672.730) [-670.637] * [-671.169] (-667.924) (-670.757) (-670.627) -- 0:00:24
621500 -- (-670.338) (-671.142) (-669.960) [-670.145] * (-674.960) [-669.924] (-668.056) (-675.678) -- 0:00:24
622000 -- (-671.462) (-671.585) (-672.276) [-668.730] * [-670.960] (-670.327) (-669.198) (-671.718) -- 0:00:24
622500 -- (-668.973) (-670.563) (-670.541) [-671.856] * (-671.581) (-672.792) (-671.941) [-670.594] -- 0:00:24
623000 -- (-667.653) (-669.360) (-673.927) [-673.161] * (-675.725) [-672.196] (-670.405) (-671.632) -- 0:00:24
623500 -- (-672.071) (-671.010) (-668.871) [-668.503] * (-672.108) (-670.927) [-670.909] (-669.032) -- 0:00:24
624000 -- (-671.821) [-672.943] (-670.025) (-669.976) * (-669.922) (-671.043) (-673.893) [-672.071] -- 0:00:24
624500 -- (-671.567) (-669.845) (-675.436) [-668.924] * (-673.178) (-668.111) (-672.622) [-667.432] -- 0:00:24
625000 -- [-670.230] (-670.582) (-670.720) (-668.200) * (-672.456) (-671.716) [-669.795] (-668.521) -- 0:00:24
Average standard deviation of split frequencies: 0.006878
625500 -- [-671.400] (-671.615) (-672.905) (-670.716) * (-669.870) (-670.459) [-670.134] (-673.300) -- 0:00:24
626000 -- (-675.837) [-670.406] (-672.335) (-672.272) * (-672.642) (-671.224) (-669.029) [-669.831] -- 0:00:24
626500 -- [-676.643] (-673.535) (-670.312) (-673.387) * (-671.557) (-672.404) (-671.882) [-671.242] -- 0:00:24
627000 -- (-676.034) (-671.725) (-671.236) [-672.435] * [-671.379] (-672.181) (-670.695) (-672.568) -- 0:00:24
627500 -- (-673.469) [-670.494] (-669.974) (-672.619) * (-670.202) [-673.381] (-681.054) (-671.306) -- 0:00:24
628000 -- (-671.611) (-669.576) (-670.132) [-670.398] * (-670.197) (-673.606) [-673.882] (-671.264) -- 0:00:24
628500 -- (-672.717) (-669.089) (-670.661) [-669.667] * (-669.240) (-670.705) (-669.467) [-670.998] -- 0:00:24
629000 -- [-670.888] (-671.721) (-668.219) (-672.427) * [-671.830] (-671.301) (-673.350) (-671.277) -- 0:00:24
629500 -- [-672.289] (-669.512) (-668.998) (-672.442) * (-671.753) (-670.899) (-670.148) [-673.347] -- 0:00:24
630000 -- (-672.124) (-674.305) [-673.240] (-670.950) * (-670.806) (-671.692) (-671.710) [-671.693] -- 0:00:24
Average standard deviation of split frequencies: 0.007288
630500 -- (-673.512) [-670.441] (-672.687) (-674.676) * (-668.971) (-672.688) [-669.927] (-671.102) -- 0:00:24
631000 -- (-671.396) [-670.601] (-673.260) (-671.542) * (-670.872) [-676.682] (-671.202) (-670.896) -- 0:00:23
631500 -- (-668.738) [-670.216] (-671.058) (-672.201) * (-671.580) (-675.068) (-674.250) [-672.106] -- 0:00:23
632000 -- (-672.389) [-667.931] (-678.498) (-672.399) * (-670.726) (-670.776) (-673.862) [-669.568] -- 0:00:23
632500 -- (-672.784) [-670.619] (-671.171) (-672.760) * [-670.278] (-672.094) (-672.460) (-669.674) -- 0:00:23
633000 -- (-672.706) (-670.960) (-670.840) [-670.346] * (-668.638) (-672.557) (-670.186) [-669.055] -- 0:00:23
633500 -- (-671.862) (-667.169) (-670.579) [-670.217] * [-668.373] (-674.634) (-672.367) (-669.513) -- 0:00:23
634000 -- (-670.101) [-669.756] (-670.581) (-672.370) * (-668.943) (-673.867) (-670.856) [-672.115] -- 0:00:23
634500 -- [-668.091] (-669.836) (-671.548) (-673.262) * (-670.714) [-672.429] (-670.686) (-674.691) -- 0:00:23
635000 -- (-673.357) (-671.870) [-672.521] (-679.864) * (-675.573) [-672.643] (-670.480) (-672.644) -- 0:00:23
Average standard deviation of split frequencies: 0.007458
635500 -- [-669.519] (-671.860) (-670.391) (-679.308) * (-674.710) (-672.000) [-669.624] (-671.626) -- 0:00:23
636000 -- (-670.833) (-668.035) [-672.586] (-672.331) * (-669.684) [-669.517] (-670.934) (-671.384) -- 0:00:23
