--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:02:52 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cdd/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -554.29 -560.15
2 -554.29 -557.74
--------------------------------------
TOTAL -554.29 -559.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898935 0.086296 0.359596 1.466641 0.865573 1501.00 1501.00 1.000
r(A<->C){all} 0.165423 0.019519 0.000209 0.442229 0.130350 122.89 157.60 1.002
r(A<->G){all} 0.178765 0.020719 0.000059 0.470556 0.144785 202.05 287.63 1.005
r(A<->T){all} 0.165472 0.021507 0.000005 0.474504 0.124020 296.53 319.88 1.002
r(C<->G){all} 0.172268 0.021010 0.000005 0.470142 0.133650 136.97 197.57 1.000
r(C<->T){all} 0.158064 0.018103 0.000019 0.437183 0.119327 120.37 149.53 1.000
r(G<->T){all} 0.160009 0.019877 0.000001 0.443619 0.119417 144.17 190.78 1.001
pi(A){all} 0.216438 0.000414 0.177760 0.256286 0.216121 1403.17 1449.24 1.000
pi(C){all} 0.273101 0.000512 0.229554 0.317124 0.272532 1126.49 1260.71 1.000
pi(G){all} 0.300722 0.000524 0.257089 0.345393 0.300527 1258.82 1336.98 1.001
pi(T){all} 0.209739 0.000418 0.170467 0.248942 0.209113 1359.86 1422.75 1.000
alpha{1,2} 0.407837 0.218573 0.000117 1.352050 0.243213 1253.09 1377.04 1.000
alpha{3} 0.448433 0.238966 0.000431 1.422336 0.286614 1040.22 1132.30 1.000
pinvar{all} 0.995992 0.000023 0.986907 0.999999 0.997471 937.31 1153.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -537.605214
Model 2: PositiveSelection -537.605274
Model 0: one-ratio -537.605214
Model 7: beta -537.605214
Model 8: beta&w>1 -537.605254
Model 0 vs 1 0.0
Model 2 vs 1 1.199999999244028E-4
Model 8 vs 7 7.999999979801942E-5
>C1
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C2
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C3
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C4
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C5
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C6
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=134
C1 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C2 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C3 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C4 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C5 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C6 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
**************************************************
C1 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C2 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C3 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C4 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C5 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C6 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
**************************************************
C1 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C2 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C3 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C4 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C5 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C6 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4020]--->[4020]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.665 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C2 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C3 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C4 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C5 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C6 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
**************************************************
C1 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C2 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C3 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C4 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C5 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C6 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
**************************************************
C1 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C2 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C3 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C4 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C5 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C6 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C2 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C3 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C4 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C5 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C6 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
**************************************************
C1 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C2 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C3 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C4 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C5 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C6 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
**************************************************
C1 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C2 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C3 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C4 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C5 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C6 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
**************************************************
C1 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C2 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C3 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C4 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C5 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C6 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
**************************************************
C1 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C2 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C3 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C4 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C5 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C6 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
**************************************************
C1 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C2 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C3 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C4 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C5 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C6 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
**************************************************
C1 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C2 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C3 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C4 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C5 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C6 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
**************************************************
C1 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C2 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C3 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C4 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C5 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C6 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
**************************************************
C1 AA
C2 AA
C3 AA
C4 AA
C5 AA
C6 AA
**
>C1
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C2
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C3
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C4
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C5
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C6
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C1
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C2
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C3
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C4
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C5
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C6
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 402 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773701
Setting output file names to "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1764455769
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8333414215
Seed = 414241026
Swapseed = 1579773701
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -899.695220 -- -24.965149
Chain 2 -- -899.695220 -- -24.965149
Chain 3 -- -899.695272 -- -24.965149
Chain 4 -- -899.695220 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -899.695272 -- -24.965149
Chain 2 -- -899.695272 -- -24.965149
Chain 3 -- -899.695135 -- -24.965149
Chain 4 -- -899.695220 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-899.695] (-899.695) (-899.695) (-899.695) * [-899.695] (-899.695) (-899.695) (-899.695)
500 -- [-567.107] (-559.429) (-562.692) (-562.745) * [-566.280] (-561.826) (-571.034) (-557.735) -- 0:00:00
1000 -- (-575.808) [-562.913] (-566.597) (-564.730) * (-567.487) [-557.899] (-562.562) (-563.928) -- 0:00:00
1500 -- [-560.225] (-569.479) (-568.142) (-562.595) * (-560.794) (-561.671) [-559.272] (-560.305) -- 0:00:00
2000 -- (-560.563) (-569.666) [-561.280] (-560.556) * [-559.513] (-569.379) (-568.013) (-567.001) -- 0:00:00
2500 -- (-566.115) [-561.561] (-567.798) (-567.645) * (-568.028) (-568.299) (-569.551) [-564.061] -- 0:00:00
3000 -- (-565.383) (-566.368) (-567.810) [-562.023] * (-567.663) [-559.932] (-567.481) (-572.962) -- 0:00:00
3500 -- (-565.020) (-563.345) (-573.992) [-564.522] * (-564.166) (-564.441) [-562.315] (-562.009) -- 0:00:00
4000 -- (-566.166) (-569.362) (-564.482) [-563.190] * (-559.379) [-560.799] (-560.400) (-565.246) -- 0:00:00
4500 -- (-569.672) [-560.796] (-564.863) (-568.264) * (-562.976) (-563.799) [-562.934] (-562.901) -- 0:00:00
5000 -- (-568.052) [-566.173] (-568.692) (-572.031) * (-558.458) (-562.046) [-569.936] (-557.739) -- 0:00:00
Average standard deviation of split frequencies: 0.109994
5500 -- (-563.328) (-570.471) [-561.934] (-566.746) * (-566.646) (-563.223) [-565.120] (-571.209) -- 0:00:00
6000 -- (-565.169) [-564.776] (-561.762) (-564.240) * [-560.826] (-569.456) (-572.362) (-568.273) -- 0:00:00
6500 -- (-572.295) [-559.456] (-565.839) (-563.556) * (-571.671) (-570.142) [-564.693] (-565.682) -- 0:00:00
7000 -- [-561.452] (-569.165) (-564.831) (-566.359) * (-557.763) (-576.078) (-558.100) [-568.043] -- 0:00:00
7500 -- (-563.956) (-577.756) (-565.348) [-561.936] * (-573.686) (-564.870) (-561.008) [-564.287] -- 0:00:00
8000 -- (-558.674) [-571.738] (-572.295) (-564.971) * (-566.699) (-570.458) [-562.372] (-564.874) -- 0:00:00
8500 -- [-559.729] (-559.009) (-564.218) (-558.749) * [-565.542] (-565.881) (-566.936) (-562.925) -- 0:00:00
9000 -- [-563.316] (-555.889) (-569.777) (-562.285) * (-573.302) (-561.331) (-564.850) [-559.551] -- 0:00:00
9500 -- (-562.404) [-555.148] (-560.991) (-562.861) * [-561.036] (-560.630) (-560.562) (-561.330) -- 0:01:44
10000 -- (-560.303) (-554.379) (-562.304) [-562.046] * (-565.079) (-565.550) (-558.971) [-559.490] -- 0:01:39
Average standard deviation of split frequencies: 0.077990
10500 -- (-566.047) (-553.848) [-565.907] (-564.201) * (-561.274) [-566.401] (-562.504) (-561.686) -- 0:01:34
11000 -- (-569.903) [-554.937] (-567.278) (-567.668) * [-557.261] (-560.587) (-570.418) (-570.334) -- 0:01:29
11500 -- (-564.739) (-556.089) [-564.375] (-558.686) * (-572.473) (-563.057) [-562.217] (-575.397) -- 0:01:25
12000 -- [-561.267] (-557.780) (-559.629) (-560.087) * (-559.975) (-557.617) (-561.078) [-565.473] -- 0:01:22
12500 -- (-573.697) [-559.364] (-559.336) (-561.798) * [-562.058] (-571.636) (-560.436) (-562.129) -- 0:01:19
13000 -- (-568.747) [-557.820] (-564.144) (-560.806) * (-565.252) (-568.086) (-562.707) [-563.094] -- 0:01:15
13500 -- (-566.162) (-554.139) (-566.038) [-559.460] * [-556.667] (-562.130) (-567.088) (-563.342) -- 0:01:13
14000 -- (-572.871) (-556.087) (-565.223) [-559.721] * (-570.597) (-566.489) [-559.600] (-558.466) -- 0:01:10
14500 -- (-558.658) (-554.298) (-567.883) [-568.857] * [-568.333] (-572.318) (-564.167) (-565.122) -- 0:01:07
15000 -- [-553.031] (-553.156) (-570.624) (-563.820) * (-565.270) (-568.249) [-565.665] (-570.879) -- 0:01:05
Average standard deviation of split frequencies: 0.072020
15500 -- (-554.228) [-554.966] (-563.917) (-568.245) * (-559.759) (-566.692) [-568.829] (-573.833) -- 0:01:03
16000 -- [-556.277] (-553.395) (-563.827) (-559.763) * [-568.623] (-580.347) (-569.259) (-566.441) -- 0:01:01
16500 -- (-553.801) (-555.073) [-563.727] (-565.089) * (-560.452) [-562.147] (-566.146) (-569.912) -- 0:00:59
17000 -- (-556.928) (-554.416) [-561.781] (-562.707) * (-566.733) (-562.877) (-566.475) [-561.379] -- 0:00:57
17500 -- (-555.393) [-556.274] (-564.605) (-562.571) * (-566.596) (-560.890) [-568.064] (-560.942) -- 0:00:56
18000 -- [-553.983] (-556.559) (-567.494) (-562.090) * (-565.032) [-572.519] (-562.343) (-569.195) -- 0:00:54
18500 -- (-555.938) [-556.078] (-560.662) (-557.632) * [-569.434] (-567.796) (-563.910) (-564.281) -- 0:00:53
19000 -- (-555.147) [-554.263] (-562.601) (-563.828) * (-563.383) (-580.266) (-567.958) [-565.012] -- 0:00:51
19500 -- [-554.753] (-553.993) (-565.912) (-564.136) * [-564.549] (-574.321) (-579.548) (-560.099) -- 0:00:50
20000 -- [-554.087] (-553.667) (-563.724) (-565.007) * (-565.016) [-569.254] (-570.374) (-564.860) -- 0:00:49
Average standard deviation of split frequencies: 0.065578
20500 -- (-554.572) (-555.581) [-565.154] (-565.388) * [-562.192] (-561.155) (-558.604) (-561.961) -- 0:00:47
21000 -- (-556.380) (-553.467) (-565.219) [-558.038] * (-565.415) (-557.207) (-554.820) [-564.221] -- 0:00:46
21500 -- (-557.096) [-557.592] (-567.031) (-566.040) * [-563.674] (-554.822) (-557.394) (-565.234) -- 0:00:45
22000 -- (-554.724) [-558.224] (-566.915) (-561.093) * (-568.456) (-554.725) (-554.113) [-562.770] -- 0:00:44
22500 -- (-555.436) (-556.514) [-559.070] (-566.059) * (-555.030) (-555.011) (-555.747) [-561.511] -- 0:00:43
23000 -- (-557.923) (-555.442) (-564.001) [-563.492] * (-554.497) [-555.681] (-553.247) (-572.385) -- 0:00:42
23500 -- (-553.086) (-554.461) (-567.843) [-560.338] * (-554.047) [-554.235] (-554.171) (-561.816) -- 0:00:41
24000 -- (-554.327) [-554.763] (-580.247) (-565.687) * [-554.157] (-554.609) (-559.254) (-571.833) -- 0:00:40
24500 -- (-554.321) (-554.468) (-576.851) [-559.017] * (-556.006) (-553.310) (-557.605) [-568.872] -- 0:00:39
25000 -- (-553.013) [-555.278] (-574.976) (-559.760) * [-555.072] (-554.063) (-554.391) (-564.134) -- 0:01:18
Average standard deviation of split frequencies: 0.053486
25500 -- (-555.204) (-553.860) (-565.261) [-567.813] * (-556.119) (-556.288) [-555.807] (-576.565) -- 0:01:16
26000 -- (-553.029) (-557.915) [-563.713] (-563.265) * (-556.444) (-556.098) (-556.250) [-558.125] -- 0:01:14
26500 -- (-555.404) [-556.577] (-560.217) (-569.316) * (-558.868) [-558.701] (-553.375) (-562.773) -- 0:01:13
27000 -- [-554.458] (-554.656) (-568.304) (-562.308) * (-556.508) (-553.799) (-557.951) [-567.322] -- 0:01:12
27500 -- (-555.473) (-552.952) [-566.965] (-568.914) * (-554.514) [-556.350] (-555.021) (-563.421) -- 0:01:10
28000 -- [-555.606] (-553.651) (-567.602) (-569.807) * (-554.041) (-554.949) [-554.050] (-566.722) -- 0:01:09
28500 -- (-554.959) (-553.023) [-553.244] (-571.579) * (-556.265) (-556.738) (-556.501) [-560.757] -- 0:01:08
29000 -- (-553.672) (-556.157) (-554.387) [-560.169] * (-553.511) [-555.627] (-555.112) (-567.984) -- 0:01:06
29500 -- [-554.988] (-556.041) (-552.987) (-562.509) * [-552.939] (-554.109) (-554.538) (-566.888) -- 0:01:05
30000 -- (-556.990) [-555.593] (-554.333) (-561.426) * (-553.792) (-554.555) [-558.694] (-562.978) -- 0:01:04
Average standard deviation of split frequencies: 0.059869
30500 -- (-552.885) (-556.140) [-556.453] (-560.008) * (-556.509) (-554.244) [-554.429] (-567.222) -- 0:01:03
31000 -- (-554.209) (-555.690) [-552.975] (-557.281) * (-553.478) (-555.169) (-553.535) [-562.016] -- 0:01:02
31500 -- (-554.908) [-553.922] (-556.324) (-556.883) * (-554.929) (-560.146) (-553.678) [-565.077] -- 0:01:01
32000 -- (-553.904) (-553.296) (-558.212) [-559.381] * (-553.725) [-555.674] (-554.199) (-562.630) -- 0:01:00
32500 -- (-555.635) [-556.155] (-554.122) (-559.203) * (-554.843) (-553.386) (-561.990) [-562.509] -- 0:00:59
33000 -- (-559.475) (-555.336) [-553.725] (-558.856) * [-554.697] (-556.195) (-557.700) (-572.766) -- 0:00:58
33500 -- (-563.028) [-556.365] (-555.100) (-556.304) * (-555.258) (-556.112) [-554.228] (-565.809) -- 0:00:57
34000 -- (-560.708) [-554.485] (-553.986) (-554.582) * (-552.789) [-558.949] (-554.362) (-558.819) -- 0:00:56
34500 -- (-557.398) (-554.109) [-556.188] (-554.161) * [-553.014] (-555.361) (-555.777) (-557.608) -- 0:00:55
35000 -- (-554.735) (-556.734) [-554.458] (-555.658) * (-553.904) [-554.617] (-553.867) (-555.885) -- 0:00:55
Average standard deviation of split frequencies: 0.052378
35500 -- [-554.703] (-555.627) (-555.435) (-556.773) * (-556.257) (-553.867) (-553.698) [-557.485] -- 0:00:54
36000 -- (-553.030) (-556.018) (-553.242) [-554.900] * (-555.741) (-553.579) [-554.986] (-556.149) -- 0:00:53
36500 -- [-557.986] (-555.006) (-554.058) (-553.314) * [-556.315] (-554.424) (-553.227) (-554.461) -- 0:00:52
37000 -- (-554.376) (-553.106) [-555.089] (-555.371) * (-557.091) [-556.456] (-554.855) (-554.328) -- 0:00:52
37500 -- [-554.910] (-553.783) (-553.202) (-554.471) * (-556.528) (-554.234) (-557.205) [-555.098] -- 0:00:51
38000 -- [-556.483] (-555.306) (-553.361) (-553.532) * (-556.145) (-553.744) (-555.530) [-555.073] -- 0:00:50
38500 -- [-557.801] (-552.919) (-556.170) (-554.731) * (-554.266) [-554.022] (-556.227) (-558.521) -- 0:00:49
39000 -- (-555.342) (-553.051) [-557.658] (-554.497) * [-554.327] (-558.061) (-556.725) (-557.733) -- 0:00:49
39500 -- (-555.768) (-554.386) [-554.536] (-558.931) * (-555.298) (-560.176) (-558.372) [-553.746] -- 0:00:48
40000 -- (-555.554) (-553.529) [-557.869] (-561.962) * [-554.407] (-554.602) (-560.646) (-553.002) -- 0:00:48
Average standard deviation of split frequencies: 0.043927
40500 -- (-553.630) (-553.635) (-553.690) [-554.231] * (-556.675) (-553.662) (-558.790) [-553.978] -- 0:00:47
41000 -- (-555.008) (-554.997) [-557.042] (-558.316) * (-556.403) (-555.835) [-559.161] (-554.965) -- 0:00:46
41500 -- (-556.723) (-554.123) (-553.114) [-554.506] * (-553.518) (-554.646) [-555.124] (-557.859) -- 0:00:46
42000 -- [-554.660] (-555.647) (-554.563) (-554.491) * [-555.388] (-554.777) (-554.968) (-554.903) -- 0:01:08
42500 -- (-554.594) (-555.420) [-552.964] (-554.412) * [-557.386] (-555.369) (-554.117) (-553.433) -- 0:01:07
43000 -- (-556.765) [-553.515] (-555.125) (-558.154) * (-560.844) (-555.238) [-554.421] (-553.659) -- 0:01:06
43500 -- (-555.776) [-554.641] (-554.056) (-555.795) * (-559.239) (-555.423) (-554.630) [-553.018] -- 0:01:05
44000 -- [-555.054] (-556.458) (-553.942) (-553.852) * [-557.590] (-555.893) (-557.400) (-554.130) -- 0:01:05
44500 -- (-555.433) (-559.214) (-554.985) [-554.119] * (-562.238) (-555.843) [-553.941] (-554.775) -- 0:01:04
45000 -- (-554.107) (-556.700) [-555.571] (-557.274) * (-555.137) (-553.098) [-554.168] (-554.649) -- 0:01:03
Average standard deviation of split frequencies: 0.035645
45500 -- (-554.295) (-559.185) [-553.089] (-560.256) * (-555.360) [-554.416] (-555.124) (-559.267) -- 0:01:02
46000 -- (-553.154) [-557.116] (-554.346) (-557.481) * (-553.268) [-555.319] (-554.520) (-561.016) -- 0:01:02
46500 -- [-554.432] (-559.029) (-553.285) (-558.620) * (-560.534) [-554.500] (-554.813) (-555.242) -- 0:01:01
47000 -- (-553.913) (-554.666) [-553.318] (-554.029) * (-553.212) [-553.414] (-554.660) (-555.793) -- 0:01:00
47500 -- (-553.760) (-555.300) (-554.571) [-552.977] * (-553.271) (-557.178) (-556.140) [-554.073] -- 0:01:00
48000 -- (-555.229) (-556.212) (-554.374) [-554.442] * [-554.014] (-555.416) (-554.630) (-555.319) -- 0:00:59
48500 -- (-553.761) [-555.769] (-554.760) (-557.813) * [-554.112] (-556.883) (-553.672) (-556.277) -- 0:00:58
49000 -- (-557.716) [-553.845] (-556.024) (-557.379) * (-553.809) (-556.214) [-553.921] (-559.092) -- 0:00:58
49500 -- (-553.059) (-556.379) (-553.587) [-553.662] * (-554.391) (-554.085) [-554.844] (-553.524) -- 0:00:57
50000 -- (-555.470) (-555.835) (-555.208) [-554.449] * [-553.143] (-553.344) (-555.169) (-554.722) -- 0:00:57
Average standard deviation of split frequencies: 0.033833
50500 -- (-558.887) [-555.868] (-554.014) (-553.908) * (-553.438) (-556.488) [-557.506] (-554.434) -- 0:00:56
51000 -- (-558.854) [-553.963] (-553.000) (-555.472) * (-555.004) (-555.563) (-553.888) [-553.090] -- 0:00:55
51500 -- (-560.788) (-554.782) (-554.827) [-555.326] * (-556.197) [-554.458] (-554.842) (-553.842) -- 0:00:55
52000 -- (-556.927) (-557.405) [-553.580] (-557.218) * [-554.908] (-554.134) (-557.242) (-554.139) -- 0:00:54
52500 -- (-557.528) (-556.591) (-553.563) [-553.332] * [-562.491] (-556.461) (-554.626) (-554.153) -- 0:00:54
53000 -- (-554.482) (-553.874) (-554.095) [-554.369] * (-559.277) [-554.364] (-555.081) (-553.265) -- 0:00:53
53500 -- (-555.889) [-555.769] (-556.139) (-554.359) * (-555.321) [-555.120] (-555.050) (-554.680) -- 0:00:53
54000 -- (-559.900) (-556.388) (-556.430) [-554.706] * (-560.476) (-554.555) [-555.142] (-554.401) -- 0:00:52
54500 -- [-557.061] (-553.338) (-557.387) (-555.121) * (-560.072) (-556.608) (-555.175) [-557.723] -- 0:00:52
55000 -- (-556.721) (-554.637) (-555.496) [-553.524] * (-553.573) (-553.371) [-554.614] (-554.210) -- 0:00:51
Average standard deviation of split frequencies: 0.039564
55500 -- [-554.934] (-553.197) (-554.825) (-554.444) * (-555.802) [-552.949] (-553.125) (-554.402) -- 0:00:51
56000 -- (-560.405) (-556.566) (-556.069) [-558.382] * (-554.616) [-554.643] (-554.310) (-555.611) -- 0:00:50
56500 -- (-557.697) [-559.568] (-554.324) (-557.019) * [-554.816] (-554.008) (-553.128) (-555.281) -- 0:00:50
57000 -- (-555.212) (-554.359) (-559.132) [-553.351] * [-553.265] (-553.231) (-554.329) (-557.299) -- 0:00:49
57500 -- [-555.381] (-555.944) (-554.104) (-554.032) * (-553.603) (-555.177) (-555.333) [-556.622] -- 0:00:49
58000 -- (-552.870) (-555.075) [-553.976] (-558.983) * (-554.012) [-553.912] (-554.107) (-553.994) -- 0:00:48
58500 -- (-553.519) (-556.383) [-553.113] (-553.736) * [-553.641] (-553.240) (-553.599) (-557.664) -- 0:00:48
59000 -- (-552.870) (-556.589) [-555.899] (-552.977) * (-560.786) [-556.297] (-556.076) (-557.286) -- 0:00:47
59500 -- (-554.620) (-555.234) [-553.838] (-557.178) * [-553.682] (-552.833) (-554.250) (-553.023) -- 0:01:03
60000 -- (-555.911) [-556.305] (-553.339) (-554.668) * [-554.002] (-555.021) (-558.408) (-554.327) -- 0:01:02
Average standard deviation of split frequencies: 0.040406
60500 -- (-559.093) (-553.796) (-554.647) [-556.079] * [-555.814] (-555.000) (-557.227) (-554.949) -- 0:01:02
61000 -- (-555.917) [-554.618] (-559.510) (-556.278) * (-558.767) (-554.981) [-555.140] (-553.679) -- 0:01:01
61500 -- (-554.686) (-554.165) [-553.194] (-554.397) * (-553.326) [-554.349] (-555.211) (-553.714) -- 0:01:01
62000 -- [-556.231] (-553.725) (-554.514) (-554.709) * (-554.975) (-553.010) [-558.941] (-553.709) -- 0:01:00
62500 -- (-554.327) [-553.701] (-553.408) (-555.019) * (-556.655) (-556.429) [-554.242] (-553.737) -- 0:01:00
63000 -- (-555.964) (-555.568) [-554.392] (-554.891) * (-553.739) (-553.610) [-553.482] (-553.132) -- 0:00:59
63500 -- (-555.123) [-556.173] (-553.241) (-554.952) * (-554.666) [-554.612] (-553.371) (-556.987) -- 0:00:58
64000 -- (-554.685) [-554.475] (-552.857) (-553.774) * (-553.454) (-554.098) (-554.236) [-554.437] -- 0:00:58
64500 -- [-553.592] (-554.963) (-553.635) (-554.107) * (-553.322) (-557.222) (-554.577) [-555.823] -- 0:00:58
65000 -- [-553.306] (-553.420) (-558.203) (-555.090) * (-554.901) (-555.769) (-558.241) [-554.670] -- 0:00:57
Average standard deviation of split frequencies: 0.043476
65500 -- (-557.132) (-554.897) (-553.675) [-554.282] * (-556.155) (-557.939) [-555.069] (-557.575) -- 0:00:57
66000 -- (-554.538) [-555.409] (-555.654) (-555.179) * (-554.975) [-554.183] (-554.070) (-557.956) -- 0:00:56
66500 -- (-554.344) (-554.702) (-554.274) [-554.212] * [-554.119] (-557.451) (-557.180) (-557.964) -- 0:00:56
67000 -- [-552.745] (-558.178) (-553.382) (-560.214) * (-554.099) [-553.171] (-559.084) (-555.461) -- 0:00:55
67500 -- [-556.684] (-557.622) (-554.953) (-556.039) * (-556.301) (-555.180) (-556.926) [-555.561] -- 0:00:55
68000 -- (-556.493) [-555.668] (-555.294) (-556.452) * (-553.614) (-554.887) (-554.937) [-552.763] -- 0:00:54
68500 -- (-558.575) [-553.648] (-555.746) (-558.121) * [-554.982] (-558.650) (-553.962) (-553.430) -- 0:00:54
69000 -- (-562.493) (-555.561) [-555.052] (-554.067) * (-554.687) (-554.961) [-556.035] (-553.902) -- 0:00:53
69500 -- (-557.380) (-556.258) (-555.084) [-553.043] * (-559.871) [-553.530] (-554.039) (-553.849) -- 0:00:53
70000 -- (-555.204) (-557.742) (-555.717) [-554.379] * (-557.094) [-553.037] (-552.954) (-559.882) -- 0:00:53
Average standard deviation of split frequencies: 0.039155
70500 -- (-553.292) (-564.390) [-553.327] (-556.592) * (-552.756) (-555.575) (-553.129) [-554.461] -- 0:00:52
71000 -- (-553.196) (-554.818) (-552.761) [-554.886] * (-553.138) (-555.628) (-552.820) [-553.975] -- 0:00:52
71500 -- (-553.775) (-554.933) [-556.427] (-554.198) * (-554.656) (-553.970) (-555.012) [-554.219] -- 0:00:51
72000 -- (-555.062) (-555.255) (-554.084) [-555.531] * (-554.485) [-555.095] (-555.629) (-557.624) -- 0:00:51
72500 -- (-556.634) (-556.001) (-556.620) [-554.724] * (-556.284) [-556.012] (-561.655) (-559.465) -- 0:00:51
73000 -- (-557.549) (-555.381) (-555.634) [-553.870] * (-555.287) (-555.110) [-556.920] (-559.580) -- 0:00:50
73500 -- (-553.275) [-555.054] (-555.786) (-555.106) * (-553.352) (-554.208) [-556.272] (-559.437) -- 0:00:50
74000 -- [-557.316] (-557.473) (-554.909) (-555.587) * (-553.332) (-553.655) (-553.478) [-554.514] -- 0:00:50
74500 -- (-556.914) [-553.334] (-558.812) (-555.365) * [-553.281] (-555.749) (-554.827) (-555.455) -- 0:00:49
75000 -- (-553.118) (-554.400) [-558.116] (-554.298) * [-553.428] (-556.825) (-553.357) (-554.722) -- 0:00:49
Average standard deviation of split frequencies: 0.037216
75500 -- (-554.465) (-560.385) (-556.847) [-554.128] * (-554.188) (-555.266) (-558.107) [-554.938] -- 0:00:48
76000 -- (-553.446) (-553.431) [-554.646] (-554.861) * [-555.415] (-554.161) (-556.522) (-556.789) -- 0:01:00
76500 -- [-559.122] (-554.214) (-554.832) (-556.156) * (-561.372) (-557.186) [-556.434] (-555.760) -- 0:01:00
77000 -- (-553.458) (-558.105) [-555.514] (-555.633) * (-555.135) (-557.087) [-556.199] (-553.604) -- 0:00:59
77500 -- [-552.976] (-555.285) (-556.013) (-554.699) * (-553.511) (-553.143) [-553.956] (-553.565) -- 0:00:59
78000 -- (-552.884) (-557.676) [-555.185] (-554.540) * (-556.702) (-555.377) [-553.940] (-554.558) -- 0:00:59
78500 -- (-554.797) (-558.924) (-556.505) [-554.088] * (-555.501) [-555.069] (-555.850) (-554.270) -- 0:00:58
79000 -- (-554.215) (-558.816) (-554.353) [-553.411] * (-552.808) (-553.697) [-555.980] (-554.113) -- 0:00:58
79500 -- (-554.593) (-554.251) (-554.228) [-554.444] * [-556.295] (-554.814) (-555.284) (-554.683) -- 0:00:57
80000 -- [-556.525] (-554.546) (-556.132) (-554.959) * [-554.308] (-555.649) (-553.340) (-554.930) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
80500 -- [-557.485] (-557.577) (-555.964) (-554.451) * (-554.446) [-554.194] (-553.816) (-555.076) -- 0:00:57
81000 -- (-556.581) (-555.259) (-554.529) [-554.452] * (-560.633) (-553.274) [-553.412] (-558.553) -- 0:00:56
81500 -- (-554.705) (-554.246) [-557.535] (-555.877) * (-554.844) (-553.189) (-554.577) [-554.041] -- 0:00:56
82000 -- [-553.644] (-554.955) (-555.991) (-554.289) * [-557.227] (-555.092) (-554.667) (-556.025) -- 0:00:55
82500 -- (-556.690) (-554.186) [-555.310] (-557.218) * (-557.103) (-560.278) [-554.780] (-554.180) -- 0:00:55
83000 -- (-555.509) (-553.088) (-553.912) [-555.045] * [-553.959] (-556.344) (-554.402) (-554.350) -- 0:00:55
83500 -- (-554.740) [-553.381] (-553.169) (-557.262) * (-558.183) (-554.015) [-556.097] (-554.769) -- 0:00:54
84000 -- (-554.575) (-557.606) [-553.513] (-558.998) * (-558.569) [-554.103] (-554.840) (-556.965) -- 0:00:54
84500 -- [-556.753] (-554.162) (-554.356) (-553.518) * (-555.764) (-554.535) [-555.813] (-556.245) -- 0:00:54
85000 -- [-553.153] (-556.663) (-553.908) (-553.823) * (-553.091) (-555.225) [-555.053] (-555.010) -- 0:00:53
Average standard deviation of split frequencies: 0.031792
85500 -- (-557.964) (-557.226) (-555.872) [-555.603] * [-556.516] (-553.937) (-556.119) (-553.438) -- 0:00:53
86000 -- [-553.131] (-556.247) (-557.499) (-554.957) * (-554.492) (-556.777) [-559.271] (-554.531) -- 0:00:53
86500 -- (-554.099) (-556.069) (-553.380) [-555.339] * (-552.898) (-555.540) [-556.834] (-553.638) -- 0:00:52
87000 -- [-555.289] (-557.078) (-557.511) (-553.725) * (-556.352) (-556.971) (-555.423) [-554.319] -- 0:00:52
87500 -- (-555.508) (-555.338) [-554.774] (-555.363) * (-554.144) [-554.200] (-555.234) (-555.824) -- 0:00:52
88000 -- (-553.395) [-553.357] (-555.480) (-555.595) * (-553.227) (-553.575) [-553.970] (-558.214) -- 0:00:51
88500 -- [-555.591] (-554.011) (-556.927) (-557.139) * (-555.827) [-556.633] (-558.169) (-557.898) -- 0:00:51
89000 -- (-555.106) [-554.553] (-556.848) (-555.251) * (-554.703) [-554.824] (-556.884) (-556.120) -- 0:00:51
89500 -- (-554.907) (-553.275) [-553.796] (-562.412) * (-561.308) (-555.388) [-554.554] (-556.466) -- 0:00:50
90000 -- [-554.108] (-554.625) (-554.589) (-567.280) * (-555.745) (-555.987) [-553.608] (-556.149) -- 0:00:50
Average standard deviation of split frequencies: 0.025006
90500 -- (-552.761) (-555.459) (-556.198) [-559.965] * (-560.647) (-555.182) (-554.945) [-558.519] -- 0:00:50