636500 -- (-671.760) (-672.730) [-668.915] (-676.462) * (-676.077) (-673.499) (-669.293) [-672.504] -- 0:00:23
637000 -- (-670.292) (-669.430) (-671.046) [-673.031] * (-673.367) (-675.545) (-670.782) [-671.103] -- 0:00:23
637500 -- (-671.406) [-668.855] (-670.100) (-671.234) * (-672.888) (-673.432) [-672.009] (-671.186) -- 0:00:23
638000 -- [-669.665] (-668.623) (-673.625) (-672.275) * (-672.751) (-672.628) (-675.408) [-672.723] -- 0:00:23
638500 -- (-669.163) [-670.421] (-669.108) (-676.247) * [-672.055] (-671.567) (-672.819) (-672.679) -- 0:00:23
639000 -- (-671.725) (-670.529) [-671.532] (-672.845) * (-669.386) (-671.877) [-668.668] (-670.167) -- 0:00:23
639500 -- (-669.228) (-671.063) [-669.696] (-672.282) * (-670.583) (-672.233) (-670.072) [-671.305] -- 0:00:23
640000 -- [-670.912] (-670.893) (-669.917) (-673.266) * (-671.661) (-670.617) (-675.981) [-672.106] -- 0:00:23
Average standard deviation of split frequencies: 0.007082
640500 -- [-670.108] (-672.769) (-671.448) (-669.983) * [-670.424] (-670.931) (-668.462) (-673.570) -- 0:00:23
641000 -- (-672.656) (-676.160) [-670.640] (-672.109) * (-675.171) (-671.931) [-672.190] (-672.323) -- 0:00:23
641500 -- (-668.831) (-671.125) [-671.237] (-675.891) * [-670.394] (-673.902) (-668.310) (-670.947) -- 0:00:23
642000 -- (-671.114) [-671.398] (-669.711) (-671.265) * [-669.883] (-677.490) (-667.952) (-670.509) -- 0:00:23
642500 -- (-672.070) (-672.328) (-674.450) [-673.408] * [-668.540] (-670.770) (-669.687) (-671.912) -- 0:00:23
643000 -- (-671.933) (-672.430) [-671.251] (-671.011) * [-671.942] (-670.169) (-670.158) (-671.967) -- 0:00:23
643500 -- (-670.480) [-672.175] (-670.919) (-668.668) * [-673.032] (-668.626) (-671.569) (-671.527) -- 0:00:23
644000 -- (-670.746) [-670.269] (-669.484) (-670.790) * (-670.116) [-670.159] (-671.342) (-671.813) -- 0:00:23
644500 -- (-670.886) [-669.887] (-669.872) (-668.657) * (-669.130) (-673.190) (-667.966) [-671.556] -- 0:00:23
645000 -- [-670.054] (-670.948) (-669.676) (-671.402) * [-669.598] (-674.180) (-668.463) (-668.149) -- 0:00:23
Average standard deviation of split frequencies: 0.007024
645500 -- (-673.698) (-671.890) [-671.650] (-675.307) * (-668.347) (-669.207) [-670.061] (-671.385) -- 0:00:23
646000 -- (-669.399) (-670.310) (-672.654) [-671.901] * (-668.787) (-673.488) [-671.851] (-671.975) -- 0:00:23
646500 -- (-668.423) (-671.035) [-668.556] (-670.423) * (-669.477) [-672.446] (-671.431) (-668.764) -- 0:00:22
647000 -- (-669.310) (-670.781) [-670.988] (-669.524) * [-672.896] (-673.131) (-668.869) (-672.191) -- 0:00:22
647500 -- (-670.440) [-671.043] (-674.724) (-672.319) * [-668.499] (-671.814) (-673.010) (-668.675) -- 0:00:22
648000 -- (-670.386) (-676.579) (-670.708) [-668.881] * (-670.448) (-668.207) (-673.777) [-669.367] -- 0:00:22
648500 -- (-673.101) [-672.170] (-670.479) (-670.434) * (-671.757) (-672.300) (-670.851) [-667.715] -- 0:00:22
649000 -- (-675.045) [-672.038] (-670.917) (-669.703) * (-671.304) [-672.177] (-672.017) (-668.519) -- 0:00:22
649500 -- (-673.096) (-669.172) [-670.315] (-668.377) * (-669.794) (-668.532) (-672.434) [-673.580] -- 0:00:22
650000 -- (-671.408) (-674.010) [-670.652] (-672.834) * [-669.936] (-672.327) (-669.181) (-673.297) -- 0:00:22
Average standard deviation of split frequencies: 0.006762
650500 -- (-670.635) [-670.540] (-670.163) (-668.198) * (-670.259) (-667.980) [-670.579] (-672.550) -- 0:00:22
651000 -- [-670.689] (-672.578) (-669.745) (-676.632) * [-669.398] (-671.065) (-673.579) (-670.735) -- 0:00:22
651500 -- (-673.695) [-669.103] (-669.376) (-674.455) * [-672.420] (-669.878) (-676.025) (-672.158) -- 0:00:22