91000 -- [-553.644] (-555.106) (-554.066) (-557.030) * (-555.895) (-556.463) [-558.051] (-554.918) -- 0:00:49
91500 -- (-555.296) [-554.147] (-553.651) (-554.319) * (-553.872) (-554.180) [-559.117] (-555.712) -- 0:00:49
92000 -- (-556.479) (-554.645) [-554.235] (-553.459) * (-555.841) (-557.545) (-558.415) [-554.108] -- 0:00:49
92500 -- (-557.942) [-553.268] (-553.014) (-558.123) * [-556.065] (-565.193) (-556.903) (-555.986) -- 0:00:49
93000 -- (-554.275) (-553.995) (-555.026) [-555.434] * (-558.158) (-554.641) (-556.898) [-562.393] -- 0:00:58
93500 -- (-556.291) (-555.661) [-554.021] (-555.566) * (-554.656) (-553.377) [-556.602] (-555.188) -- 0:00:58
94000 -- (-554.827) (-554.344) [-555.060] (-553.649) * [-554.927] (-556.484) (-557.130) (-556.738) -- 0:00:57
94500 -- [-554.005] (-554.021) (-558.937) (-552.935) * (-555.565) (-554.578) [-554.294] (-554.623) -- 0:00:57
95000 -- (-554.351) (-555.714) (-559.881) [-553.992] * (-557.532) (-553.289) [-555.225] (-556.017) -- 0:00:57
Average standard deviation of split frequencies: 0.024061
95500 -- (-555.485) (-555.200) (-554.327) [-553.475] * (-554.248) (-555.275) [-559.023] (-559.275) -- 0:00:56
96000 -- [-553.207] (-554.406) (-554.558) (-555.053) * [-553.373] (-553.081) (-560.877) (-557.961) -- 0:00:56
96500 -- (-553.109) (-555.869) (-554.041) [-556.504] * [-555.752] (-553.925) (-556.846) (-555.289) -- 0:00:56
97000 -- (-555.940) (-556.995) [-556.043] (-556.406) * (-553.273) (-556.598) (-557.572) [-557.114] -- 0:00:55
97500 -- (-555.508) (-556.826) [-553.272] (-553.863) * [-553.565] (-556.262) (-554.911) (-557.427) -- 0:00:55
98000 -- (-555.027) (-553.795) [-553.836] (-555.514) * (-553.233) (-553.981) [-553.920] (-553.381) -- 0:00:55
98500 -- (-553.231) (-552.920) [-555.164] (-553.709) * (-554.253) (-554.273) [-554.043] (-554.905) -- 0:00:54
99000 -- (-552.987) (-554.975) [-557.939] (-555.267) * [-555.512] (-553.199) (-555.318) (-555.548) -- 0:00:54
99500 -- (-556.186) (-557.516) (-555.724) [-555.772] * (-555.343) (-557.253) (-560.181) [-556.390] -- 0:00:54
100000 -- (-552.669) (-554.961) [-554.491] (-558.274) * (-553.163) (-557.409) [-556.052] (-559.108) -- 0:00:54
Average standard deviation of split frequencies: 0.024154
100500 -- [-552.734] (-555.102) (-554.054) (-556.350) * (-554.269) (-554.148) [-554.048] (-557.519) -- 0:00:53
101000 -- (-556.529) [-556.720] (-557.234) (-557.999) * (-555.115) (-553.698) [-553.415] (-554.807) -- 0:00:53
101500 -- (-554.599) (-556.189) [-555.805] (-557.556) * [-556.650] (-554.436) (-553.062) (-554.326) -- 0:00:53
102000 -- (-559.030) (-553.274) [-556.756] (-555.472) * (-557.886) (-555.256) (-555.248) [-558.267] -- 0:00:52
102500 -- (-555.296) (-555.221) (-555.499) [-557.806] * (-555.788) [-558.078] (-556.588) (-553.398) -- 0:00:52
103000 -- (-558.050) (-554.781) (-571.229) [-554.302] * (-553.774) (-555.754) (-556.557) [-553.657] -- 0:00:52
103500 -- [-554.804] (-555.433) (-557.646) (-553.399) * (-553.349) (-559.494) (-554.996) [-555.459] -- 0:00:51
104000 -- (-556.269) (-557.086) [-558.251] (-554.337) * (-556.487) (-557.661) [-554.218] (-553.902) -- 0:00:51
104500 -- (-554.784) (-552.984) [-554.792] (-554.073) * [-554.232] (-554.979) (-555.687) (-553.394) -- 0:00:51
105000 -- (-554.623) (-552.987) [-554.751] (-555.049) * [-555.988] (-553.415) (-563.112) (-555.214) -- 0:00:51
Average standard deviation of split frequencies: 0.021768
105500 -- (-554.463) [-552.965] (-556.551) (-553.591) * [-554.460] (-555.463) (-556.755) (-554.397) -- 0:00:50
106000 -- (-557.687) [-555.087] (-556.022) (-553.484) * [-554.016] (-555.370) (-555.600) (-556.457) -- 0:00:50
106500 -- (-553.928) (-553.250) [-554.715] (-553.155) * (-553.702) (-556.812) [-558.253] (-554.027) -- 0:00:50
107000 -- (-554.410) [-554.532] (-554.106) (-554.004) * [-553.607] (-556.255) (-558.501) (-554.160) -- 0:00:50
107500 -- (-554.004) [-554.782] (-553.052) (-555.805) * (-553.727) (-555.359) [-553.259] (-555.271) -- 0:00:49
108000 -- [-556.854] (-559.713) (-556.420) (-562.774) * (-554.471) [-553.419] (-555.465) (-553.313) -- 0:00:49
108500 -- (-558.517) (-562.081) (-557.352) [-553.593] * (-555.834) (-553.714) [-554.678] (-554.360) -- 0:00:49
109000 -- (-554.890) (-558.255) (-553.331) [-554.699] * (-556.883) (-554.452) (-555.120) [-553.840] -- 0:00:49
109500 -- (-555.970) (-553.386) [-554.927] (-555.665) * (-555.998) [-554.593] (-556.605) (-553.283) -- 0:00:48
110000 -- (-553.531) [-554.958] (-554.673) (-553.506) * (-554.213) [-555.513] (-557.887) (-553.428) -- 0:00:56
Average standard deviation of split frequencies: 0.020825
110500 -- (-555.287) (-555.972) (-559.433) [-553.741] * [-554.367] (-557.591) (-554.219) (-555.980) -- 0:00:56
111000 -- (-553.474) (-557.910) [-553.304] (-554.285) * (-556.725) (-555.138) [-553.633] (-558.607) -- 0:00:56
111500 -- (-554.548) [-554.590] (-557.127) (-553.339) * (-553.969) (-554.875) (-553.539) [-554.820] -- 0:00:55
112000 -- (-554.919) [-556.661] (-555.626) (-556.144) * (-553.184) [-559.138] (-557.307) (-553.796) -- 0:00:55
112500 -- (-558.450) (-554.217) (-553.211) [-553.663] * (-555.913) (-558.793) [-557.143] (-557.498) -- 0:00:55
113000 -- (-555.049) [-562.273] (-554.615) (-555.626) * (-556.517) (-553.783) (-554.589) [-555.920] -- 0:00:54
113500 -- (-556.243) (-555.959) (-558.200) [-554.491] * [-553.344] (-555.731) (-553.408) (-557.156) -- 0:00:54
114000 -- (-555.714) (-559.582) [-556.239] (-556.170) * (-556.889) (-554.180) [-558.391] (-556.154) -- 0:00:54
114500 -- (-557.173) [-559.513] (-555.676) (-554.121) * (-555.352) [-555.288] (-553.887) (-557.043) -- 0:00:54
115000 -- (-556.068) (-565.006) [-556.700] (-560.409) * (-556.352) (-555.655) (-553.444) [-554.607] -- 0:00:53
Average standard deviation of split frequencies: 0.021222
115500 -- (-555.018) (-557.346) (-553.851) [-554.728] * [-556.783] (-554.692) (-554.007) (-555.370) -- 0:00:53
116000 -- [-554.060] (-555.458) (-555.200) (-553.930) * (-555.526) [-557.799] (-553.392) (-555.720) -- 0:00:53
116500 -- [-557.220] (-555.350) (-555.255) (-557.236) * (-555.319) (-557.971) (-556.140) [-553.369] -- 0:00:53
117000 -- [-556.626] (-553.823) (-556.732) (-559.698) * (-554.913) (-554.051) (-554.611) [-554.563] -- 0:00:52
117500 -- (-556.238) [-556.971] (-561.081) (-556.001) * (-553.348) (-553.136) [-558.666] (-553.416) -- 0:00:52
118000 -- [-555.480] (-556.901) (-556.945) (-553.871) * (-556.843) [-553.193] (-555.072) (-554.919) -- 0:00:52
118500 -- [-552.906] (-555.116) (-554.058) (-554.029) * [-554.450] (-554.714) (-556.215) (-553.786) -- 0:00:52
119000 -- [-556.500] (-554.793) (-557.488) (-554.541) * [-553.846] (-554.781) (-554.138) (-555.352) -- 0:00:51
119500 -- (-555.069) (-554.986) [-553.770] (-553.410) * (-554.488) (-553.369) [-558.550] (-553.890) -- 0:00:51
120000 -- (-553.161) (-559.879) [-554.624] (-553.605) * (-554.577) [-552.630] (-555.409) (-558.327) -- 0:00:51
Average standard deviation of split frequencies: 0.019993
120500 -- (-553.501) (-554.054) (-554.333) [-553.409] * (-554.888) [-553.051] (-556.355) (-557.775) -- 0:00:51
121000 -- (-553.262) (-555.793) (-553.656) [-553.114] * (-554.025) (-554.062) [-554.025] (-552.924) -- 0:00:50
121500 -- (-556.375) (-556.659) [-554.765] (-555.988) * (-552.812) (-554.390) (-554.226) [-556.254] -- 0:00:50
122000 -- (-556.018) (-555.313) (-557.446) [-555.557] * [-553.272] (-554.954) (-553.494) (-556.453) -- 0:00:50
122500 -- [-554.709] (-554.646) (-555.301) (-556.398) * (-554.436) (-554.204) [-556.438] (-553.691) -- 0:00:50
123000 -- (-554.398) [-553.634] (-555.009) (-554.381) * (-554.071) (-553.391) [-556.292] (-555.021) -- 0:00:49
123500 -- (-559.164) (-553.837) (-554.651) [-552.733] * (-554.983) (-556.634) (-556.579) [-554.361] -- 0:00:49
124000 -- (-556.130) (-553.824) (-556.782) [-553.188] * (-557.073) (-555.472) (-555.355) [-553.187] -- 0:00:49
124500 -- [-554.642] (-554.707) (-556.377) (-552.749) * (-553.678) (-555.810) [-557.732] (-556.619) -- 0:00:49
125000 -- (-554.120) [-555.884] (-554.033) (-556.634) * (-553.765) (-555.405) [-555.321] (-557.535) -- 0:00:49
Average standard deviation of split frequencies: 0.019330
125500 -- (-557.509) (-553.944) (-553.414) [-555.584] * [-560.567] (-555.823) (-556.667) (-554.709) -- 0:00:48
126000 -- (-555.251) [-553.913] (-554.649) (-554.360) * (-562.271) (-556.973) [-554.070] (-554.797) -- 0:00:48
126500 -- (-557.873) (-554.837) [-555.307] (-555.844) * (-555.796) [-553.915] (-554.005) (-553.834) -- 0:00:48
127000 -- (-556.212) (-554.788) [-555.549] (-556.303) * (-553.987) (-557.561) (-555.636) [-558.939] -- 0:00:54
127500 -- (-552.763) [-553.661] (-558.641) (-560.414) * (-553.716) (-554.375) [-557.874] (-557.725) -- 0:00:54
128000 -- (-554.976) (-554.637) [-554.553] (-555.812) * [-558.245] (-554.674) (-556.450) (-554.259) -- 0:00:54
128500 -- [-553.875] (-553.486) (-555.472) (-555.438) * (-554.571) (-553.641) (-554.948) [-553.620] -- 0:00:54
129000 -- (-555.482) (-554.179) (-554.574) [-554.670] * (-553.746) [-553.122] (-554.977) (-555.899) -- 0:00:54
129500 -- (-554.507) (-558.229) [-555.112] (-553.718) * (-555.821) [-553.117] (-554.076) (-553.379) -- 0:00:53
130000 -- (-554.799) (-556.387) [-554.325] (-557.172) * [-554.746] (-555.184) (-553.650) (-556.761) -- 0:00:53
Average standard deviation of split frequencies: 0.016899
130500 -- [-554.427] (-554.459) (-554.832) (-555.133) * (-555.632) (-553.726) [-554.256] (-554.814) -- 0:00:53
131000 -- (-553.331) (-556.592) (-555.097) [-555.339] * (-554.111) [-553.092] (-554.155) (-554.132) -- 0:00:53
131500 -- (-553.331) [-554.871] (-557.100) (-555.866) * (-553.175) [-553.260] (-555.553) (-554.112) -- 0:00:52
132000 -- (-559.163) [-555.955] (-556.141) (-559.371) * (-553.490) [-555.598] (-555.940) (-556.364) -- 0:00:52
132500 -- [-556.244] (-554.461) (-555.133) (-556.324) * [-553.499] (-555.410) (-557.489) (-556.718) -- 0:00:52
133000 -- (-555.222) (-553.364) (-554.470) [-558.257] * (-556.546) [-552.857] (-554.590) (-553.500) -- 0:00:52
133500 -- (-553.170) [-554.981] (-555.492) (-559.267) * (-561.015) [-553.779] (-555.255) (-559.772) -- 0:00:51
134000 -- (-555.307) [-556.633] (-556.308) (-558.541) * (-555.360) (-555.662) (-553.037) [-554.342] -- 0:00:51
134500 -- [-552.799] (-555.428) (-557.142) (-554.699) * (-556.326) (-555.149) (-555.060) [-553.330] -- 0:00:51
135000 -- (-556.933) [-559.370] (-556.851) (-555.493) * (-555.037) (-554.072) (-557.385) [-554.959] -- 0:00:51
Average standard deviation of split frequencies: 0.017716
135500 -- (-553.102) (-555.924) (-555.089) [-554.660] * (-553.764) [-555.951] (-555.411) (-554.192) -- 0:00:51
136000 -- (-552.807) (-557.379) (-554.873) [-553.666] * (-555.538) [-553.055] (-553.452) (-555.242) -- 0:00:50
136500 -- [-554.889] (-558.430) (-555.931) (-555.021) * [-553.919] (-553.532) (-556.300) (-557.804) -- 0:00:50
137000 -- (-559.305) [-554.702] (-555.104) (-554.121) * [-555.681] (-556.403) (-555.229) (-555.418) -- 0:00:50
137500 -- (-557.234) [-556.388] (-556.264) (-554.171) * (-555.086) (-556.134) [-556.787] (-555.176) -- 0:00:50
138000 -- (-554.921) [-559.093] (-555.517) (-553.235) * [-555.276] (-554.235) (-554.583) (-558.463) -- 0:00:49
138500 -- [-553.855] (-556.591) (-557.600) (-556.479) * [-556.650] (-553.196) (-555.256) (-555.519) -- 0:00:49
139000 -- (-556.841) (-552.915) (-553.381) [-554.236] * (-556.683) (-556.977) [-553.994] (-557.297) -- 0:00:49
139500 -- (-554.560) (-556.153) (-555.370) [-557.500] * (-553.730) [-554.347] (-556.442) (-554.798) -- 0:00:49
140000 -- (-555.237) (-553.440) [-554.132] (-556.161) * (-556.616) (-556.229) [-557.209] (-555.370) -- 0:00:49
Average standard deviation of split frequencies: 0.017991
140500 -- (-555.293) (-553.565) (-557.028) [-556.189] * (-555.465) [-554.966] (-554.379) (-553.761) -- 0:00:48
141000 -- (-553.049) (-562.018) [-555.137] (-560.397) * [-555.303] (-555.548) (-554.803) (-557.447) -- 0:00:48
141500 -- (-553.037) [-553.292] (-555.632) (-557.378) * (-554.125) (-554.533) [-554.152] (-556.882) -- 0:00:48
142000 -- (-553.038) [-552.919] (-554.300) (-555.260) * (-554.117) [-553.735] (-553.176) (-553.229) -- 0:00:48
142500 -- [-552.899] (-553.855) (-553.401) (-553.305) * (-558.004) [-553.274] (-554.344) (-555.792) -- 0:00:48
143000 -- (-554.634) [-553.920] (-553.641) (-553.975) * [-553.231] (-552.795) (-552.816) (-554.027) -- 0:00:53
143500 -- (-559.602) [-554.707] (-553.703) (-553.599) * (-556.413) (-554.464) [-554.328] (-556.595) -- 0:00:53
144000 -- (-552.672) [-554.508] (-553.817) (-554.836) * (-556.252) [-554.716] (-554.420) (-553.587) -- 0:00:53
144500 -- (-559.127) (-555.605) [-557.881] (-554.197) * [-553.259] (-556.564) (-556.687) (-554.201) -- 0:00:53
145000 -- (-552.995) (-552.828) (-556.525) [-554.568] * (-553.238) (-555.847) [-556.230] (-554.097) -- 0:00:53
Average standard deviation of split frequencies: 0.016484
145500 -- (-553.786) (-553.237) [-555.515] (-555.795) * (-555.140) [-553.557] (-554.364) (-554.292) -- 0:00:52
146000 -- (-554.859) [-555.518] (-553.173) (-556.404) * (-554.794) [-554.221] (-554.098) (-557.118) -- 0:00:52
146500 -- (-554.103) (-555.420) (-553.379) [-553.917] * (-559.307) [-554.230] (-554.163) (-553.610) -- 0:00:52
147000 -- (-554.619) (-555.386) [-553.369] (-555.291) * (-556.870) (-554.209) (-557.309) [-553.854] -- 0:00:52
147500 -- [-554.152] (-557.192) (-558.447) (-558.947) * [-555.010] (-556.675) (-554.401) (-559.220) -- 0:00:52
148000 -- (-554.028) (-555.868) [-554.879] (-555.056) * (-556.733) [-556.740] (-554.834) (-554.205) -- 0:00:51
148500 -- (-553.569) [-552.996] (-558.840) (-554.558) * (-555.946) (-553.955) (-555.130) [-553.836] -- 0:00:51
149000 -- (-554.954) (-557.403) [-553.389] (-553.012) * (-558.411) [-554.317] (-556.113) (-554.481) -- 0:00:51
149500 -- (-553.473) (-555.650) [-554.768] (-554.435) * [-553.619] (-553.730) (-556.047) (-557.006) -- 0:00:51
150000 -- (-554.653) [-554.162] (-553.021) (-555.012) * [-557.797] (-552.826) (-555.455) (-554.964) -- 0:00:51
Average standard deviation of split frequencies: 0.018279
150500 -- (-555.526) (-553.274) [-554.202] (-555.767) * (-557.137) (-553.630) [-554.331] (-555.492) -- 0:00:50
151000 -- (-556.189) (-556.080) [-555.319] (-555.397) * [-555.910] (-553.772) (-555.082) (-557.128) -- 0:00:50
151500 -- (-554.773) (-558.320) (-558.028) [-554.609] * [-553.459] (-555.986) (-556.141) (-553.464) -- 0:00:50
152000 -- (-556.985) [-555.607] (-554.001) (-556.451) * (-554.955) [-553.442] (-555.348) (-560.568) -- 0:00:50
152500 -- (-555.136) [-554.363] (-553.752) (-558.451) * [-558.522] (-555.723) (-554.555) (-559.420) -- 0:00:50
153000 -- [-554.953] (-554.350) (-558.240) (-554.929) * (-557.667) (-553.932) [-554.075] (-554.038) -- 0:00:49
153500 -- [-555.678] (-555.071) (-560.709) (-555.088) * [-553.526] (-555.718) (-554.778) (-556.800) -- 0:00:49
154000 -- (-557.349) [-555.991] (-556.759) (-555.733) * (-554.021) [-557.549] (-553.159) (-555.184) -- 0:00:49
154500 -- (-556.195) (-558.873) (-556.954) [-553.802] * (-554.720) [-553.685] (-553.191) (-555.614) -- 0:00:49
155000 -- (-554.173) [-555.121] (-556.366) (-559.336) * (-554.800) [-553.906] (-554.278) (-554.676) -- 0:00:49
Average standard deviation of split frequencies: 0.017795
155500 -- (-554.937) [-554.832] (-553.397) (-553.955) * (-556.277) (-556.105) [-553.796] (-554.746) -- 0:00:48
156000 -- (-554.481) (-553.344) (-553.741) [-554.885] * (-556.850) (-555.681) (-554.668) [-554.372] -- 0:00:48
156500 -- (-556.229) [-554.865] (-553.598) (-559.178) * (-554.466) [-554.165] (-556.543) (-554.195) -- 0:00:48
157000 -- (-554.543) [-554.300] (-553.341) (-557.909) * [-553.001] (-555.773) (-554.255) (-559.697) -- 0:00:48
157500 -- [-552.953] (-554.290) (-557.796) (-557.757) * (-557.394) (-555.296) (-556.287) [-557.857] -- 0:00:48
158000 -- [-553.113] (-557.628) (-554.039) (-556.579) * (-553.852) [-552.996] (-556.089) (-556.059) -- 0:00:47
158500 -- (-554.693) (-554.727) (-554.421) [-555.070] * (-554.644) (-553.708) [-554.350] (-556.632) -- 0:00:47
159000 -- (-558.772) (-554.697) [-557.996] (-554.605) * [-553.971] (-553.834) (-555.980) (-554.003) -- 0:00:47
159500 -- (-554.448) [-558.075] (-553.988) (-556.495) * (-554.191) [-554.692] (-558.305) (-556.005) -- 0:00:47
160000 -- (-555.023) (-552.816) [-553.874] (-555.767) * [-553.316] (-554.629) (-552.958) (-556.965) -- 0:00:52
Average standard deviation of split frequencies: 0.017141
160500 -- (-553.853) (-554.713) [-553.409] (-559.406) * (-553.315) [-553.860] (-553.935) (-555.853) -- 0:00:52
161000 -- (-553.083) [-556.058] (-554.210) (-561.168) * [-556.763] (-553.353) (-557.649) (-552.543) -- 0:00:52
161500 -- (-554.146) (-560.702) (-555.860) [-558.160] * [-553.030] (-554.604) (-558.179) (-558.493) -- 0:00:51
162000 -- (-557.459) [-562.595] (-556.250) (-554.200) * (-554.222) [-555.536] (-556.767) (-557.033) -- 0:00:51
162500 -- (-555.163) (-556.319) [-557.008] (-554.396) * (-554.021) (-556.982) [-555.087] (-563.217) -- 0:00:51
163000 -- [-555.143] (-555.847) (-552.863) (-553.212) * [-554.874] (-556.461) (-553.534) (-559.345) -- 0:00:51
163500 -- (-558.061) (-553.778) [-553.598] (-554.945) * (-555.115) [-555.813] (-553.648) (-554.476) -- 0:00:51
164000 -- (-554.341) (-555.152) [-555.575] (-553.129) * (-557.220) (-553.236) [-554.141] (-555.903) -- 0:00:50
164500 -- (-556.248) (-557.913) (-554.934) [-555.685] * [-554.389] (-553.484) (-555.326) (-553.755) -- 0:00:50
165000 -- (-555.608) (-557.447) [-556.579] (-556.321) * [-554.722] (-553.845) (-553.612) (-557.857) -- 0:00:50
Average standard deviation of split frequencies: 0.016897
165500 -- [-553.762] (-555.355) (-554.501) (-554.562) * (-554.562) (-555.559) [-555.908] (-554.158) -- 0:00:50
166000 -- (-553.905) [-553.320] (-556.113) (-554.597) * (-560.119) (-554.603) (-554.395) [-558.009] -- 0:00:50
166500 -- [-555.112] (-553.920) (-559.433) (-553.996) * (-554.105) (-553.044) [-558.372] (-555.476) -- 0:00:50
167000 -- (-552.925) [-552.922] (-556.494) (-554.470) * (-556.620) (-554.487) (-554.915) [-553.997] -- 0:00:49
167500 -- [-554.159] (-554.048) (-555.292) (-553.912) * (-556.476) [-558.212] (-555.492) (-558.743) -- 0:00:49
168000 -- (-557.421) (-557.516) [-552.626] (-555.530) * [-555.688] (-556.555) (-556.805) (-554.755) -- 0:00:49
168500 -- (-554.210) (-560.350) (-555.781) [-556.977] * (-553.949) [-553.797] (-554.007) (-554.210) -- 0:00:49
169000 -- (-553.240) (-554.700) [-554.520] (-555.522) * (-553.330) [-554.080] (-557.385) (-557.596) -- 0:00:49
169500 -- (-555.199) (-554.074) (-553.552) [-557.606] * (-555.663) [-554.080] (-554.795) (-554.031) -- 0:00:48
170000 -- (-558.484) (-554.342) [-554.512] (-552.734) * (-560.372) (-553.971) [-554.037] (-554.560) -- 0:00:48
Average standard deviation of split frequencies: 0.018172
170500 -- (-556.505) (-554.601) [-553.831] (-554.004) * (-553.744) (-554.095) (-556.696) [-556.657] -- 0:00:48
171000 -- (-554.661) (-555.270) (-555.412) [-557.277] * (-553.811) [-555.935] (-555.712) (-554.106) -- 0:00:48
171500 -- (-558.071) (-554.378) (-558.132) [-558.749] * (-555.637) (-555.868) (-555.944) [-553.805] -- 0:00:48
172000 -- [-553.895] (-558.544) (-555.149) (-555.823) * (-560.788) [-554.094] (-555.306) (-554.353) -- 0:00:48
172500 -- (-554.524) [-553.505] (-556.831) (-555.415) * [-554.685] (-555.231) (-555.571) (-554.944) -- 0:00:47
173000 -- [-557.900] (-553.233) (-553.103) (-553.019) * (-553.809) (-555.032) [-554.054] (-557.060) -- 0:00:47
173500 -- (-553.255) (-554.044) (-560.457) [-556.561] * (-554.068) (-556.296) [-553.587] (-555.124) -- 0:00:47
174000 -- (-554.795) (-554.811) [-557.704] (-557.675) * [-553.407] (-554.979) (-552.721) (-556.995) -- 0:00:47
174500 -- (-556.033) [-553.816] (-555.545) (-558.897) * (-555.970) (-553.547) (-558.421) [-553.424] -- 0:00:47
175000 -- (-554.740) (-554.142) (-553.466) [-557.127] * (-555.867) (-553.454) [-555.083] (-553.698) -- 0:00:47
Average standard deviation of split frequencies: 0.015922
175500 -- [-553.950] (-554.786) (-555.022) (-553.337) * (-556.111) (-554.767) (-555.086) [-555.198] -- 0:00:46
176000 -- (-558.523) (-560.844) (-553.190) [-555.895] * (-554.419) (-553.236) (-554.465) [-554.850] -- 0:00:46
176500 -- [-553.662] (-554.513) (-553.664) (-556.525) * (-559.040) [-553.975] (-553.591) (-555.240) -- 0:00:46
177000 -- [-553.787] (-559.126) (-553.420) (-557.648) * (-554.776) [-556.100] (-555.291) (-554.588) -- 0:00:51
177500 -- (-555.526) (-554.010) (-554.471) [-555.426] * [-554.708] (-555.329) (-556.453) (-553.185) -- 0:00:50
178000 -- (-558.431) (-557.691) (-553.578) [-559.192] * [-557.131] (-556.337) (-556.454) (-554.937) -- 0:00:50
178500 -- [-556.981] (-556.840) (-554.190) (-558.403) * [-553.430] (-557.566) (-558.404) (-558.715) -- 0:00:50
179000 -- (-556.058) (-557.182) [-553.720] (-564.830) * (-554.735) [-553.682] (-556.621) (-556.229) -- 0:00:50
179500 -- (-554.931) [-557.310] (-554.285) (-561.931) * (-555.803) [-554.112] (-553.473) (-554.960) -- 0:00:50
180000 -- (-555.764) [-554.102] (-561.347) (-558.562) * (-555.561) (-554.302) [-553.184] (-555.067) -- 0:00:50
Average standard deviation of split frequencies: 0.015656
180500 -- (-559.880) (-555.697) [-555.030] (-557.320) * [-555.341] (-554.990) (-554.007) (-556.296) -- 0:00:49
181000 -- [-553.859] (-554.996) (-555.181) (-555.104) * [-552.993] (-554.692) (-554.307) (-555.453) -- 0:00:49
181500 -- (-554.699) [-553.920] (-556.524) (-558.582) * (-553.976) (-556.204) [-554.518] (-554.566) -- 0:00:49
182000 -- (-554.130) [-554.485] (-556.443) (-556.834) * [-554.749] (-559.153) (-561.069) (-553.863) -- 0:00:49
182500 -- (-554.380) (-553.509) [-553.825] (-559.275) * (-555.289) (-559.352) (-553.628) [-554.437] -- 0:00:49
183000 -- [-557.349] (-553.465) (-555.518) (-553.841) * (-556.231) (-556.322) (-553.215) [-554.337] -- 0:00:49
183500 -- (-554.943) [-555.660] (-556.356) (-553.571) * [-555.511] (-553.454) (-555.687) (-553.519) -- 0:00:48
184000 -- (-553.974) (-556.654) [-554.609] (-559.124) * [-553.745] (-556.377) (-553.640) (-553.970) -- 0:00:48
184500 -- (-553.983) [-553.276] (-554.243) (-556.640) * [-553.780] (-554.995) (-553.270) (-558.308) -- 0:00:48
185000 -- (-556.076) [-552.823] (-554.677) (-556.511) * (-557.372) (-558.150) (-557.068) [-560.852] -- 0:00:48
Average standard deviation of split frequencies: 0.015874
185500 -- (-554.127) [-553.276] (-554.678) (-554.609) * [-554.410] (-555.522) (-558.449) (-557.563) -- 0:00:48
186000 -- [-554.645] (-554.039) (-556.226) (-556.257) * [-556.325] (-553.929) (-555.308) (-557.210) -- 0:00:48
186500 -- [-559.370] (-556.999) (-558.171) (-553.330) * (-555.934) (-560.731) (-557.560) [-554.098] -- 0:00:47
187000 -- (-558.496) (-556.745) (-555.836) [-553.217] * (-553.246) (-556.290) [-554.269] (-552.574) -- 0:00:47
187500 -- [-557.835] (-553.547) (-561.117) (-554.402) * [-554.631] (-558.374) (-555.779) (-554.067) -- 0:00:47
188000 -- (-555.998) [-554.370] (-554.126) (-553.954) * [-555.596] (-553.797) (-555.793) (-554.874) -- 0:00:47
188500 -- [-557.846] (-553.912) (-555.308) (-561.788) * (-556.763) [-554.198] (-555.458) (-553.715) -- 0:00:47
189000 -- (-555.321) (-556.261) (-555.154) [-556.689] * (-555.837) (-553.654) [-553.565] (-555.236) -- 0:00:47
189500 -- [-554.426] (-556.019) (-553.096) (-554.631) * (-555.338) (-554.204) (-554.320) [-554.541] -- 0:00:47
190000 -- [-553.974] (-552.918) (-554.604) (-556.061) * (-555.972) (-553.018) (-553.961) [-554.058] -- 0:00:46
Average standard deviation of split frequencies: 0.016318
190500 -- [-558.048] (-555.192) (-555.236) (-555.482) * (-556.375) (-554.832) [-555.375] (-555.636) -- 0:00:46
191000 -- [-557.317] (-553.000) (-555.273) (-553.530) * (-557.295) (-555.142) [-556.606] (-555.990) -- 0:00:46
191500 -- (-559.472) (-555.278) (-554.887) [-555.340] * (-556.230) (-554.898) [-555.591] (-554.531) -- 0:00:46
192000 -- (-561.514) (-553.582) (-554.022) [-553.466] * (-553.184) [-555.202] (-553.934) (-552.674) -- 0:00:46
192500 -- [-561.599] (-554.156) (-553.830) (-557.584) * (-555.881) (-555.642) [-555.308] (-553.290) -- 0:00:46
193000 -- (-558.736) (-553.898) [-554.371] (-554.430) * (-554.543) (-554.221) (-557.417) [-555.719] -- 0:00:45
193500 -- (-554.728) (-554.387) (-554.739) [-553.702] * (-553.908) (-552.768) [-554.471] (-557.453) -- 0:00:45
194000 -- (-554.070) (-555.666) [-554.450] (-553.489) * (-554.584) (-553.064) [-553.432] (-554.734) -- 0:00:45
194500 -- (-555.173) (-557.440) [-553.922] (-552.686) * (-553.448) [-553.885] (-556.488) (-554.375) -- 0:00:49
195000 -- [-554.919] (-555.585) (-554.252) (-555.851) * (-557.965) (-555.405) (-556.203) [-554.013] -- 0:00:49
Average standard deviation of split frequencies: 0.018481
195500 -- (-552.745) (-554.444) (-554.052) [-553.601] * [-554.902] (-554.274) (-556.434) (-552.998) -- 0:00:49
196000 -- (-556.995) (-558.681) [-552.834] (-552.648) * [-553.573] (-553.957) (-556.134) (-553.451) -- 0:00:49
196500 -- [-555.180] (-556.146) (-558.506) (-553.847) * (-556.946) [-555.365] (-555.899) (-554.909) -- 0:00:49
197000 -- (-553.457) (-555.456) [-555.893] (-555.422) * (-554.387) (-553.546) [-557.409] (-553.848) -- 0:00:48
197500 -- (-555.459) (-554.202) [-556.350] (-554.931) * (-561.111) (-554.010) [-556.921] (-553.145) -- 0:00:48
198000 -- [-555.285] (-552.897) (-558.162) (-556.172) * (-554.382) [-554.165] (-557.650) (-554.356) -- 0:00:48
198500 -- (-553.295) (-554.032) [-555.839] (-555.921) * (-557.481) (-555.466) (-554.308) [-555.546] -- 0:00:48
199000 -- (-552.680) [-552.700] (-558.831) (-556.125) * [-555.315] (-554.917) (-554.636) (-557.743) -- 0:00:48
199500 -- [-553.313] (-553.224) (-558.748) (-554.505) * (-556.524) [-553.893] (-556.093) (-555.524) -- 0:00:48
200000 -- (-557.381) [-556.513] (-561.511) (-554.909) * [-552.868] (-553.772) (-558.974) (-555.626) -- 0:00:48
Average standard deviation of split frequencies: 0.020648
200500 -- [-556.585] (-554.506) (-560.245) (-554.686) * (-553.848) (-554.597) [-554.279] (-556.382) -- 0:00:47
201000 -- (-555.133) (-553.537) [-553.670] (-554.211) * (-554.317) [-553.240] (-556.863) (-557.385) -- 0:00:47
201500 -- (-557.179) (-554.911) (-554.984) [-553.049] * (-554.373) [-554.886] (-554.176) (-557.996) -- 0:00:47
202000 -- (-556.162) [-552.724] (-555.680) (-553.962) * (-556.232) [-555.474] (-554.745) (-553.904) -- 0:00:47
202500 -- (-561.268) (-555.766) [-554.645] (-554.202) * [-556.152] (-554.466) (-555.694) (-556.482) -- 0:00:47
203000 -- (-558.105) (-554.956) [-553.724] (-554.858) * (-556.140) (-553.900) [-553.462] (-555.813) -- 0:00:47
203500 -- [-554.481] (-554.508) (-554.345) (-557.516) * (-553.003) (-553.753) (-554.996) [-553.721] -- 0:00:46
204000 -- (-556.046) (-557.385) [-557.555] (-558.497) * (-552.780) (-554.491) (-553.968) [-554.650] -- 0:00:46
204500 -- (-553.811) [-554.350] (-556.805) (-557.673) * (-553.231) (-554.993) [-554.315] (-559.002) -- 0:00:46
205000 -- (-555.137) (-554.852) (-554.672) [-553.680] * [-555.381] (-554.825) (-556.069) (-552.670) -- 0:00:46
Average standard deviation of split frequencies: 0.020595
205500 -- (-554.377) [-554.060] (-553.598) (-554.526) * (-560.150) (-555.806) [-554.458] (-557.047) -- 0:00:46
206000 -- (-562.607) (-557.339) (-557.024) [-555.587] * (-554.248) (-555.158) (-556.017) [-554.607] -- 0:00:46
206500 -- [-563.630] (-556.314) (-555.302) (-558.410) * (-554.920) [-557.488] (-556.760) (-555.050) -- 0:00:46
207000 -- (-556.997) [-554.688] (-553.493) (-557.819) * (-553.230) (-558.118) (-556.185) [-555.974] -- 0:00:45
207500 -- (-556.608) [-554.999] (-553.954) (-556.995) * (-554.844) [-554.594] (-553.332) (-555.630) -- 0:00:45
208000 -- [-554.649] (-556.187) (-556.488) (-556.008) * [-554.791] (-559.144) (-554.436) (-556.428) -- 0:00:45
208500 -- [-554.568] (-557.601) (-554.063) (-561.368) * (-554.765) [-554.518] (-555.366) (-555.891) -- 0:00:45
209000 -- (-557.998) (-555.610) [-555.214] (-560.181) * (-554.403) [-555.330] (-553.987) (-553.183) -- 0:00:45
209500 -- [-556.573] (-554.121) (-557.124) (-555.962) * (-554.429) [-555.114] (-560.113) (-556.994) -- 0:00:45
210000 -- (-555.102) (-554.705) [-554.748] (-557.874) * [-554.399] (-553.719) (-555.177) (-560.708) -- 0:00:45
Average standard deviation of split frequencies: 0.020251
210500 -- [-556.705] (-553.473) (-556.694) (-556.134) * (-556.734) (-554.957) (-552.794) [-554.005] -- 0:00:45
211000 -- (-555.131) (-556.373) (-556.346) [-554.839] * [-554.591] (-561.563) (-554.401) (-553.712) -- 0:00:44
211500 -- [-554.776] (-557.122) (-558.868) (-555.499) * [-554.643] (-556.114) (-553.332) (-553.867) -- 0:00:48
212000 -- (-554.045) (-555.611) [-554.345] (-553.989) * (-557.038) (-553.740) (-558.674) [-555.312] -- 0:00:48
212500 -- (-554.622) (-553.414) [-555.671] (-555.186) * (-558.445) (-554.049) [-555.052] (-555.193) -- 0:00:48
213000 -- (-553.817) (-553.505) (-554.966) [-552.676] * (-554.717) [-554.527] (-553.629) (-555.317) -- 0:00:48
213500 -- (-554.535) (-552.926) [-558.315] (-553.824) * [-554.400] (-557.314) (-554.175) (-554.378) -- 0:00:47
214000 -- (-554.067) (-554.286) [-555.424] (-553.594) * (-555.247) (-556.486) (-554.961) [-557.867] -- 0:00:47
214500 -- [-553.323] (-555.922) (-560.069) (-555.259) * (-558.453) [-556.913] (-554.153) (-556.810) -- 0:00:47
215000 -- (-554.082) (-555.193) (-559.425) [-553.492] * [-554.294] (-555.212) (-555.748) (-556.459) -- 0:00:47
Average standard deviation of split frequencies: 0.020297
215500 -- [-555.890] (-556.221) (-555.212) (-553.684) * (-554.483) (-554.246) (-555.738) [-554.259] -- 0:00:47
216000 -- [-554.571] (-556.348) (-555.146) (-554.546) * (-555.712) (-554.640) [-552.916] (-557.770) -- 0:00:47
216500 -- (-557.258) [-555.862] (-558.099) (-559.509) * (-555.084) (-555.255) (-554.720) [-555.577] -- 0:00:47
217000 -- [-553.674] (-558.886) (-557.554) (-558.077) * (-553.761) (-553.749) (-554.225) [-557.697] -- 0:00:46
217500 -- (-554.586) [-556.905] (-553.148) (-555.501) * [-555.726] (-552.935) (-555.140) (-554.748) -- 0:00:46