652000 -- (-673.099) (-671.499) (-670.178) [-670.204] * (-669.696) (-672.870) (-672.808) [-670.508] -- 0:00:22
652500 -- (-670.429) (-670.825) [-671.049] (-668.442) * (-669.815) (-669.106) [-673.010] (-671.598) -- 0:00:22
653000 -- (-674.414) (-671.505) [-670.760] (-669.913) * (-675.640) [-672.960] (-669.765) (-671.536) -- 0:00:22
653500 -- (-673.351) [-673.357] (-672.219) (-670.556) * (-673.251) [-669.406] (-675.133) (-670.984) -- 0:00:22
654000 -- (-673.776) (-671.113) [-672.613] (-669.745) * (-667.215) (-666.955) (-671.032) [-673.768] -- 0:00:22
654500 -- (-674.710) (-672.383) [-670.952] (-669.480) * (-669.050) [-669.404] (-672.014) (-673.221) -- 0:00:22
655000 -- (-677.210) (-670.706) (-672.867) [-673.641] * (-669.462) (-669.580) (-671.169) [-669.438] -- 0:00:22
Average standard deviation of split frequencies: 0.006036
655500 -- (-669.725) (-672.051) [-672.085] (-670.968) * (-671.420) (-669.847) (-672.691) [-670.050] -- 0:00:22
656000 -- (-671.942) (-670.712) (-673.207) [-670.069] * (-672.959) (-668.438) (-669.303) [-668.163] -- 0:00:22
656500 -- (-674.199) [-671.504] (-671.582) (-672.282) * (-669.742) (-669.708) (-671.776) [-673.661] -- 0:00:22
657000 -- (-671.136) (-671.018) (-669.657) [-671.780] * [-669.211] (-671.135) (-675.872) (-668.266) -- 0:00:22
657500 -- (-674.010) (-670.163) [-669.869] (-672.626) * (-671.662) [-669.852] (-670.436) (-669.981) -- 0:00:22
658000 -- [-672.456] (-669.854) (-671.858) (-671.125) * (-672.271) (-668.161) (-686.977) [-671.200] -- 0:00:22
658500 -- [-669.288] (-670.438) (-675.726) (-669.411) * (-671.293) (-670.371) (-672.041) [-672.816] -- 0:00:22
659000 -- (-670.919) [-668.618] (-669.723) (-673.103) * (-668.710) (-669.786) (-672.029) [-671.321] -- 0:00:22
659500 -- (-670.383) [-673.869] (-669.325) (-668.783) * (-673.728) (-673.920) (-669.335) [-668.568] -- 0:00:22
660000 -- (-670.005) (-673.521) [-667.835] (-673.068) * (-668.576) (-672.145) (-671.654) [-672.222] -- 0:00:22
Average standard deviation of split frequencies: 0.006136
660500 -- (-669.661) (-673.908) (-671.851) [-671.152] * (-671.872) [-673.012] (-671.230) (-672.964) -- 0:00:22
661000 -- (-671.471) (-669.254) (-673.658) [-669.444] * (-670.667) (-671.950) [-668.969] (-673.115) -- 0:00:22
661500 -- (-670.017) (-671.028) [-671.253] (-671.724) * (-671.169) [-672.902] (-671.054) (-671.488) -- 0:00:22
662000 -- (-672.043) (-669.826) [-671.603] (-670.241) * (-668.917) (-672.850) (-673.599) [-671.705] -- 0:00:21
662500 -- (-671.362) (-675.116) [-670.196] (-672.425) * (-671.936) (-673.582) (-671.271) [-668.811] -- 0:00:21
663000 -- [-669.456] (-677.586) (-668.406) (-671.066) * (-673.445) (-668.066) [-671.062] (-671.724) -- 0:00:21
663500 -- [-668.818] (-668.118) (-668.455) (-670.334) * [-673.169] (-669.849) (-672.373) (-671.796) -- 0:00:21
664000 -- [-671.470] (-669.794) (-672.954) (-670.317) * (-668.391) (-671.391) [-669.098] (-668.286) -- 0:00:21
664500 -- (-670.840) (-672.319) (-675.529) [-668.263] * (-671.687) (-670.616) (-671.156) [-668.811] -- 0:00:21
665000 -- (-674.040) (-671.976) [-669.724] (-676.598) * (-671.141) [-670.996] (-671.438) (-671.978) -- 0:00:21
Average standard deviation of split frequencies: 0.006857
665500 -- (-672.633) [-670.576] (-674.589) (-671.859) * (-671.003) (-671.780) [-670.119] (-669.106) -- 0:00:21
666000 -- (-671.768) (-673.412) [-670.843] (-668.605) * [-670.194] (-670.069) (-673.314) (-667.876) -- 0:00:21
666500 -- [-667.936] (-671.341) (-673.191) (-667.791) * (-667.624) [-674.799] (-673.490) (-670.991) -- 0:00:21