218000 -- (-556.345) (-554.030) [-555.840] (-556.323) * (-553.739) (-553.833) [-553.104] (-560.149) -- 0:00:46
218500 -- (-554.157) (-555.000) (-553.754) [-556.551] * (-555.031) (-554.356) [-553.914] (-557.554) -- 0:00:46
219000 -- (-552.810) (-556.217) (-554.593) [-553.799] * [-558.619] (-553.786) (-555.461) (-554.495) -- 0:00:46
219500 -- (-553.872) [-554.131] (-556.383) (-552.991) * (-554.502) (-555.387) [-555.377] (-553.935) -- 0:00:46
220000 -- (-555.044) (-553.154) [-553.217] (-557.382) * [-557.438] (-555.286) (-554.598) (-556.362) -- 0:00:46
Average standard deviation of split frequencies: 0.020238
220500 -- (-555.127) (-553.748) (-557.864) [-553.073] * (-554.153) (-554.494) (-553.732) [-557.016] -- 0:00:45
221000 -- (-554.591) (-553.610) (-556.789) [-554.322] * (-560.026) [-557.233] (-552.805) (-554.772) -- 0:00:45
221500 -- (-552.706) [-554.276] (-554.013) (-554.823) * (-554.041) (-558.659) [-552.915] (-557.097) -- 0:00:45
222000 -- (-553.106) (-556.751) [-552.892] (-555.474) * [-555.479] (-555.994) (-552.816) (-555.872) -- 0:00:45
222500 -- (-556.591) (-558.710) [-557.845] (-557.356) * (-558.335) (-554.749) (-553.442) [-553.128] -- 0:00:45
223000 -- (-553.855) [-556.639] (-554.683) (-557.726) * (-553.950) (-555.999) (-555.272) [-553.407] -- 0:00:45
223500 -- [-559.576] (-555.355) (-556.156) (-554.623) * (-555.110) (-553.725) [-555.833] (-554.073) -- 0:00:45
224000 -- (-559.824) (-555.649) (-557.176) [-554.438] * (-555.083) (-554.010) (-555.903) [-553.932] -- 0:00:45
224500 -- (-554.892) [-555.790] (-555.779) (-555.849) * (-555.593) [-554.940] (-553.862) (-553.443) -- 0:00:44
225000 -- (-559.740) (-554.521) (-556.139) [-553.133] * (-555.665) (-555.764) [-557.293] (-554.745) -- 0:00:44
Average standard deviation of split frequencies: 0.019607
225500 -- [-555.673] (-559.219) (-557.144) (-554.391) * (-556.052) (-555.226) [-556.696] (-552.831) -- 0:00:44
226000 -- (-556.664) (-556.264) (-553.621) [-558.834] * (-557.362) (-557.683) [-554.466] (-555.949) -- 0:00:44
226500 -- (-553.500) [-553.526] (-553.882) (-556.095) * (-556.206) [-559.946] (-555.253) (-553.311) -- 0:00:44
227000 -- (-556.047) (-556.129) (-553.768) [-553.733] * (-556.709) (-555.661) [-554.606] (-553.748) -- 0:00:44
227500 -- (-554.369) (-553.130) [-557.726] (-555.745) * (-552.650) [-555.836] (-555.127) (-556.651) -- 0:00:44
228000 -- [-553.716] (-553.477) (-555.552) (-556.130) * (-554.810) (-553.833) [-559.479] (-555.100) -- 0:00:44
228500 -- (-556.746) (-557.095) [-556.503] (-557.109) * (-554.581) [-557.470] (-553.613) (-552.896) -- 0:00:47
229000 -- (-557.912) (-554.542) [-553.485] (-557.846) * (-554.204) [-555.562] (-556.263) (-552.970) -- 0:00:47
229500 -- [-553.112] (-554.520) (-554.500) (-554.820) * [-553.236] (-554.490) (-556.170) (-554.294) -- 0:00:47
230000 -- (-554.726) (-555.271) (-555.853) [-553.776] * (-555.624) (-555.640) [-553.946] (-555.568) -- 0:00:46
Average standard deviation of split frequencies: 0.019108
230500 -- (-560.021) (-556.791) [-553.774] (-556.996) * [-553.762] (-558.043) (-556.395) (-554.831) -- 0:00:46
231000 -- (-556.795) (-553.050) [-555.618] (-556.405) * (-554.936) [-555.274] (-555.956) (-554.601) -- 0:00:46
231500 -- (-557.926) (-555.212) [-556.550] (-554.378) * [-554.461] (-555.547) (-554.235) (-555.387) -- 0:00:46
232000 -- (-554.068) (-553.567) [-556.772] (-554.166) * [-555.387] (-559.763) (-555.089) (-554.087) -- 0:00:46
232500 -- (-553.917) (-555.108) (-556.329) [-554.651] * (-558.853) [-553.823] (-557.982) (-554.429) -- 0:00:46
233000 -- (-553.078) (-555.768) (-556.986) [-554.159] * (-556.369) (-553.857) (-555.445) [-554.996] -- 0:00:46
233500 -- [-554.007] (-555.455) (-556.017) (-553.643) * (-553.379) [-558.447] (-555.070) (-554.061) -- 0:00:45
234000 -- (-559.411) [-554.861] (-558.522) (-555.408) * (-557.971) (-563.517) (-555.962) [-555.136] -- 0:00:45
234500 -- (-552.919) [-555.256] (-553.765) (-554.993) * (-554.089) (-555.423) (-554.375) [-556.955] -- 0:00:45
235000 -- [-554.198] (-554.393) (-556.396) (-554.253) * (-555.325) (-554.754) [-556.470] (-553.102) -- 0:00:45
Average standard deviation of split frequencies: 0.019975
235500 -- [-553.012] (-554.893) (-556.289) (-557.652) * (-562.937) [-558.139] (-558.130) (-553.437) -- 0:00:45
236000 -- (-555.281) (-558.474) [-554.012] (-555.906) * (-559.788) (-558.262) [-555.303] (-558.255) -- 0:00:45
236500 -- (-553.429) (-554.091) [-554.279] (-556.661) * [-556.203] (-555.345) (-553.725) (-555.363) -- 0:00:45
237000 -- (-555.769) [-555.227] (-554.578) (-553.444) * (-553.636) (-555.023) [-554.162] (-555.810) -- 0:00:45
237500 -- (-553.582) (-562.400) [-552.943] (-554.847) * (-553.708) [-554.763] (-566.499) (-555.005) -- 0:00:44
238000 -- (-557.258) [-554.127] (-553.981) (-555.752) * [-553.390] (-556.988) (-559.905) (-557.528) -- 0:00:44
238500 -- (-554.840) (-555.900) (-553.750) [-554.038] * (-554.918) (-554.520) [-556.118] (-557.573) -- 0:00:44
239000 -- (-561.901) [-555.667] (-553.969) (-555.590) * (-555.162) [-553.724] (-558.946) (-555.063) -- 0:00:44
239500 -- [-553.847] (-554.092) (-554.889) (-558.245) * (-554.581) (-558.439) [-555.114] (-557.934) -- 0:00:44
240000 -- (-556.100) (-555.169) (-558.064) [-556.121] * (-554.583) (-553.341) (-554.613) [-556.175] -- 0:00:44
Average standard deviation of split frequencies: 0.020721
240500 -- (-553.227) (-554.481) [-558.544] (-557.285) * (-554.857) (-555.781) [-557.308] (-563.719) -- 0:00:44
241000 -- (-553.542) (-555.193) (-555.146) [-555.775] * (-558.043) (-556.702) [-557.612] (-558.011) -- 0:00:44
241500 -- (-555.843) (-557.274) [-555.980] (-555.564) * (-555.015) (-554.474) (-556.414) [-554.065] -- 0:00:43
242000 -- (-553.490) (-554.533) [-554.599] (-554.266) * (-552.728) (-557.563) (-554.077) [-564.500] -- 0:00:43
242500 -- [-553.125] (-558.881) (-553.361) (-556.459) * (-553.379) [-554.653] (-554.307) (-556.030) -- 0:00:43
243000 -- (-562.084) [-553.335] (-555.615) (-557.987) * (-555.455) (-556.703) [-553.739] (-558.130) -- 0:00:43
243500 -- (-555.471) (-553.992) [-552.949] (-554.481) * [-554.586] (-558.922) (-555.243) (-552.826) -- 0:00:43
244000 -- (-554.199) (-554.314) (-555.414) [-553.785] * (-553.480) (-554.291) (-554.740) [-552.673] -- 0:00:43
244500 -- (-553.603) (-554.028) (-552.987) [-554.083] * (-558.994) [-553.687] (-555.616) (-553.589) -- 0:00:43
245000 -- (-557.721) [-554.942] (-553.053) (-555.616) * [-553.436] (-553.240) (-555.235) (-554.184) -- 0:00:43
Average standard deviation of split frequencies: 0.019929
245500 -- [-557.521] (-555.654) (-555.796) (-555.420) * (-553.899) (-554.074) [-554.732] (-553.691) -- 0:00:46
246000 -- (-557.858) (-555.855) [-557.472] (-554.391) * (-557.854) (-553.319) (-558.057) [-555.324] -- 0:00:45
246500 -- (-554.111) (-554.024) [-554.883] (-555.783) * (-555.712) (-553.609) [-555.155] (-554.667) -- 0:00:45
247000 -- [-556.530] (-559.520) (-556.462) (-558.415) * (-555.476) [-554.817] (-553.623) (-555.836) -- 0:00:45
247500 -- (-553.454) [-555.767] (-556.079) (-555.999) * (-554.698) [-553.293] (-554.006) (-558.035) -- 0:00:45
248000 -- [-554.257] (-554.894) (-555.927) (-554.647) * (-558.967) (-556.562) [-555.450] (-558.791) -- 0:00:45
248500 -- (-557.805) (-554.895) [-552.823] (-554.261) * (-553.941) (-554.890) [-553.676] (-557.295) -- 0:00:45
249000 -- (-557.533) (-553.273) [-558.130] (-555.636) * (-553.686) (-554.024) [-554.076] (-559.509) -- 0:00:45
249500 -- (-554.392) (-553.584) (-558.871) [-553.503] * (-553.621) [-553.445] (-558.992) (-553.791) -- 0:00:45
250000 -- (-553.427) [-556.790] (-553.477) (-553.138) * [-553.619] (-553.834) (-554.005) (-559.527) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-554.009) (-554.979) [-553.103] (-553.663) * (-554.812) (-554.677) (-557.026) [-554.286] -- 0:00:44
251000 -- (-554.175) (-559.155) (-554.547) [-554.900] * (-555.821) [-554.855] (-557.510) (-553.833) -- 0:00:44
251500 -- [-555.305] (-557.464) (-561.483) (-554.383) * (-555.359) (-553.859) (-554.053) [-558.473] -- 0:00:44
252000 -- (-554.701) (-560.822) (-556.312) [-553.203] * [-555.386] (-555.765) (-553.252) (-554.827) -- 0:00:44
252500 -- (-552.801) (-553.943) [-555.362] (-555.735) * (-555.418) [-555.585] (-553.498) (-554.832) -- 0:00:44
253000 -- (-557.066) [-554.009] (-559.436) (-561.343) * (-556.085) [-554.622] (-552.911) (-554.513) -- 0:00:44
253500 -- [-553.647] (-554.111) (-556.310) (-556.374) * (-553.834) (-554.835) (-554.941) [-556.072] -- 0:00:44
254000 -- (-555.490) (-552.953) (-554.543) [-553.608] * (-554.550) (-554.503) (-559.775) [-559.098] -- 0:00:44
254500 -- (-555.944) [-553.915] (-558.445) (-554.667) * (-554.062) [-555.212] (-556.112) (-556.342) -- 0:00:43
255000 -- (-559.237) (-559.971) [-553.759] (-553.597) * (-558.118) (-554.729) [-557.700] (-553.803) -- 0:00:43
Average standard deviation of split frequencies: 0.018926
255500 -- (-558.548) (-553.474) [-555.163] (-554.682) * (-557.484) [-553.740] (-557.920) (-558.149) -- 0:00:43
256000 -- (-553.390) [-553.741] (-554.631) (-554.423) * [-555.665] (-555.869) (-555.229) (-554.217) -- 0:00:43
256500 -- (-559.224) (-554.566) [-557.050] (-554.605) * [-556.786] (-552.771) (-556.260) (-554.575) -- 0:00:43
257000 -- [-557.233] (-554.293) (-558.253) (-555.576) * (-556.588) (-553.310) [-555.586] (-555.513) -- 0:00:43
257500 -- (-556.054) [-555.141] (-554.145) (-555.176) * (-556.684) (-552.835) [-553.324] (-557.073) -- 0:00:43
258000 -- (-555.609) (-554.186) [-553.415] (-555.507) * (-554.989) (-556.809) (-557.284) [-553.311] -- 0:00:43
258500 -- (-557.170) [-556.983] (-554.669) (-554.712) * (-553.536) [-554.800] (-556.215) (-553.339) -- 0:00:43
259000 -- (-560.610) (-557.327) (-555.639) [-556.833] * [-554.956] (-558.027) (-552.841) (-556.343) -- 0:00:42
259500 -- [-558.212] (-558.972) (-555.704) (-554.524) * [-555.570] (-555.847) (-553.488) (-561.692) -- 0:00:42
260000 -- (-562.324) (-560.894) [-556.247] (-554.814) * [-555.757] (-553.554) (-553.372) (-555.558) -- 0:00:42
Average standard deviation of split frequencies: 0.018687
260500 -- (-555.339) (-556.776) (-558.288) [-558.402] * (-554.848) [-555.346] (-552.689) (-557.136) -- 0:00:42
261000 -- (-553.316) (-555.069) [-557.766] (-559.234) * [-553.967] (-555.196) (-552.791) (-560.531) -- 0:00:42
261500 -- (-556.720) [-554.397] (-554.450) (-556.586) * (-554.470) [-555.163] (-555.811) (-553.935) -- 0:00:42
262000 -- (-554.249) (-553.724) (-553.422) [-557.062] * (-556.348) (-554.166) [-555.280] (-556.374) -- 0:00:42
262500 -- (-553.228) (-553.777) [-554.187] (-554.815) * [-554.294] (-554.568) (-557.342) (-555.772) -- 0:00:44
263000 -- [-553.977] (-555.489) (-556.696) (-554.719) * [-554.743] (-554.330) (-555.231) (-557.083) -- 0:00:44
263500 -- (-554.387) [-555.086] (-555.782) (-553.986) * (-555.742) [-553.925] (-557.998) (-555.547) -- 0:00:44
264000 -- (-553.823) (-555.815) [-553.457] (-555.247) * (-555.586) (-553.686) (-555.101) [-554.227] -- 0:00:44
264500 -- (-556.867) [-552.853] (-558.027) (-555.235) * [-553.731] (-554.154) (-558.243) (-556.927) -- 0:00:44
265000 -- (-556.079) [-555.932] (-555.424) (-554.640) * (-556.010) (-554.116) (-554.214) [-555.286] -- 0:00:44
Average standard deviation of split frequencies: 0.018375
265500 -- (-555.597) (-556.690) [-554.862] (-555.109) * [-553.397] (-553.198) (-558.636) (-557.389) -- 0:00:44
266000 -- [-553.245] (-555.021) (-554.029) (-555.081) * (-553.446) (-553.005) [-554.238] (-555.350) -- 0:00:44
266500 -- (-560.582) (-553.985) [-555.170] (-556.568) * [-555.152] (-552.746) (-555.593) (-554.269) -- 0:00:44
267000 -- (-554.176) [-553.729] (-553.708) (-555.008) * (-554.882) [-554.887] (-554.588) (-553.134) -- 0:00:43
267500 -- (-557.477) (-555.482) (-554.392) [-554.679] * (-553.903) [-556.498] (-553.691) (-554.109) -- 0:00:43
268000 -- (-557.164) [-553.995] (-557.707) (-553.519) * (-555.400) (-556.921) (-556.095) [-556.932] -- 0:00:43
268500 -- (-557.100) (-556.187) (-556.952) [-554.561] * (-553.643) (-556.067) [-554.549] (-555.944) -- 0:00:43
269000 -- (-555.449) (-554.020) (-554.689) [-556.076] * [-553.637] (-556.543) (-555.360) (-555.095) -- 0:00:43
269500 -- (-555.818) (-553.835) [-554.922] (-555.158) * (-553.925) (-553.393) (-554.499) [-556.528] -- 0:00:43
270000 -- (-553.048) (-555.048) (-554.493) [-556.583] * (-553.566) (-553.243) (-554.474) [-554.283] -- 0:00:43
Average standard deviation of split frequencies: 0.016739
270500 -- (-556.586) [-553.509] (-558.008) (-553.681) * (-554.894) (-554.680) [-554.946] (-554.822) -- 0:00:43
271000 -- (-553.071) (-558.396) (-555.783) [-555.833] * (-553.540) (-554.097) (-553.943) [-558.151] -- 0:00:43
271500 -- [-553.359] (-559.076) (-557.192) (-555.402) * [-553.542] (-556.127) (-553.831) (-557.132) -- 0:00:42
272000 -- (-555.910) (-554.213) (-555.169) [-554.661] * (-553.743) (-554.335) [-555.682] (-554.229) -- 0:00:42
272500 -- (-558.678) [-554.741] (-557.858) (-553.567) * (-554.858) [-559.567] (-554.073) (-555.933) -- 0:00:42
273000 -- (-554.379) [-555.888] (-555.805) (-555.450) * (-556.401) (-555.749) (-553.629) [-553.845] -- 0:00:42
273500 -- (-559.149) (-556.185) [-554.171] (-558.757) * (-555.929) (-556.816) (-554.071) [-554.454] -- 0:00:42
274000 -- [-553.761] (-553.670) (-554.084) (-558.882) * [-556.356] (-554.379) (-557.445) (-552.928) -- 0:00:42
274500 -- (-554.702) (-555.112) [-554.378] (-560.974) * [-556.816] (-554.375) (-558.208) (-554.396) -- 0:00:42
275000 -- (-554.685) (-556.228) [-553.640] (-554.876) * (-558.201) [-553.300] (-557.093) (-558.976) -- 0:00:42
Average standard deviation of split frequencies: 0.015874
275500 -- (-559.660) (-554.701) [-554.996] (-553.522) * (-555.349) [-557.293] (-554.213) (-560.553) -- 0:00:42
276000 -- [-553.382] (-553.661) (-554.750) (-555.954) * [-555.394] (-552.921) (-554.917) (-559.044) -- 0:00:41
276500 -- (-555.866) (-553.145) (-554.111) [-554.542] * (-557.318) (-553.438) (-561.619) [-556.708] -- 0:00:41
277000 -- (-554.903) [-556.705] (-553.633) (-554.909) * (-554.774) (-553.285) [-556.487] (-555.284) -- 0:00:41
277500 -- [-555.174] (-554.745) (-554.915) (-558.380) * [-554.630] (-554.220) (-555.235) (-554.578) -- 0:00:41
278000 -- [-554.332] (-555.086) (-556.813) (-555.425) * (-558.887) (-553.251) [-552.796] (-556.823) -- 0:00:41
278500 -- (-557.233) (-554.004) (-555.529) [-559.135] * (-560.915) [-554.856] (-555.970) (-554.465) -- 0:00:41
279000 -- [-553.347] (-554.499) (-555.169) (-555.579) * (-556.548) (-558.348) [-555.175] (-559.657) -- 0:00:41
279500 -- (-555.362) [-553.940] (-554.589) (-553.329) * (-554.798) (-555.818) [-555.571] (-559.095) -- 0:00:43
280000 -- (-554.715) (-553.736) (-558.051) [-555.214] * [-555.758] (-553.633) (-553.139) (-555.928) -- 0:00:43
Average standard deviation of split frequencies: 0.015396
280500 -- (-553.458) (-553.057) [-553.584] (-560.980) * (-554.468) (-553.585) (-552.912) [-560.479] -- 0:00:43
281000 -- (-555.182) (-558.577) (-553.737) [-556.562] * (-553.245) [-554.187] (-556.141) (-558.425) -- 0:00:43