667000 -- (-668.348) [-670.722] (-670.559) (-671.742) * [-675.118] (-677.099) (-669.048) (-670.785) -- 0:00:21
667500 -- (-671.693) (-671.312) (-673.169) [-668.904] * [-670.080] (-671.551) (-671.203) (-670.569) -- 0:00:21
668000 -- [-669.534] (-674.485) (-669.545) (-672.862) * (-671.299) (-674.011) (-669.679) [-669.712] -- 0:00:21
668500 -- (-670.126) [-669.363] (-670.580) (-670.452) * [-671.641] (-675.334) (-669.742) (-669.878) -- 0:00:21
669000 -- (-672.212) (-672.108) [-671.705] (-671.546) * [-670.161] (-672.687) (-669.286) (-672.141) -- 0:00:21
669500 -- [-671.758] (-668.589) (-672.409) (-669.692) * [-668.753] (-675.240) (-671.309) (-669.499) -- 0:00:21
670000 -- (-669.470) (-669.091) [-671.974] (-669.726) * (-669.237) (-675.615) [-671.504] (-669.516) -- 0:00:21
Average standard deviation of split frequencies: 0.007380
670500 -- (-667.816) [-669.474] (-673.749) (-670.791) * [-670.155] (-674.212) (-673.409) (-668.889) -- 0:00:21
671000 -- (-671.411) (-672.796) (-671.345) [-668.928] * (-671.512) (-672.612) [-668.253] (-670.416) -- 0:00:21
671500 -- (-669.799) [-669.056] (-668.971) (-675.892) * (-670.895) (-674.579) [-674.792] (-669.663) -- 0:00:21
672000 -- (-668.594) (-670.010) [-668.365] (-673.808) * [-672.744] (-670.264) (-668.723) (-672.683) -- 0:00:21
672500 -- (-674.026) (-669.807) [-671.087] (-668.394) * [-670.812] (-668.902) (-667.354) (-670.357) -- 0:00:21
673000 -- (-669.862) [-671.089] (-669.523) (-671.446) * (-672.416) (-668.902) [-670.187] (-672.230) -- 0:00:21
673500 -- (-669.290) [-670.699] (-672.261) (-670.577) * [-669.010] (-672.856) (-672.043) (-671.564) -- 0:00:21
674000 -- (-675.859) (-671.887) (-673.042) [-672.013] * (-671.044) [-673.298] (-670.109) (-673.223) -- 0:00:21
674500 -- [-671.105] (-673.411) (-672.654) (-671.555) * (-678.136) (-678.861) [-669.509] (-672.475) -- 0:00:21
675000 -- (-672.034) (-670.837) (-671.209) [-667.939] * (-671.729) [-671.848] (-669.378) (-673.563) -- 0:00:21
Average standard deviation of split frequencies: 0.006834
675500 -- (-669.662) (-669.901) [-671.323] (-668.084) * [-671.300] (-674.029) (-670.321) (-675.401) -- 0:00:21
676000 -- (-670.017) [-670.824] (-669.870) (-667.471) * (-670.761) (-671.258) (-668.961) [-672.659] -- 0:00:21
676500 -- (-669.591) [-675.049] (-670.699) (-668.273) * (-673.386) (-673.543) [-670.599] (-672.763) -- 0:00:21
677000 -- (-673.773) (-671.946) [-669.962] (-671.145) * (-669.981) [-671.211] (-672.781) (-674.343) -- 0:00:20
677500 -- (-673.681) [-669.649] (-672.401) (-671.739) * (-671.998) (-673.242) (-670.146) [-672.248] -- 0:00:20
678000 -- (-674.627) (-669.289) (-669.804) [-672.705] * (-672.610) [-670.506] (-671.735) (-668.620) -- 0:00:20
678500 -- [-670.325] (-673.485) (-669.894) (-671.396) * [-671.687] (-668.936) (-668.931) (-673.342) -- 0:00:20
679000 -- [-673.084] (-670.092) (-670.177) (-670.956) * (-672.628) [-670.065] (-669.620) (-679.718) -- 0:00:20
679500 -- (-671.491) (-670.945) (-669.057) [-669.580] * (-670.725) (-675.244) (-671.147) [-676.676] -- 0:00:20
680000 -- (-672.168) (-670.982) [-669.073] (-668.823) * (-671.886) (-675.864) (-670.604) [-671.478] -- 0:00:20
Average standard deviation of split frequencies: 0.006787
680500 -- (-670.503) (-671.963) (-669.760) [-669.748] * (-669.935) (-669.520) [-674.093] (-673.152) -- 0:00:20
681000 -- (-672.099) (-670.609) (-669.417) [-671.346] * (-669.633) (-670.358) (-669.735) [-668.923] -- 0:00:20
681500 -- [-669.864] (-674.538) (-670.121) (-672.305) * [-669.398] (-673.331) (-671.211) (-669.052) -- 0:00:20
682000 -- (-668.650) (-671.292) [-667.549] (-671.245) * [-671.692] (-673.065) (-669.976) (-670.000) -- 0:00:20