281500 -- (-555.468) [-553.920] (-554.874) (-554.544) * (-554.978) (-555.133) (-556.372) [-556.337] -- 0:00:43
282000 -- (-557.959) (-556.497) [-556.251] (-553.277) * (-554.855) (-554.090) [-555.918] (-555.580) -- 0:00:43
282500 -- (-558.263) [-557.610] (-555.484) (-554.418) * (-555.666) (-553.944) [-555.021] (-557.228) -- 0:00:43
283000 -- (-555.475) [-553.242] (-556.882) (-556.229) * [-554.010] (-555.128) (-555.038) (-560.304) -- 0:00:43
283500 -- [-555.404] (-554.792) (-554.813) (-554.166) * (-553.657) (-555.460) [-553.529] (-555.955) -- 0:00:42
284000 -- (-559.348) (-555.396) (-556.497) [-553.221] * [-554.809] (-556.673) (-554.349) (-557.349) -- 0:00:42
284500 -- (-557.420) [-556.048] (-553.180) (-555.833) * (-555.558) (-556.198) [-554.167] (-553.529) -- 0:00:42
285000 -- (-560.374) [-561.670] (-553.941) (-553.781) * (-556.653) (-557.120) [-553.758] (-561.401) -- 0:00:42
Average standard deviation of split frequencies: 0.014285
285500 -- [-555.519] (-561.777) (-553.535) (-554.587) * (-555.481) (-555.489) [-555.068] (-553.391) -- 0:00:42
286000 -- (-558.978) (-555.152) [-556.667] (-556.069) * (-553.633) [-554.843] (-554.048) (-555.850) -- 0:00:42
286500 -- (-553.044) [-556.409] (-555.450) (-557.906) * (-556.589) (-553.416) (-554.857) [-556.151] -- 0:00:42
287000 -- (-554.156) [-556.786] (-554.765) (-556.781) * [-555.115] (-553.297) (-556.081) (-556.264) -- 0:00:42
287500 -- (-554.086) (-555.012) [-555.303] (-553.849) * (-556.369) (-554.619) (-556.089) [-554.770] -- 0:00:42
288000 -- (-556.182) [-554.045] (-552.671) (-553.026) * (-554.552) (-554.291) [-555.137] (-555.191) -- 0:00:42
288500 -- (-557.782) (-557.646) (-553.552) [-553.349] * [-553.386] (-552.906) (-555.215) (-555.479) -- 0:00:41
289000 -- (-557.718) (-553.646) (-552.938) [-554.056] * [-555.848] (-552.910) (-553.703) (-553.573) -- 0:00:41
289500 -- (-561.778) (-553.662) [-556.016] (-555.787) * (-555.499) (-553.057) (-553.484) [-555.087] -- 0:00:41
290000 -- (-554.492) (-558.333) [-554.195] (-555.461) * [-554.120] (-555.469) (-554.778) (-554.656) -- 0:00:41
Average standard deviation of split frequencies: 0.015741
290500 -- [-555.449] (-554.880) (-556.473) (-554.244) * [-556.227] (-558.828) (-553.174) (-554.508) -- 0:00:41
291000 -- [-553.830] (-557.723) (-557.507) (-557.476) * [-561.445] (-557.148) (-554.632) (-556.121) -- 0:00:41
291500 -- (-552.941) (-555.038) [-556.079] (-554.395) * [-557.015] (-556.826) (-553.684) (-556.464) -- 0:00:41
292000 -- (-555.264) (-553.897) (-554.241) [-556.175] * (-554.099) (-555.846) (-555.076) [-555.309] -- 0:00:41
292500 -- (-555.312) (-554.872) [-553.281] (-552.856) * (-554.220) (-553.129) (-555.391) [-555.080] -- 0:00:41
293000 -- (-561.852) (-556.591) [-554.037] (-557.008) * [-556.599] (-555.397) (-556.146) (-553.950) -- 0:00:41
293500 -- (-556.059) [-553.093] (-557.362) (-553.873) * (-555.191) [-556.553] (-554.167) (-555.827) -- 0:00:40
294000 -- (-557.627) [-553.632] (-556.299) (-553.462) * (-553.413) (-553.812) (-555.297) [-554.777] -- 0:00:40
294500 -- (-557.261) [-553.904] (-554.683) (-556.970) * (-555.758) (-555.745) [-557.117] (-555.548) -- 0:00:40
295000 -- [-559.246] (-553.518) (-555.201) (-559.267) * (-559.835) (-558.663) (-553.762) [-555.939] -- 0:00:40
Average standard deviation of split frequencies: 0.015645
295500 -- (-561.991) (-552.617) [-557.579] (-555.410) * (-558.274) [-557.619] (-553.440) (-555.005) -- 0:00:40
296000 -- (-555.273) (-561.347) (-556.671) [-553.492] * (-556.691) (-560.265) [-553.334] (-554.995) -- 0:00:42
296500 -- (-554.757) (-554.663) (-556.890) [-554.406] * (-556.055) (-557.454) [-553.298] (-555.532) -- 0:00:42
297000 -- (-554.081) [-555.748] (-553.916) (-552.882) * (-558.445) (-553.299) (-555.322) [-554.531] -- 0:00:42
297500 -- (-558.455) (-553.828) (-554.219) [-553.418] * (-558.630) (-552.832) [-555.909] (-556.284) -- 0:00:42
298000 -- (-556.475) (-561.592) [-557.147] (-556.103) * (-554.109) [-553.129] (-562.870) (-557.013) -- 0:00:42
298500 -- (-552.791) [-558.464] (-558.038) (-555.118) * (-554.390) (-553.701) [-557.426] (-553.017) -- 0:00:42
299000 -- (-553.940) (-553.555) (-553.201) [-555.135] * (-556.160) (-555.486) (-555.661) [-554.014] -- 0:00:42
299500 -- (-556.293) (-554.970) (-553.980) [-554.827] * (-558.482) [-556.049] (-557.158) (-553.846) -- 0:00:42
300000 -- (-557.077) [-555.281] (-554.138) (-555.333) * (-558.500) (-554.533) [-554.126] (-554.319) -- 0:00:42
Average standard deviation of split frequencies: 0.016785
300500 -- (-563.780) [-554.838] (-553.014) (-560.422) * (-556.077) [-556.092] (-556.116) (-553.917) -- 0:00:41
301000 -- (-561.008) (-557.791) [-554.719] (-553.828) * (-556.414) (-553.811) [-557.709] (-553.458) -- 0:00:41
301500 -- (-558.468) (-554.658) [-555.850] (-554.428) * [-554.524] (-555.477) (-554.621) (-555.518) -- 0:00:41
302000 -- (-558.540) (-554.237) [-554.814] (-554.220) * (-553.168) [-554.322] (-554.330) (-554.083) -- 0:00:41
302500 -- (-556.884) (-557.821) (-558.469) [-554.294] * [-555.503] (-556.226) (-556.746) (-554.495) -- 0:00:41
303000 -- (-555.815) (-554.439) (-556.522) [-553.244] * (-559.493) (-554.963) [-553.805] (-554.178) -- 0:00:41
303500 -- (-553.358) [-553.859] (-556.832) (-554.119) * [-554.573] (-555.304) (-555.854) (-555.520) -- 0:00:41
304000 -- [-554.529] (-555.827) (-554.802) (-554.300) * [-557.671] (-554.351) (-554.625) (-556.052) -- 0:00:41
304500 -- (-555.188) (-556.861) (-556.762) [-554.468] * [-555.127] (-556.738) (-555.291) (-557.970) -- 0:00:41
305000 -- [-553.424] (-553.755) (-554.845) (-561.932) * (-553.979) [-556.271] (-559.607) (-555.252) -- 0:00:41
Average standard deviation of split frequencies: 0.016312
305500 -- (-557.030) (-555.337) (-555.054) [-558.387] * (-555.630) (-556.014) [-557.885] (-555.683) -- 0:00:40
306000 -- (-555.462) (-555.144) (-554.861) [-553.650] * (-558.604) [-555.204] (-553.466) (-554.548) -- 0:00:40
306500 -- (-560.210) [-553.620] (-554.950) (-554.521) * [-556.181] (-553.544) (-554.228) (-554.894) -- 0:00:40
307000 -- (-556.641) (-554.562) (-557.262) [-555.799] * (-558.810) (-554.019) (-555.596) [-557.940] -- 0:00:40
307500 -- [-555.060] (-553.079) (-556.194) (-555.859) * (-553.243) (-553.264) [-555.632] (-552.963) -- 0:00:40
308000 -- (-554.730) (-554.364) [-553.064] (-553.953) * [-555.438] (-555.082) (-558.201) (-556.147) -- 0:00:40
308500 -- (-554.395) (-554.502) [-553.831] (-553.700) * (-556.710) [-556.222] (-556.295) (-556.732) -- 0:00:40
309000 -- (-557.325) [-554.442] (-553.342) (-555.374) * [-554.750] (-553.482) (-558.122) (-554.835) -- 0:00:40
309500 -- [-556.373] (-554.551) (-552.807) (-552.791) * (-556.191) (-554.706) (-554.313) [-554.778] -- 0:00:40
310000 -- (-558.513) (-555.066) [-553.026] (-554.131) * [-553.150] (-556.880) (-556.625) (-552.960) -- 0:00:40
Average standard deviation of split frequencies: 0.015620
310500 -- (-556.018) (-560.442) [-552.896] (-553.375) * (-555.443) (-559.480) [-553.638] (-554.674) -- 0:00:39
311000 -- (-557.057) [-555.345] (-553.924) (-554.322) * (-553.299) (-555.592) [-557.579] (-555.381) -- 0:00:39
311500 -- [-554.041] (-554.330) (-560.050) (-556.104) * (-554.069) (-555.502) (-557.659) [-554.767] -- 0:00:39
312000 -- [-554.260] (-555.155) (-555.479) (-556.887) * [-556.665] (-553.039) (-553.308) (-554.617) -- 0:00:39
312500 -- (-558.303) (-554.041) [-554.431] (-554.235) * (-554.548) [-557.062] (-553.990) (-558.997) -- 0:00:39
313000 -- (-556.410) (-557.393) (-553.302) [-553.922] * (-554.061) [-554.487] (-554.600) (-557.103) -- 0:00:41
313500 -- (-558.415) (-553.885) (-554.246) [-554.364] * (-557.000) (-556.193) [-556.649] (-553.822) -- 0:00:41
314000 -- (-557.078) (-554.842) (-554.063) [-553.961] * (-553.275) (-554.715) [-553.874] (-553.925) -- 0:00:41
314500 -- [-556.586] (-556.380) (-553.447) (-555.143) * (-554.401) [-554.953] (-557.329) (-554.571) -- 0:00:41
315000 -- (-552.894) (-555.793) (-554.739) [-555.117] * (-554.168) [-554.513] (-554.555) (-554.626) -- 0:00:41
Average standard deviation of split frequencies: 0.015757
315500 -- (-554.649) [-557.136] (-556.573) (-558.311) * (-554.875) (-554.098) [-553.901] (-555.348) -- 0:00:41
316000 -- [-554.326] (-555.847) (-554.662) (-558.706) * (-554.799) [-554.102] (-555.299) (-560.242) -- 0:00:41
316500 -- [-553.104] (-555.817) (-556.475) (-553.846) * (-556.206) (-553.940) [-557.095] (-556.475) -- 0:00:41
317000 -- [-556.788] (-554.232) (-555.266) (-558.335) * (-554.799) [-557.148] (-554.769) (-556.744) -- 0:00:40
317500 -- [-556.174] (-559.649) (-555.167) (-557.135) * (-556.123) (-553.241) [-553.839] (-555.372) -- 0:00:40
318000 -- (-554.501) [-554.151] (-554.189) (-555.650) * (-554.885) (-554.929) (-553.573) [-553.619] -- 0:00:40
318500 -- (-553.473) (-556.515) (-559.205) [-553.255] * (-559.032) (-556.344) [-554.391] (-553.606) -- 0:00:40
319000 -- (-553.421) (-558.205) [-558.193] (-555.701) * (-557.634) (-554.321) [-554.693] (-559.021) -- 0:00:40
319500 -- (-557.715) (-553.767) (-555.269) [-553.691] * (-556.067) (-553.995) [-553.705] (-555.857) -- 0:00:40
320000 -- [-554.967] (-554.827) (-556.728) (-555.211) * [-556.108] (-553.311) (-555.189) (-555.509) -- 0:00:40
Average standard deviation of split frequencies: 0.016690
320500 -- [-553.608] (-554.569) (-556.347) (-556.395) * [-553.604] (-553.341) (-562.333) (-554.626) -- 0:00:40
321000 -- (-556.851) [-557.445] (-553.396) (-556.473) * (-553.963) (-554.462) [-562.405] (-555.576) -- 0:00:40
321500 -- (-556.242) (-556.322) (-554.292) [-557.824] * [-555.625] (-556.554) (-556.238) (-553.229) -- 0:00:40
322000 -- (-553.301) (-555.374) [-556.760] (-559.933) * (-562.442) (-555.288) [-554.133] (-552.896) -- 0:00:40
322500 -- (-553.775) (-554.952) (-555.331) [-555.081] * (-556.924) (-556.805) [-558.496] (-562.258) -- 0:00:39
323000 -- (-552.779) (-557.680) [-567.349] (-557.670) * [-553.050] (-557.233) (-556.228) (-555.578) -- 0:00:39
323500 -- (-553.343) [-552.888] (-556.052) (-556.601) * (-553.839) (-553.708) [-556.583] (-554.799) -- 0:00:39
324000 -- [-554.867] (-557.136) (-557.880) (-554.828) * (-556.101) (-554.118) (-554.892) [-557.547] -- 0:00:39
324500 -- [-554.845] (-557.151) (-555.608) (-559.941) * (-553.853) (-554.617) (-554.270) [-555.841] -- 0:00:39
325000 -- (-556.674) (-556.973) (-554.594) [-561.990] * (-557.889) [-553.772] (-556.211) (-556.385) -- 0:00:39
Average standard deviation of split frequencies: 0.015145
325500 -- (-553.751) (-553.966) (-554.462) [-559.635] * (-554.098) (-553.924) [-554.180] (-559.228) -- 0:00:39
326000 -- (-556.233) (-555.813) [-557.752] (-562.545) * (-554.190) (-557.606) [-555.372] (-554.688) -- 0:00:39
326500 -- (-553.817) [-556.001] (-554.352) (-553.547) * (-553.494) [-559.412] (-553.595) (-556.512) -- 0:00:39
327000 -- (-554.422) (-554.714) [-555.692] (-554.570) * (-553.758) [-555.112] (-554.005) (-554.449) -- 0:00:39
327500 -- [-555.585] (-555.719) (-556.095) (-555.189) * (-553.839) (-553.699) [-554.637] (-554.401) -- 0:00:39
328000 -- (-553.883) (-556.410) [-553.582] (-554.068) * (-554.781) [-555.262] (-555.019) (-554.595) -- 0:00:38
328500 -- (-558.344) (-557.145) (-553.943) [-552.713] * (-554.781) (-555.371) [-555.067] (-556.301) -- 0:00:38
329000 -- [-555.224] (-556.348) (-554.952) (-554.422) * (-555.092) (-555.003) (-553.585) [-554.320] -- 0:00:38
329500 -- (-556.329) (-554.327) (-554.854) [-553.178] * (-558.520) (-555.001) [-555.117] (-556.982) -- 0:00:38
330000 -- (-555.723) (-554.531) [-553.558] (-554.820) * (-556.256) (-552.882) [-553.783] (-552.746) -- 0:00:38
Average standard deviation of split frequencies: 0.015682
330500 -- (-554.701) (-555.867) [-557.307] (-553.885) * (-556.719) (-554.373) (-558.181) [-553.877] -- 0:00:40
331000 -- (-553.696) [-554.124] (-554.280) (-554.593) * (-557.295) [-557.780] (-554.465) (-553.982) -- 0:00:40
331500 -- (-559.804) (-553.591) (-554.390) [-556.252] * (-554.410) (-555.223) (-554.757) [-554.022] -- 0:00:40
332000 -- (-555.895) [-555.262] (-554.991) (-555.127) * (-555.869) [-555.784] (-553.310) (-557.628) -- 0:00:40
332500 -- (-555.728) (-554.938) [-552.933] (-557.117) * (-553.401) [-554.098] (-555.305) (-554.421) -- 0:00:40
333000 -- (-555.636) (-555.017) (-552.873) [-555.443] * (-561.337) (-554.266) [-553.282] (-554.885) -- 0:00:40
333500 -- (-553.755) (-554.027) [-552.826] (-553.630) * (-559.834) (-557.932) (-553.208) [-553.536] -- 0:00:39
334000 -- (-560.168) (-556.716) (-553.962) [-554.850] * (-559.246) (-557.086) (-560.398) [-553.054] -- 0:00:39
334500 -- [-557.363] (-554.140) (-555.954) (-557.439) * (-554.975) [-557.651] (-556.410) (-562.416) -- 0:00:39
335000 -- (-556.153) (-554.267) [-556.104] (-559.311) * (-555.085) [-553.891] (-554.139) (-555.660) -- 0:00:39
Average standard deviation of split frequencies: 0.015680
335500 -- (-554.920) [-554.430] (-557.750) (-557.629) * (-556.413) (-558.457) (-556.347) [-554.629] -- 0:00:39
336000 -- (-558.447) (-553.591) (-559.874) [-555.374] * (-553.855) (-554.931) [-554.175] (-553.764) -- 0:00:39
336500 -- [-552.917] (-553.943) (-555.932) (-555.355) * (-557.699) (-555.523) [-553.237] (-554.896) -- 0:00:39
337000 -- (-555.833) (-556.076) (-552.875) [-554.005] * [-553.598] (-553.755) (-554.161) (-555.694) -- 0:00:39
337500 -- [-556.201] (-557.494) (-553.936) (-554.594) * (-554.931) [-552.921] (-558.207) (-554.228) -- 0:00:39
338000 -- [-554.214] (-558.427) (-554.488) (-554.320) * (-555.594) (-552.942) (-553.286) [-553.839] -- 0:00:39
338500 -- (-556.487) (-556.390) [-556.803] (-553.260) * (-556.837) (-554.423) [-556.082] (-554.956) -- 0:00:39
339000 -- (-553.660) (-554.669) (-556.235) [-554.455] * [-554.282] (-553.181) (-556.936) (-556.128) -- 0:00:38
339500 -- (-553.716) (-553.493) (-556.481) [-554.232] * [-557.379] (-555.991) (-555.059) (-553.550) -- 0:00:38
340000 -- (-555.026) [-555.275] (-554.800) (-557.830) * (-555.404) [-555.080] (-553.043) (-553.486) -- 0:00:38
Average standard deviation of split frequencies: 0.015384
340500 -- (-554.413) [-556.656] (-553.402) (-556.372) * (-557.056) [-555.295] (-556.125) (-564.138) -- 0:00:38
341000 -- (-557.112) (-557.162) [-555.035] (-555.671) * [-554.164] (-555.638) (-555.669) (-555.627) -- 0:00:38
341500 -- (-557.552) (-555.722) (-553.859) [-556.323] * (-556.901) (-553.913) (-554.720) [-558.607] -- 0:00:38
342000 -- (-553.655) (-555.881) (-558.308) [-555.076] * (-556.708) (-556.706) (-554.779) [-554.668] -- 0:00:38
342500 -- (-554.715) (-554.294) [-558.397] (-558.712) * (-555.366) [-556.703] (-554.818) (-559.987) -- 0:00:38
343000 -- (-556.028) (-554.466) [-553.327] (-554.998) * (-553.173) [-556.632] (-554.170) (-556.113) -- 0:00:38
343500 -- (-555.148) (-555.814) [-554.491] (-556.280) * [-553.015] (-554.871) (-556.599) (-553.737) -- 0:00:38
344000 -- [-555.667] (-559.333) (-555.839) (-553.780) * (-558.237) (-553.828) [-554.228] (-555.343) -- 0:00:38
344500 -- (-557.414) (-553.944) [-553.171] (-555.529) * [-562.501] (-554.131) (-554.811) (-556.469) -- 0:00:38
345000 -- (-557.097) (-555.502) (-554.030) [-553.124] * (-554.672) (-555.465) [-554.245] (-557.779) -- 0:00:37