682500 -- (-669.850) (-671.008) [-668.102] (-670.020) * (-672.284) (-671.750) [-671.213] (-673.898) -- 0:00:20
683000 -- (-679.377) [-671.284] (-671.839) (-670.507) * (-672.845) (-672.636) (-672.413) [-674.200] -- 0:00:20
683500 -- (-674.685) (-671.332) (-671.074) [-669.754] * (-676.793) (-670.324) (-670.997) [-674.422] -- 0:00:20
684000 -- (-672.122) [-671.959] (-670.500) (-669.939) * (-672.312) [-668.981] (-671.600) (-673.906) -- 0:00:20
684500 -- (-672.841) (-671.521) [-670.983] (-670.720) * [-671.378] (-668.358) (-670.432) (-675.133) -- 0:00:20
685000 -- [-670.728] (-676.411) (-669.981) (-668.667) * (-672.389) (-671.802) (-673.027) [-668.614] -- 0:00:20
Average standard deviation of split frequencies: 0.007645
685500 -- [-671.449] (-672.773) (-670.296) (-670.770) * (-670.432) (-670.909) [-671.444] (-670.986) -- 0:00:20
686000 -- (-669.976) [-671.040] (-669.376) (-669.707) * (-669.469) [-668.602] (-670.867) (-671.620) -- 0:00:20
686500 -- (-666.611) [-668.560] (-669.765) (-675.354) * [-677.431] (-669.492) (-671.955) (-671.364) -- 0:00:20
687000 -- (-670.976) (-669.535) [-672.559] (-672.340) * (-670.809) (-672.196) (-669.489) [-668.230] -- 0:00:20
687500 -- (-672.664) (-671.347) (-667.289) [-670.970] * (-670.329) (-670.730) (-672.480) [-670.808] -- 0:00:20
688000 -- (-669.497) (-671.314) (-672.594) [-671.056] * (-670.426) (-670.811) (-674.011) [-668.753] -- 0:00:20
688500 -- (-668.022) (-669.976) [-669.821] (-668.692) * (-670.655) [-672.720] (-669.785) (-669.169) -- 0:00:20
689000 -- (-669.083) [-670.487] (-671.137) (-668.750) * (-668.143) (-675.711) (-671.562) [-674.057] -- 0:00:20
689500 -- [-669.276] (-670.131) (-668.273) (-675.729) * [-669.010] (-669.460) (-674.022) (-671.829) -- 0:00:20
690000 -- (-670.655) (-672.444) [-670.114] (-674.478) * (-674.947) (-669.682) [-670.926] (-672.263) -- 0:00:20
Average standard deviation of split frequencies: 0.007423
690500 -- (-669.569) (-670.207) [-671.654] (-671.423) * (-670.255) [-671.849] (-673.128) (-670.774) -- 0:00:20
691000 -- (-668.027) (-668.953) (-667.501) [-671.224] * (-670.517) (-669.760) [-671.657] (-668.808) -- 0:00:20
691500 -- [-668.767] (-670.800) (-668.575) (-673.430) * (-670.565) (-668.448) [-674.411] (-669.616) -- 0:00:20
692000 -- (-671.540) [-673.032] (-672.361) (-673.189) * (-671.626) [-671.634] (-671.803) (-671.594) -- 0:00:20
692500 -- (-671.097) (-674.943) [-672.288] (-669.017) * (-670.041) (-669.738) [-671.579] (-673.163) -- 0:00:19
693000 -- (-669.320) [-669.890] (-668.886) (-669.800) * (-672.586) (-674.659) [-670.094] (-668.347) -- 0:00:19
693500 -- (-669.160) (-669.441) (-672.869) [-667.464] * (-671.046) (-671.750) [-669.113] (-668.069) -- 0:00:19
694000 -- [-670.709] (-669.956) (-670.825) (-669.520) * (-672.793) [-675.256] (-670.228) (-668.985) -- 0:00:19
694500 -- (-670.610) (-671.892) (-670.046) [-668.626] * (-668.555) (-669.762) [-670.465] (-669.001) -- 0:00:19
695000 -- (-669.365) [-670.482] (-671.394) (-670.313) * (-674.671) [-671.841] (-672.619) (-670.981) -- 0:00:19
Average standard deviation of split frequencies: 0.007112
695500 -- (-670.628) (-670.250) [-668.118] (-669.136) * (-674.207) [-670.839] (-669.883) (-672.418) -- 0:00:19
696000 -- (-671.653) (-673.449) (-669.745) [-670.769] * (-672.964) (-670.967) [-671.339] (-671.144) -- 0:00:19
696500 -- (-672.989) (-671.829) [-668.202] (-671.751) * (-670.608) [-671.117] (-670.818) (-670.228) -- 0:00:19
697000 -- (-668.760) (-673.921) (-670.866) [-672.120] * (-671.151) [-673.919] (-674.303) (-670.899) -- 0:00:19
697500 -- (-671.264) [-669.383] (-670.607) (-670.493) * (-669.827) (-673.184) [-673.997] (-670.231) -- 0:00:19
698000 -- (-677.544) (-672.127) (-669.335) [-671.510] * [-673.967] (-673.651) (-670.338) (-670.011) -- 0:00:19
698500 -- [-668.894] (-669.675) (-671.112) (-670.445) * (-668.965) [-671.859] (-672.235) (-667.731) -- 0:00:19
699000 -- (-670.270) [-668.908] (-675.208) (-671.902) * (-670.378) (-672.823) [-671.157] (-669.115) -- 0:00:19
699500 -- [-672.719] (-670.118) (-670.757) (-671.736) * [-669.683] (-673.844) (-674.292) (-670.823) -- 0:00:19
700000 -- (-668.466) (-668.266) [-672.691] (-671.170) * (-669.242) (-671.546) [-672.192] (-670.301) -- 0:00:19
Average standard deviation of split frequencies: 0.006854
700500 -- (-668.404) (-672.214) (-671.572) [-670.144] * (-672.549) (-672.269) (-672.224) [-676.086] -- 0:00:19
701000 -- (-668.782) (-669.127) [-670.605] (-671.539) * (-671.659) (-673.670) (-669.247) [-669.667] -- 0:00:19
701500 -- [-670.387] (-670.351) (-668.062) (-673.124) * (-675.252) (-673.350) (-674.058) [-668.079] -- 0:00:19
702000 -- (-672.461) (-670.421) [-668.548] (-672.588) * [-670.624] (-671.514) (-671.801) (-670.117) -- 0:00:19
702500 -- (-670.591) [-668.919] (-673.417) (-672.635) * [-670.668] (-668.830) (-670.174) (-670.798) -- 0:00:19
703000 -- [-670.927] (-672.850) (-668.868) (-672.426) * (-678.451) (-671.093) (-672.640) [-668.148] -- 0:00:19
703500 -- (-670.977) (-669.575) [-670.059] (-676.979) * (-671.850) (-672.368) (-672.819) [-670.859] -- 0:00:19
704000 -- [-671.083] (-669.942) (-674.853) (-677.378) * (-669.623) (-674.074) (-671.239) [-670.218] -- 0:00:19
704500 -- [-670.263] (-670.158) (-675.744) (-672.704) * (-671.588) (-671.057) [-671.200] (-670.551) -- 0:00:19
705000 -- [-670.578] (-669.469) (-671.988) (-669.925) * [-670.594] (-671.012) (-673.826) (-671.091) -- 0:00:19
Average standard deviation of split frequencies: 0.006343
705500 -- (-673.604) (-674.132) [-670.958] (-670.306) * (-671.234) (-670.790) (-670.075) [-667.099] -- 0:00:19
706000 -- (-673.284) (-670.244) (-669.847) [-670.915] * (-672.686) [-671.018] (-672.788) (-669.829) -- 0:00:19
706500 -- (-668.173) [-670.369] (-671.988) (-672.502) * [-669.470] (-670.418) (-671.666) (-671.186) -- 0:00:19
707000 -- (-668.792) (-670.078) (-673.889) [-670.270] * (-672.286) (-671.331) (-671.685) [-667.277] -- 0:00:19
707500 -- (-671.202) [-668.916] (-669.578) (-672.114) * (-669.427) [-669.214] (-672.338) (-669.480) -- 0:00:19
708000 -- (-674.575) (-670.269) [-671.799] (-671.327) * (-670.246) [-670.393] (-673.690) (-668.791) -- 0:00:18
708500 -- [-670.012] (-669.267) (-674.745) (-673.641) * (-672.965) (-672.807) (-672.067) [-671.130] -- 0:00:18
709000 -- (-670.403) (-671.944) (-672.976) [-671.274] * (-670.436) (-670.301) (-672.320) [-676.668] -- 0:00:18
709500 -- (-670.525) [-669.484] (-668.544) (-670.942) * (-670.083) (-670.197) (-672.075) [-669.514] -- 0:00:18
710000 -- [-669.936] (-673.031) (-670.471) (-672.425) * [-670.266] (-672.268) (-674.319) (-671.799) -- 0:00:18
Average standard deviation of split frequencies: 0.005749
710500 -- (-670.184) (-668.735) [-669.050] (-670.479) * [-669.290] (-670.941) (-669.835) (-671.694) -- 0:00:18
711000 -- [-668.362] (-672.205) (-672.132) (-671.914) * (-669.196) (-670.321) [-670.095] (-671.343) -- 0:00:18
711500 -- [-669.835] (-670.459) (-673.336) (-669.715) * (-672.223) (-676.256) (-670.155) [-672.057] -- 0:00:18
712000 -- (-669.816) [-669.172] (-673.116) (-671.432) * (-668.720) (-672.443) [-668.481] (-672.733) -- 0:00:18
712500 -- [-669.891] (-669.016) (-669.733) (-670.205) * (-670.575) [-669.116] (-668.789) (-673.818) -- 0:00:18
713000 -- (-669.412) (-671.098) (-668.920) [-671.320] * [-671.113] (-670.310) (-669.758) (-677.344) -- 0:00:18