Average standard deviation of split frequencies: 0.015468
345500 -- [-555.322] (-553.659) (-553.869) (-554.489) * (-555.234) (-557.657) (-554.642) [-554.269] -- 0:00:37
346000 -- (-554.950) (-554.174) (-561.236) [-553.959] * (-559.880) (-554.752) [-556.666] (-553.378) -- 0:00:37
346500 -- (-556.184) (-553.473) [-556.058] (-556.904) * (-555.982) [-552.911] (-556.439) (-554.396) -- 0:00:37
347000 -- (-553.386) (-552.926) (-553.467) [-554.488] * (-554.821) (-552.832) [-555.004] (-556.136) -- 0:00:39
347500 -- (-558.608) (-554.929) (-554.024) [-556.211] * (-554.427) (-554.390) (-554.130) [-555.015] -- 0:00:39
348000 -- (-554.337) (-553.088) (-556.673) [-553.147] * [-554.488] (-554.682) (-557.316) (-552.822) -- 0:00:39
348500 -- (-556.975) (-554.781) [-553.504] (-554.230) * [-556.206] (-557.598) (-558.624) (-553.726) -- 0:00:39
349000 -- (-555.627) [-553.750] (-554.835) (-554.485) * [-555.339] (-555.688) (-559.024) (-557.791) -- 0:00:39
349500 -- (-557.998) (-556.231) [-554.370] (-552.995) * (-553.483) (-556.484) (-554.289) [-554.618] -- 0:00:39
350000 -- [-555.059] (-560.266) (-560.527) (-554.637) * (-556.878) (-554.758) (-553.976) [-556.908] -- 0:00:39
Average standard deviation of split frequencies: 0.015104
350500 -- (-554.178) (-557.021) [-553.982] (-554.968) * (-556.981) [-554.671] (-554.265) (-558.535) -- 0:00:38
351000 -- [-556.911] (-558.119) (-553.247) (-555.495) * (-554.765) (-555.353) (-553.970) [-557.148] -- 0:00:38
351500 -- (-553.881) (-558.487) [-553.689] (-554.719) * (-553.589) (-555.916) [-557.695] (-554.182) -- 0:00:38
352000 -- (-553.908) [-555.740] (-555.286) (-553.191) * (-553.350) (-555.108) [-554.705] (-555.742) -- 0:00:38
352500 -- (-552.651) [-552.712] (-554.182) (-553.952) * [-554.453] (-554.087) (-554.580) (-555.468) -- 0:00:38
353000 -- (-555.596) [-554.304] (-553.909) (-554.879) * (-555.760) [-556.136] (-553.929) (-556.809) -- 0:00:38
353500 -- (-555.086) (-560.013) (-553.868) [-555.464] * [-555.820] (-554.620) (-554.353) (-556.628) -- 0:00:38
354000 -- (-557.124) [-554.242] (-553.734) (-553.455) * [-558.136] (-555.842) (-553.153) (-558.778) -- 0:00:38
354500 -- (-555.039) (-556.160) [-556.282] (-554.844) * (-554.444) (-555.227) [-553.792] (-557.136) -- 0:00:38
355000 -- [-555.330] (-554.654) (-556.681) (-555.193) * [-555.586] (-554.986) (-556.981) (-553.573) -- 0:00:38
Average standard deviation of split frequencies: 0.013943
355500 -- [-553.996] (-554.140) (-555.738) (-553.926) * (-556.893) (-555.269) [-555.199] (-553.926) -- 0:00:38
356000 -- (-556.439) [-556.908] (-554.992) (-558.382) * (-559.785) (-554.908) [-553.852] (-555.517) -- 0:00:37
356500 -- (-557.031) [-554.557] (-557.332) (-553.259) * (-558.956) [-561.519] (-554.586) (-554.566) -- 0:00:37
357000 -- (-556.826) (-554.076) [-553.508] (-556.158) * (-561.819) (-554.388) (-554.249) [-555.969] -- 0:00:37
357500 -- (-553.845) [-553.909] (-557.316) (-552.831) * (-553.925) [-553.423] (-555.327) (-555.178) -- 0:00:37
358000 -- (-555.534) (-556.245) (-558.493) [-553.710] * [-558.057] (-556.972) (-560.033) (-555.433) -- 0:00:37
358500 -- (-556.412) (-553.894) (-557.105) [-554.415] * [-556.777] (-555.371) (-555.537) (-559.449) -- 0:00:37
359000 -- [-554.462] (-555.414) (-554.306) (-553.909) * [-553.903] (-558.025) (-554.054) (-556.505) -- 0:00:37
359500 -- (-556.871) (-554.956) [-555.798] (-555.729) * [-556.996] (-565.728) (-557.123) (-555.081) -- 0:00:37
360000 -- [-553.819] (-555.084) (-556.384) (-557.643) * (-554.742) (-562.330) (-554.349) [-556.441] -- 0:00:37
Average standard deviation of split frequencies: 0.014704
360500 -- (-553.535) [-555.638] (-553.933) (-554.182) * (-554.728) (-554.331) [-555.787] (-557.566) -- 0:00:37
361000 -- (-554.451) (-555.825) (-553.153) [-554.718] * (-554.193) (-554.135) (-556.030) [-557.731] -- 0:00:37
361500 -- (-554.321) (-556.978) (-553.489) [-554.864] * (-554.749) (-553.787) (-553.400) [-554.798] -- 0:00:37
362000 -- (-556.473) (-559.008) [-555.262] (-554.974) * (-554.107) [-554.841] (-552.669) (-559.639) -- 0:00:37
362500 -- (-559.806) (-557.307) (-555.235) [-556.168] * [-553.659] (-557.292) (-557.919) (-554.444) -- 0:00:36
363000 -- (-555.680) (-556.497) (-555.635) [-553.704] * (-556.489) (-555.913) [-553.871] (-553.633) -- 0:00:36
363500 -- (-555.969) [-554.292] (-554.786) (-556.965) * (-555.956) (-552.998) (-557.229) [-554.171] -- 0:00:36
364000 -- (-557.249) (-553.455) [-554.262] (-552.832) * (-555.722) (-555.507) [-554.031] (-554.830) -- 0:00:38
364500 -- (-555.495) (-556.228) [-553.866] (-554.514) * (-561.983) [-553.734] (-554.745) (-553.582) -- 0:00:38
365000 -- (-553.228) (-556.910) [-555.060] (-557.366) * (-556.178) (-554.927) (-556.119) [-555.250] -- 0:00:38
Average standard deviation of split frequencies: 0.014892
365500 -- (-556.356) (-554.857) [-556.078] (-554.163) * (-558.309) [-555.161] (-556.948) (-554.653) -- 0:00:38
366000 -- (-553.098) [-555.927] (-556.175) (-555.261) * [-554.105] (-553.216) (-558.667) (-553.371) -- 0:00:38
366500 -- (-554.862) [-553.321] (-556.480) (-558.542) * (-553.759) (-553.086) (-555.944) [-555.063] -- 0:00:38
367000 -- (-554.098) (-555.582) [-557.900] (-554.493) * [-561.111] (-557.682) (-554.678) (-562.325) -- 0:00:37
367500 -- (-555.024) (-553.953) (-553.541) [-556.717] * [-554.302] (-555.739) (-557.598) (-554.190) -- 0:00:37
368000 -- (-554.321) [-554.180] (-557.413) (-553.485) * (-555.567) [-555.349] (-553.495) (-555.351) -- 0:00:37
368500 -- [-554.017] (-554.320) (-556.908) (-554.475) * [-555.736] (-557.414) (-553.711) (-555.713) -- 0:00:37
369000 -- [-556.890] (-556.271) (-555.108) (-553.827) * (-553.948) (-555.616) [-553.143] (-554.758) -- 0:00:37
369500 -- (-557.494) (-554.814) [-553.664] (-553.365) * (-554.340) (-555.439) [-554.689] (-557.640) -- 0:00:37
370000 -- [-556.842] (-555.160) (-555.677) (-554.060) * [-557.786] (-555.620) (-557.359) (-554.348) -- 0:00:37
Average standard deviation of split frequencies: 0.014513
370500 -- (-553.303) (-555.690) [-556.321] (-553.751) * (-554.009) [-554.168] (-556.034) (-555.240) -- 0:00:37
371000 -- (-553.094) [-554.069] (-560.042) (-555.376) * [-553.551] (-556.093) (-553.744) (-554.254) -- 0:00:37
371500 -- (-554.952) [-558.812] (-556.562) (-553.275) * [-554.222] (-554.387) (-555.016) (-555.145) -- 0:00:37
372000 -- [-555.136] (-555.298) (-555.296) (-554.872) * [-553.729] (-556.076) (-557.946) (-555.286) -- 0:00:37
372500 -- (-553.970) [-556.351] (-557.477) (-557.548) * [-552.786] (-554.431) (-553.791) (-556.679) -- 0:00:37
373000 -- (-553.260) [-554.189] (-553.801) (-555.252) * [-554.886] (-553.623) (-557.914) (-554.463) -- 0:00:36
373500 -- [-553.513] (-553.977) (-554.468) (-556.146) * (-554.139) (-556.289) [-555.080] (-554.321) -- 0:00:36
374000 -- (-557.182) (-555.949) (-555.930) [-556.444] * (-554.862) [-553.192] (-555.462) (-554.856) -- 0:00:36
374500 -- (-556.335) (-553.345) [-553.334] (-556.621) * (-556.298) (-554.206) [-554.942] (-557.109) -- 0:00:36
375000 -- (-558.083) (-554.237) (-557.440) [-555.461] * (-554.877) (-560.397) (-554.122) [-554.592] -- 0:00:36
Average standard deviation of split frequencies: 0.015561
375500 -- (-556.091) (-554.462) [-555.769] (-553.016) * [-559.826] (-556.074) (-558.734) (-554.954) -- 0:00:36
376000 -- (-555.450) (-556.057) (-558.511) [-553.400] * (-557.833) (-558.424) [-561.366] (-554.326) -- 0:00:36
376500 -- [-554.978] (-555.805) (-560.336) (-553.884) * (-555.346) (-558.158) [-560.038] (-553.847) -- 0:00:36
377000 -- (-554.025) (-553.560) (-557.576) [-553.957] * (-553.455) (-560.625) [-553.220] (-554.301) -- 0:00:36
377500 -- (-554.502) [-555.931] (-557.239) (-554.544) * [-553.514] (-555.887) (-553.760) (-554.357) -- 0:00:36
378000 -- [-556.056] (-553.346) (-559.959) (-554.363) * (-555.745) (-554.846) (-558.435) [-556.974] -- 0:00:36
378500 -- (-558.877) [-553.943] (-555.104) (-554.162) * (-553.744) [-553.825] (-553.705) (-556.503) -- 0:00:36
379000 -- [-556.697] (-558.870) (-559.396) (-553.862) * (-557.314) (-555.713) (-554.734) [-557.440] -- 0:00:36
379500 -- (-555.139) (-554.402) (-560.189) [-553.934] * [-554.124] (-555.688) (-553.663) (-553.761) -- 0:00:35
380000 -- [-553.628] (-553.555) (-556.548) (-554.588) * (-554.551) [-553.762] (-555.365) (-557.506) -- 0:00:35
Average standard deviation of split frequencies: 0.015516
380500 -- (-554.346) (-553.838) [-554.533] (-554.055) * (-555.248) [-553.063] (-556.517) (-553.654) -- 0:00:35
381000 -- (-557.365) (-556.684) (-554.831) [-555.471] * (-559.748) [-553.012] (-554.640) (-556.047) -- 0:00:37
381500 -- (-557.538) [-553.417] (-554.365) (-558.402) * (-556.943) [-554.922] (-556.407) (-556.073) -- 0:00:37
382000 -- (-555.236) (-552.862) [-556.966] (-556.634) * (-552.684) [-555.092] (-558.985) (-558.318) -- 0:00:37
382500 -- (-555.989) (-553.490) (-559.372) [-554.078] * (-554.407) [-555.957] (-553.488) (-555.967) -- 0:00:37
383000 -- (-555.048) [-552.792] (-556.781) (-554.310) * (-554.535) (-554.680) [-554.143] (-555.111) -- 0:00:37
383500 -- (-555.038) (-552.731) [-557.034] (-553.383) * (-560.057) (-554.228) [-554.005] (-553.521) -- 0:00:36
384000 -- (-555.808) [-552.985] (-556.524) (-555.708) * (-553.358) [-558.294] (-553.475) (-553.634) -- 0:00:36
384500 -- (-554.840) [-552.582] (-555.636) (-556.909) * (-555.507) (-555.675) (-554.330) [-557.529] -- 0:00:36
385000 -- (-556.924) (-553.227) [-553.616] (-553.893) * (-555.088) (-553.245) (-555.128) [-556.184] -- 0:00:36
Average standard deviation of split frequencies: 0.016020
385500 -- (-556.793) (-554.585) (-555.531) [-554.440] * (-554.664) (-554.661) (-555.661) [-554.340] -- 0:00:36
386000 -- (-555.075) (-556.615) (-555.376) [-554.258] * [-553.538] (-553.422) (-555.615) (-554.991) -- 0:00:36
386500 -- (-553.202) [-554.096] (-554.992) (-556.335) * (-554.315) (-556.762) [-553.677] (-553.854) -- 0:00:36
387000 -- [-556.143] (-558.475) (-553.326) (-556.288) * (-557.394) [-554.062] (-560.951) (-554.140) -- 0:00:36
387500 -- (-556.394) (-558.525) [-555.632] (-555.207) * [-553.905] (-557.476) (-572.017) (-556.499) -- 0:00:36
388000 -- [-553.242] (-554.010) (-556.823) (-555.548) * (-555.731) (-553.556) (-553.857) [-555.392] -- 0:00:36
388500 -- (-554.576) (-556.503) (-558.542) [-557.123] * (-558.102) (-557.313) [-553.107] (-555.239) -- 0:00:36
389000 -- [-555.681] (-553.112) (-556.855) (-559.217) * [-556.145] (-553.459) (-557.699) (-554.243) -- 0:00:36
389500 -- (-553.784) [-553.347] (-560.407) (-554.923) * (-554.781) [-553.938] (-555.164) (-555.197) -- 0:00:36
390000 -- [-555.850] (-553.696) (-554.142) (-552.778) * (-555.376) (-553.910) [-558.017] (-555.624) -- 0:00:35
Average standard deviation of split frequencies: 0.016692
390500 -- (-555.772) (-556.256) [-556.293] (-553.317) * (-554.439) (-553.931) (-553.985) [-553.524] -- 0:00:35
391000 -- (-554.824) (-554.247) [-555.779] (-553.160) * (-553.639) (-555.159) [-556.200] (-553.212) -- 0:00:35
391500 -- (-556.530) (-554.699) [-556.920] (-553.812) * [-554.769] (-556.747) (-553.884) (-554.537) -- 0:00:35
392000 -- [-554.333] (-555.438) (-555.320) (-556.803) * (-554.253) (-556.491) (-554.112) [-553.831] -- 0:00:35
392500 -- (-554.394) [-554.170] (-556.520) (-554.438) * (-554.763) (-553.290) (-555.265) [-553.152] -- 0:00:35
393000 -- (-554.002) [-553.604] (-552.836) (-554.041) * (-555.813) (-555.828) (-555.216) [-554.824] -- 0:00:35
393500 -- (-554.195) (-560.667) (-553.178) [-554.321] * (-553.908) (-553.730) [-556.632] (-555.719) -- 0:00:35
394000 -- [-554.180] (-554.088) (-553.336) (-553.542) * (-556.345) [-553.440] (-556.025) (-554.406) -- 0:00:35
394500 -- (-554.693) (-555.720) (-555.385) [-553.563] * [-554.134] (-555.129) (-558.305) (-553.543) -- 0:00:35
395000 -- (-555.259) (-555.137) [-555.484] (-553.496) * (-553.425) [-555.186] (-554.605) (-554.182) -- 0:00:35
Average standard deviation of split frequencies: 0.016467
395500 -- (-555.436) (-555.033) (-555.012) [-554.425] * (-554.395) (-554.097) [-554.247] (-554.433) -- 0:00:35
396000 -- (-554.517) [-555.398] (-554.308) (-553.560) * (-555.468) (-553.899) (-554.081) [-554.860] -- 0:00:35
396500 -- (-553.579) (-555.461) (-563.160) [-560.421] * [-555.425] (-553.789) (-556.782) (-556.956) -- 0:00:35
397000 -- [-554.305] (-553.556) (-557.296) (-555.927) * (-554.970) [-554.154] (-555.002) (-554.758) -- 0:00:34
397500 -- (-556.428) [-553.555] (-556.518) (-556.102) * [-554.718] (-554.343) (-558.971) (-558.329) -- 0:00:34
398000 -- [-554.721] (-557.618) (-556.273) (-555.522) * (-557.423) [-555.403] (-555.707) (-554.841) -- 0:00:36
398500 -- (-554.994) [-553.665] (-558.188) (-558.371) * (-555.509) [-554.676] (-560.479) (-553.793) -- 0:00:36
399000 -- (-556.310) [-553.253] (-556.554) (-555.850) * (-553.801) (-557.042) (-554.346) [-554.612] -- 0:00:36
399500 -- (-556.978) (-553.602) [-554.953] (-554.657) * (-561.158) (-555.161) [-553.740] (-554.707) -- 0:00:36
400000 -- (-553.480) [-553.966] (-554.732) (-556.450) * [-557.768] (-555.857) (-554.718) (-557.345) -- 0:00:36
Average standard deviation of split frequencies: 0.015491
400500 -- [-558.654] (-554.531) (-554.419) (-555.721) * (-562.208) (-553.515) [-558.299] (-559.273) -- 0:00:35
401000 -- (-556.934) [-554.682] (-553.192) (-553.588) * [-558.392] (-555.952) (-556.065) (-559.737) -- 0:00:35
401500 -- (-554.580) [-553.018] (-555.991) (-558.110) * [-555.907] (-553.198) (-556.541) (-558.039) -- 0:00:35
402000 -- [-553.699] (-557.709) (-553.949) (-558.857) * (-558.240) [-555.238] (-556.136) (-553.946) -- 0:00:35
402500 -- (-554.198) [-556.160] (-557.083) (-555.884) * [-559.155] (-555.695) (-555.028) (-555.470) -- 0:00:35
403000 -- (-557.194) (-554.553) (-553.904) [-554.998] * (-557.761) (-554.590) (-553.762) [-555.165] -- 0:00:35
403500 -- (-554.039) (-556.049) [-553.950] (-556.304) * (-562.763) (-556.550) (-552.791) [-557.846] -- 0:00:35
404000 -- (-556.479) (-558.394) [-553.558] (-555.230) * (-565.127) (-554.999) (-554.663) [-553.679] -- 0:00:35
404500 -- [-553.225] (-554.224) (-554.027) (-557.396) * [-557.356] (-553.936) (-553.456) (-557.915) -- 0:00:35
405000 -- [-552.623] (-554.854) (-553.785) (-555.544) * [-555.009] (-553.869) (-553.731) (-558.247) -- 0:00:35
Average standard deviation of split frequencies: 0.014965
405500 -- (-552.608) (-554.675) [-555.303] (-555.669) * (-558.815) (-555.644) [-557.458] (-557.249) -- 0:00:35
406000 -- (-554.171) (-555.955) [-555.061] (-553.998) * (-554.733) (-556.960) (-555.290) [-555.647] -- 0:00:35
406500 -- (-554.209) (-553.979) (-556.172) [-554.823] * (-555.134) [-555.909] (-555.657) (-556.417) -- 0:00:35
407000 -- (-553.498) (-553.816) [-553.699] (-555.096) * [-557.368] (-554.871) (-558.144) (-557.936) -- 0:00:34
407500 -- (-555.067) (-554.924) [-554.350] (-559.103) * (-558.376) [-554.373] (-561.057) (-554.189) -- 0:00:34
408000 -- (-555.879) (-556.510) (-557.260) [-554.342] * (-552.952) (-554.704) (-557.246) [-555.564] -- 0:00:34
408500 -- [-554.493] (-555.161) (-554.499) (-559.051) * (-554.293) [-554.707] (-558.843) (-553.819) -- 0:00:34