713500 -- (-674.290) [-671.152] (-670.693) (-673.257) * (-670.877) (-671.445) (-671.132) [-671.236] -- 0:00:18
714000 -- (-675.830) (-669.189) [-670.186] (-670.804) * (-673.719) (-672.503) (-669.639) [-670.536] -- 0:00:18
714500 -- (-670.988) (-668.435) [-670.845] (-670.020) * [-671.217] (-672.376) (-670.389) (-670.749) -- 0:00:18
715000 -- (-669.522) (-668.410) (-669.722) [-670.025] * (-674.541) [-672.166] (-672.890) (-671.697) -- 0:00:18
Average standard deviation of split frequencies: 0.005443
715500 -- (-671.030) (-667.370) [-670.743] (-671.340) * (-675.477) (-671.714) [-674.505] (-672.361) -- 0:00:18
716000 -- (-673.784) (-671.676) [-670.539] (-670.055) * (-671.810) (-670.710) (-673.330) [-671.618] -- 0:00:18
716500 -- (-671.974) [-673.797] (-669.683) (-674.751) * [-669.934] (-673.700) (-670.212) (-670.593) -- 0:00:18
717000 -- (-669.790) (-670.223) [-671.824] (-670.594) * [-668.398] (-674.415) (-671.785) (-671.873) -- 0:00:18
717500 -- (-672.211) (-670.584) (-673.621) [-669.221] * (-675.211) (-668.643) (-672.430) [-671.027] -- 0:00:18
718000 -- (-670.128) [-671.418] (-670.170) (-668.915) * (-672.214) [-671.958] (-671.839) (-670.861) -- 0:00:18
718500 -- (-671.251) (-669.544) (-672.525) [-670.774] * (-677.248) (-674.175) (-671.823) [-673.591] -- 0:00:18
719000 -- [-668.807] (-670.477) (-671.340) (-670.890) * (-680.621) (-673.110) [-671.533] (-673.429) -- 0:00:18
719500 -- [-670.768] (-670.243) (-670.874) (-670.828) * (-673.381) (-672.665) (-671.328) [-674.948] -- 0:00:18
720000 -- (-675.683) (-671.456) (-670.448) [-675.432] * [-671.711] (-672.753) (-673.486) (-670.348) -- 0:00:18
Average standard deviation of split frequencies: 0.005364
720500 -- [-669.560] (-670.089) (-668.181) (-670.840) * (-672.139) [-671.499] (-670.244) (-669.500) -- 0:00:18
721000 -- (-671.319) (-674.363) [-666.812] (-672.278) * (-672.133) [-675.948] (-670.791) (-669.454) -- 0:00:18
721500 -- (-677.533) (-675.673) [-669.079] (-669.762) * [-670.487] (-673.155) (-669.431) (-672.738) -- 0:00:18
722000 -- (-671.679) (-672.994) (-668.392) [-672.946] * (-670.798) (-672.768) [-671.125] (-672.226) -- 0:00:18
722500 -- (-669.739) (-669.960) [-671.336] (-673.534) * (-670.225) (-673.793) (-671.182) [-669.421] -- 0:00:18
723000 -- [-673.650] (-671.660) (-675.504) (-668.480) * (-670.552) [-671.884] (-669.770) (-670.695) -- 0:00:18
723500 -- (-672.755) (-666.828) [-671.364] (-671.626) * (-673.909) [-670.597] (-669.945) (-672.232) -- 0:00:17
724000 -- (-670.875) (-668.596) [-670.923] (-670.289) * (-672.187) (-671.421) [-672.366] (-670.097) -- 0:00:17
724500 -- (-670.147) (-669.368) [-670.274] (-670.520) * [-673.128] (-677.086) (-673.589) (-671.779) -- 0:00:17
725000 -- (-671.486) (-668.806) (-678.585) [-672.614] * [-669.641] (-671.020) (-675.741) (-669.682) -- 0:00:17
Average standard deviation of split frequencies: 0.005195
725500 -- [-671.481] (-669.522) (-675.792) (-675.275) * (-670.863) (-671.185) [-672.680] (-670.398) -- 0:00:17
726000 -- (-674.202) (-673.967) (-672.915) [-669.464] * (-670.282) (-671.970) (-673.627) [-671.270] -- 0:00:17
726500 -- [-670.238] (-668.694) (-670.344) (-670.800) * [-669.773] (-674.770) (-670.207) (-670.188) -- 0:00:17
727000 -- (-671.758) [-667.996] (-672.478) (-673.561) * [-669.454] (-669.475) (-670.209) (-673.516) -- 0:00:17
727500 -- (-672.002) (-671.919) (-671.873) [-669.246] * (-669.348) (-668.666) [-668.163] (-672.622) -- 0:00:17
728000 -- [-672.221] (-670.321) (-670.395) (-676.476) * (-669.045) (-673.412) [-670.444] (-672.388) -- 0:00:17
728500 -- [-669.065] (-670.320) (-678.240) (-675.815) * (-671.370) [-672.819] (-675.256) (-672.341) -- 0:00:17
729000 -- (-667.404) (-668.538) (-672.091) [-673.656] * (-668.458) (-671.813) [-671.079] (-672.629) -- 0:00:17
729500 -- (-670.748) (-670.517) (-672.291) [-672.732] * (-673.777) (-669.752) [-671.327] (-676.564) -- 0:00:17
730000 -- (-672.898) [-669.851] (-670.861) (-669.623) * (-670.965) [-672.069] (-667.602) (-672.324) -- 0:00:17
Average standard deviation of split frequencies: 0.005462
730500 -- [-669.173] (-669.503) (-669.063) (-667.194) * (-670.512) [-670.669] (-670.342) (-671.457) -- 0:00:17
731000 -- (-669.241) (-672.227) [-667.498] (-670.324) * (-670.961) [-669.630] (-669.348) (-668.364) -- 0:00:17
731500 -- (-672.181) (-668.203) [-671.007] (-670.538) * (-671.438) (-670.195) (-669.866) [-670.768] -- 0:00:17
732000 -- (-675.261) (-671.175) (-671.131) [-670.154] * (-673.026) (-671.174) [-673.423] (-670.217) -- 0:00:17
732500 -- (-670.465) [-672.792] (-673.117) (-672.235) * (-672.983) (-669.613) (-670.355) [-671.937] -- 0:00:17
733000 -- [-669.415] (-672.344) (-671.268) (-674.287) * (-672.991) (-670.405) [-670.156] (-673.901) -- 0:00:17
733500 -- (-668.095) [-672.576] (-670.338) (-670.332) * (-670.086) (-673.260) (-672.779) [-673.653] -- 0:00:17
734000 -- (-672.217) (-671.638) [-671.196] (-668.114) * [-670.932] (-672.012) (-671.853) (-671.746) -- 0:00:17
734500 -- (-672.816) (-673.323) [-669.400] (-668.059) * [-668.701] (-670.770) (-672.347) (-668.233) -- 0:00:17
735000 -- [-670.959] (-672.390) (-669.168) (-668.489) * [-670.822] (-675.429) (-670.612) (-666.984) -- 0:00:17
Average standard deviation of split frequencies: 0.005081
735500 -- (-672.066) (-672.235) [-672.382] (-673.026) * (-669.641) [-669.200] (-668.047) (-669.549) -- 0:00:17
736000 -- (-672.607) (-670.894) (-670.071) [-670.387] * (-669.479) (-668.961) [-667.529] (-669.564) -- 0:00:17
736500 -- (-670.595) (-672.298) [-673.974] (-671.358) * (-669.420) [-669.592] (-669.926) (-671.840) -- 0:00:17
737000 -- (-671.077) (-670.849) [-670.550] (-671.472) * (-671.126) (-669.039) (-669.842) [-670.832] -- 0:00:17
737500 -- (-669.903) [-670.847] (-671.261) (-667.971) * (-670.023) [-669.498] (-670.676) (-669.724) -- 0:00:17
738000 -- (-670.876) [-672.224] (-672.438) (-672.505) * (-670.953) (-675.733) (-668.129) [-670.236] -- 0:00:17
738500 -- [-672.191] (-673.201) (-673.732) (-669.516) * [-669.196] (-670.589) (-667.724) (-673.184) -- 0:00:16
739000 -- (-671.195) (-672.334) (-669.678) [-671.505] * (-669.586) [-669.854] (-670.223) (-674.093) -- 0:00:16
739500 -- (-673.393) (-670.077) [-674.287] (-667.495) * [-667.880] (-670.780) (-668.271) (-673.529) -- 0:00:16
740000 -- (-673.646) (-669.891) [-669.346] (-667.409) * (-669.429) (-669.442) (-672.203) [-671.258] -- 0:00:16
Average standard deviation of split frequencies: 0.005304
740500 -- (-673.474) (-671.981) [-670.787] (-667.854) * [-671.928] (-669.931) (-674.179) (-673.434) -- 0:00:16
741000 -- (-671.335) (-675.712) [-671.315] (-668.374) * (-675.645) [-669.317] (-671.126) (-667.884) -- 0:00:16
741500 -- (-672.043) [-674.044] (-672.026) (-669.278) * [-674.291] (-668.094) (-677.101) (-672.266) -- 0:00:16
742000 -- (-676.924) (-669.780) [-669.453] (-671.687) * (-670.655) (-669.084) (-670.430) [-671.552] -- 0:00:16
742500 -- (-672.526) [-673.854] (-670.291) (-669.400) * (-667.240) (-668.982) (-669.184) [-673.535] -- 0:00:16
743000 -- (-671.772) (-670.463) (-669.180) [-667.520] * (-668.101) [-671.376] (-669.237) (-671.209) -- 0:00:16
743500 -- (-669.851) (-670.281) [-668.867] (-667.937) * [-668.575] (-672.740) (-670.477) (-670.765) -- 0 