409000 -- (-555.211) (-555.153) [-555.595] (-553.698) * (-554.837) (-556.080) (-554.891) [-555.049] -- 0:00:34
409500 -- [-558.996] (-555.444) (-555.395) (-555.986) * (-558.567) [-555.891] (-555.808) (-555.653) -- 0:00:34
410000 -- (-558.199) (-555.133) (-555.590) [-556.276] * (-554.701) (-553.438) (-553.667) [-556.480] -- 0:00:34
Average standard deviation of split frequencies: 0.014986
410500 -- (-554.034) [-556.685] (-555.388) (-555.755) * (-554.068) (-552.746) [-555.753] (-560.132) -- 0:00:34
411000 -- (-556.853) (-556.767) (-560.172) [-557.827] * (-556.717) [-553.047] (-556.149) (-556.100) -- 0:00:34
411500 -- [-556.293] (-553.687) (-555.312) (-556.640) * (-554.747) (-554.795) (-554.655) [-554.293] -- 0:00:34
412000 -- [-553.163] (-554.707) (-555.442) (-554.442) * (-556.653) [-555.157] (-554.948) (-554.356) -- 0:00:34
412500 -- [-555.225] (-554.250) (-554.123) (-555.437) * (-554.971) (-555.222) (-563.801) [-558.004] -- 0:00:34
413000 -- (-558.158) (-553.851) (-554.250) [-553.599] * (-556.428) (-558.870) (-557.098) [-560.321] -- 0:00:34
413500 -- (-557.527) (-554.842) (-553.504) [-553.666] * (-555.241) [-556.741] (-554.496) (-555.680) -- 0:00:34
414000 -- (-553.921) [-557.517] (-553.029) (-555.755) * [-555.507] (-555.154) (-556.779) (-557.151) -- 0:00:33
414500 -- [-553.214] (-558.052) (-557.060) (-556.659) * (-554.349) (-554.205) [-555.359] (-556.096) -- 0:00:33
415000 -- (-555.056) (-553.436) [-559.354] (-553.727) * (-555.737) (-554.606) [-553.470] (-556.147) -- 0:00:35
Average standard deviation of split frequencies: 0.014598
415500 -- [-554.834] (-553.700) (-559.350) (-553.641) * (-555.632) (-559.708) (-555.112) [-553.713] -- 0:00:35
416000 -- (-556.635) (-555.231) (-556.317) [-554.205] * (-556.955) (-559.518) (-555.371) [-555.099] -- 0:00:35
416500 -- (-556.280) [-554.660] (-562.212) (-553.926) * [-554.222] (-554.158) (-553.008) (-555.577) -- 0:00:35
417000 -- (-556.764) (-554.020) [-555.570] (-553.813) * (-556.227) [-553.634] (-552.848) (-553.114) -- 0:00:34
417500 -- (-553.469) (-553.962) (-557.279) [-555.116] * (-554.926) [-553.499] (-554.117) (-553.597) -- 0:00:34
418000 -- [-557.555] (-556.512) (-553.828) (-554.126) * [-555.811] (-554.610) (-554.211) (-553.949) -- 0:00:34
418500 -- (-554.274) (-554.671) [-553.473] (-553.905) * [-555.617] (-557.983) (-554.472) (-553.370) -- 0:00:34
419000 -- (-556.419) [-554.138] (-554.376) (-554.758) * [-553.731] (-555.933) (-553.246) (-557.074) -- 0:00:34
419500 -- [-557.809] (-553.204) (-553.411) (-553.586) * (-555.616) (-556.006) [-553.770] (-556.896) -- 0:00:34
420000 -- (-556.483) [-553.204] (-555.044) (-554.244) * (-555.670) (-555.305) (-557.063) [-556.126] -- 0:00:34
Average standard deviation of split frequencies: 0.014436
420500 -- (-554.388) (-559.452) [-553.685] (-553.266) * [-554.227] (-558.362) (-556.882) (-556.320) -- 0:00:34
421000 -- (-555.481) (-554.246) [-555.760] (-553.466) * (-554.886) [-558.242] (-555.724) (-555.820) -- 0:00:34
421500 -- (-555.003) [-555.413] (-554.514) (-554.634) * [-554.880] (-553.774) (-555.703) (-553.861) -- 0:00:34
422000 -- (-555.040) (-553.775) [-554.505] (-559.139) * [-552.994] (-562.356) (-557.611) (-553.265) -- 0:00:34
422500 -- [-554.770] (-553.809) (-556.690) (-553.026) * [-555.752] (-553.765) (-554.092) (-553.481) -- 0:00:34
423000 -- (-553.495) [-557.202] (-556.666) (-554.266) * [-556.631] (-555.075) (-554.041) (-556.765) -- 0:00:34
423500 -- (-560.066) (-558.007) [-553.881] (-553.753) * (-556.508) (-555.588) (-558.737) [-556.461] -- 0:00:34
424000 -- (-555.969) [-554.564] (-554.117) (-557.593) * (-554.456) (-559.828) [-554.870] (-555.620) -- 0:00:33
424500 -- [-556.254] (-555.438) (-561.767) (-559.904) * (-553.641) (-560.596) (-559.299) [-553.927] -- 0:00:33
425000 -- [-555.008] (-555.264) (-553.515) (-558.458) * [-556.408] (-556.621) (-557.531) (-552.664) -- 0:00:33
Average standard deviation of split frequencies: 0.013709
425500 -- (-554.616) (-555.906) [-555.439] (-558.621) * (-557.905) [-558.159] (-559.148) (-556.217) -- 0:00:33
426000 -- (-553.690) (-554.301) [-555.616] (-555.703) * (-555.660) (-554.759) (-554.562) [-554.109] -- 0:00:33
426500 -- (-554.483) (-554.503) [-554.213] (-556.916) * (-555.004) [-554.478] (-556.076) (-555.172) -- 0:00:33
427000 -- (-554.661) (-553.932) [-553.307] (-556.060) * [-558.575] (-554.165) (-558.791) (-555.650) -- 0:00:33
427500 -- (-553.472) [-554.685] (-557.349) (-556.029) * (-554.854) (-557.984) (-557.447) [-553.516] -- 0:00:33
428000 -- (-554.138) [-554.283] (-554.296) (-556.657) * (-553.770) (-557.485) (-556.579) [-554.190] -- 0:00:33
428500 -- (-553.581) (-555.030) [-556.046] (-556.788) * (-555.786) (-553.567) (-555.154) [-554.976] -- 0:00:33
429000 -- (-553.862) [-554.488] (-558.503) (-555.188) * (-556.490) (-553.350) (-554.476) [-555.652] -- 0:00:33
429500 -- [-555.464] (-555.375) (-553.530) (-555.781) * (-553.865) [-557.434] (-553.873) (-557.997) -- 0:00:33
430000 -- [-556.541] (-556.149) (-554.645) (-552.633) * (-554.884) (-555.146) [-556.044] (-555.639) -- 0:00:33
Average standard deviation of split frequencies: 0.012892
430500 -- (-553.926) (-555.454) [-554.190] (-552.613) * (-555.254) [-554.944] (-554.239) (-555.877) -- 0:00:33
431000 -- (-557.900) (-559.347) [-554.629] (-558.767) * [-555.813] (-553.574) (-554.325) (-555.505) -- 0:00:33
431500 -- (-557.124) (-556.231) [-556.356] (-553.234) * (-556.475) [-553.851] (-558.024) (-556.397) -- 0:00:32
432000 -- (-559.671) (-554.660) (-554.897) [-553.227] * (-554.605) (-554.121) (-556.397) [-555.553] -- 0:00:34
432500 -- (-552.866) (-554.053) [-556.148] (-554.603) * (-553.799) [-555.983] (-553.931) (-555.226) -- 0:00:34
433000 -- [-553.728] (-553.534) (-555.101) (-552.962) * (-555.052) (-555.639) [-552.960] (-554.628) -- 0:00:34
433500 -- [-554.971] (-556.527) (-553.179) (-553.842) * (-555.979) (-558.886) (-554.680) [-553.815] -- 0:00:33
434000 -- (-553.994) [-556.762] (-557.035) (-559.457) * (-556.147) [-553.805] (-553.886) (-553.966) -- 0:00:33
434500 -- (-553.799) [-554.987] (-554.737) (-556.075) * (-556.294) (-552.857) (-556.633) [-555.760] -- 0:00:33
435000 -- (-556.243) (-554.745) (-555.262) [-552.893] * (-555.000) [-554.194] (-555.852) (-556.021) -- 0:00:33
Average standard deviation of split frequencies: 0.013095
435500 -- (-555.720) (-555.264) [-556.069] (-557.065) * [-554.857] (-555.430) (-554.384) (-560.650) -- 0:00:33
436000 -- (-561.093) (-555.526) [-553.926] (-556.918) * (-555.437) (-555.839) [-554.295] (-556.600) -- 0:00:33
436500 -- (-557.829) [-554.575] (-556.118) (-554.484) * (-556.599) (-556.854) [-553.456] (-554.589) -- 0:00:33
437000 -- (-554.214) [-554.819] (-554.463) (-554.650) * (-563.869) [-553.833] (-553.477) (-554.834) -- 0:00:33
437500 -- [-555.578] (-557.543) (-556.315) (-557.708) * (-553.669) [-556.775] (-553.993) (-556.537) -- 0:00:33
438000 -- (-556.020) (-554.478) (-554.956) [-555.566] * (-558.054) [-554.455] (-555.063) (-557.310) -- 0:00:33
438500 -- [-555.857] (-556.883) (-557.523) (-556.222) * (-555.935) (-554.366) [-554.424] (-557.358) -- 0:00:33
439000 -- [-555.123] (-557.910) (-557.059) (-553.510) * (-554.548) [-554.757] (-554.285) (-557.489) -- 0:00:33
439500 -- [-552.919] (-553.223) (-554.787) (-555.111) * (-554.546) (-553.939) (-554.049) [-557.163] -- 0:00:33
440000 -- (-553.139) (-553.631) (-556.438) [-554.808] * [-555.483] (-553.673) (-555.215) (-554.658) -- 0:00:33
Average standard deviation of split frequencies: 0.012774
440500 -- (-553.844) (-554.586) (-556.637) [-558.083] * [-554.652] (-554.526) (-553.922) (-557.280) -- 0:00:33
441000 -- (-553.481) (-554.798) (-554.269) [-558.032] * [-554.475] (-555.673) (-553.543) (-555.707) -- 0:00:32
441500 -- (-555.359) (-554.738) (-555.647) [-555.250] * (-553.292) [-554.621] (-556.460) (-555.929) -- 0:00:32
442000 -- (-555.046) [-557.195] (-553.094) (-553.631) * (-554.744) (-558.750) (-557.622) [-556.081] -- 0:00:32
442500 -- [-555.256] (-553.559) (-555.637) (-554.419) * [-555.883] (-554.959) (-554.205) (-555.920) -- 0:00:32
443000 -- (-555.997) (-557.042) [-556.186] (-553.476) * (-554.809) [-555.426] (-556.522) (-555.252) -- 0:00:32
443500 -- [-554.760] (-555.799) (-554.462) (-555.020) * [-554.562] (-555.265) (-556.710) (-556.223) -- 0:00:32
444000 -- (-556.935) (-553.847) [-553.026] (-553.196) * [-553.055] (-558.062) (-553.698) (-555.830) -- 0:00:32
444500 -- (-556.603) [-554.260] (-554.331) (-553.325) * [-553.097] (-556.285) (-556.129) (-555.128) -- 0:00:32
445000 -- (-555.307) (-553.703) (-554.307) [-553.038] * (-560.870) [-557.803] (-555.941) (-557.063) -- 0:00:32
Average standard deviation of split frequencies: 0.013329
445500 -- [-555.116] (-553.991) (-554.226) (-556.446) * [-557.438] (-556.967) (-557.372) (-554.704) -- 0:00:32
446000 -- (-554.853) (-553.099) (-555.285) [-555.741] * (-554.350) [-555.341] (-555.681) (-554.067) -- 0:00:32
446500 -- (-557.819) (-553.565) [-555.170] (-553.771) * (-558.207) (-561.706) (-554.543) [-560.099] -- 0:00:32
447000 -- [-557.615] (-553.666) (-556.551) (-555.383) * (-556.728) [-554.388] (-557.423) (-559.834) -- 0:00:32
447500 -- (-555.121) [-554.591] (-555.582) (-552.716) * [-555.029] (-556.678) (-556.420) (-559.676) -- 0:00:32
448000 -- [-556.039] (-553.261) (-558.222) (-559.855) * [-554.360] (-554.269) (-555.437) (-558.090) -- 0:00:32
448500 -- (-558.852) (-554.567) (-555.512) [-554.347] * (-555.546) [-553.933] (-560.980) (-556.052) -- 0:00:31
449000 -- (-556.445) (-555.659) (-554.593) [-555.421] * (-554.144) (-555.047) [-556.151] (-553.623) -- 0:00:33
449500 -- [-553.384] (-553.911) (-554.605) (-553.782) * (-557.166) (-556.633) [-554.473] (-553.076) -- 0:00:33
450000 -- (-555.206) (-554.006) [-555.192] (-558.136) * (-556.354) (-554.314) (-555.455) [-553.076] -- 0:00:33
Average standard deviation of split frequencies: 0.012552
450500 -- [-557.299] (-558.318) (-555.736) (-555.846) * (-557.929) (-557.634) (-554.899) [-553.075] -- 0:00:32
451000 -- [-556.728] (-557.998) (-553.594) (-555.337) * (-554.567) (-556.340) [-555.924] (-555.262) -- 0:00:32
451500 -- [-557.698] (-555.258) (-555.489) (-556.121) * (-555.846) (-560.120) [-557.517] (-553.239) -- 0:00:32
452000 -- (-554.423) (-554.434) [-554.603] (-554.570) * (-554.673) (-554.626) [-554.581] (-554.040) -- 0:00:32
452500 -- (-555.188) (-555.758) [-555.771] (-555.383) * (-554.368) (-552.936) [-554.004] (-554.029) -- 0:00:32
453000 -- [-554.874] (-558.183) (-553.331) (-554.329) * (-556.309) [-553.729] (-554.004) (-556.057) -- 0:00:32
453500 -- (-555.609) (-555.190) [-557.303] (-557.317) * (-556.175) (-555.629) (-556.227) [-554.298] -- 0:00:32
454000 -- (-554.205) (-556.788) (-554.106) [-559.618] * (-559.952) (-553.974) (-555.870) [-554.903] -- 0:00:32
454500 -- (-554.157) (-554.919) [-554.611] (-557.302) * (-560.414) (-553.681) [-554.875] (-554.874) -- 0:00:32
455000 -- (-555.505) (-554.022) [-557.000] (-557.604) * [-554.121] (-554.749) (-553.446) (-558.642) -- 0:00:32
Average standard deviation of split frequencies: 0.011759
455500 -- [-553.395] (-554.173) (-553.853) (-555.404) * (-553.654) (-557.164) (-553.531) [-556.361] -- 0:00:32
456000 -- (-554.033) (-553.754) [-553.773] (-554.198) * (-554.540) (-554.251) (-558.351) [-556.028] -- 0:00:32
456500 -- [-554.381] (-554.060) (-552.954) (-553.386) * [-553.004] (-552.772) (-556.273) (-554.247) -- 0:00:32
457000 -- (-554.768) [-554.060] (-555.953) (-554.213) * (-555.337) [-553.181] (-553.837) (-561.134) -- 0:00:32
457500 -- (-554.795) (-554.870) [-553.618] (-553.569) * [-554.592] (-554.321) (-555.710) (-559.142) -- 0:00:32
458000 -- [-554.567] (-552.954) (-559.008) (-553.657) * (-558.547) (-553.700) [-559.339] (-553.350) -- 0:00:31
458500 -- (-553.459) (-558.626) [-561.018] (-555.572) * (-558.484) (-554.021) [-558.332] (-553.639) -- 0:00:31
459000 -- (-556.683) (-555.063) [-555.881] (-562.287) * (-554.781) (-556.994) [-555.597] (-553.659) -- 0:00:31
459500 -- (-554.073) [-557.390] (-553.629) (-557.982) * (-556.270) (-554.402) (-554.471) [-555.776] -- 0:00:31
460000 -- (-554.827) (-554.541) [-554.448] (-555.001) * [-556.337] (-554.803) (-553.516) (-556.100) -- 0:00:31
Average standard deviation of split frequencies: 0.012024
460500 -- (-557.877) (-554.060) [-553.806] (-558.723) * (-553.213) (-555.292) [-554.089] (-556.421) -- 0:00:31
461000 -- (-555.206) (-556.943) [-555.003] (-553.332) * (-555.043) (-554.507) [-553.646] (-553.655) -- 0:00:31
461500 -- (-554.404) (-559.255) [-556.205] (-556.137) * (-554.772) (-555.179) (-556.155) [-554.928] -- 0:00:31
462000 -- (-553.575) (-555.292) [-555.903] (-559.620) * (-554.516) (-556.343) [-557.444] (-554.704) -- 0:00:31
462500 -- (-553.575) [-554.799] (-553.997) (-555.894) * (-561.176) (-553.556) (-556.423) [-554.665] -- 0:00:31
463000 -- [-556.528] (-554.060) (-555.375) (-557.300) * (-555.488) (-554.319) (-555.300) [-553.713] -- 0:00:31
463500 -- (-555.231) (-555.693) [-553.764] (-554.242) * (-554.653) [-554.567] (-555.501) (-555.584) -- 0:00:31
464000 -- (-557.597) (-557.617) [-553.158] (-553.385) * [-554.037] (-557.391) (-556.650) (-554.376) -- 0:00:31
464500 -- (-558.916) (-555.536) (-555.511) [-554.195] * (-554.202) (-555.413) [-557.395] (-555.494) -- 0:00:31
465000 -- (-557.542) [-555.235] (-553.878) (-554.175) * (-557.249) (-555.166) [-553.789] (-553.392) -- 0:00:31
Average standard deviation of split frequencies: 0.011961
465500 -- (-553.440) (-554.168) [-556.911] (-558.098) * (-556.335) [-556.526] (-553.569) (-552.947) -- 0:00:32
466000 -- (-557.220) (-556.619) (-557.556) [-555.903] * (-555.356) [-554.495] (-553.578) (-554.001) -- 0:00:32
466500 -- [-557.127] (-556.287) (-560.565) (-554.735) * (-554.531) (-554.057) (-558.823) [-558.338] -- 0:00:32
467000 -- (-556.913) (-555.375) (-554.736) [-553.371] * (-554.096) (-553.322) (-556.621) [-554.499] -- 0:00:31
467500 -- [-556.675] (-554.626) (-554.360) (-553.594) * (-556.661) (-555.191) [-554.352] (-554.135) -- 0:00:31
468000 -- (-553.824) [-556.139] (-553.438) (-553.160) * [-554.513] (-553.227) (-554.875) (-558.186) -- 0:00:31
468500 -- (-554.530) (-557.647) (-553.397) [-553.729] * (-556.089) [-556.540] (-554.365) (-556.230) -- 0:00:31
469000 -- (-555.410) (-557.773) (-554.135) [-552.805] * (-555.613) (-553.618) (-557.888) [-554.513] -- 0:00:31
469500 -- (-554.740) (-554.440) (-553.415) [-556.204] * (-555.785) (-553.631) (-553.679) [-553.891] -- 0:00:31
470000 -- (-554.248) (-556.588) [-554.369] (-555.028) * (-556.063) (-559.951) (-555.166) [-553.978] -- 0:00:31
Average standard deviation of split frequencies: 0.012019
470500 -- (-554.700) [-553.715] (-556.001) (-554.746) * (-554.406) [-554.662] (-558.061) (-554.178) -- 0:00:31
471000 -- [-552.933] (-558.412) (-554.421) (-555.280) * (-554.042) (-555.242) (-555.560) [-557.608] -- 0:00:31
471500 -- (-555.769) (-556.551) (-553.230) [-553.682] * (-556.489) [-553.794] (-554.941) (-553.702) -- 0:00:31
472000 -- (-553.825) [-554.153] (-553.993) (-558.108) * (-557.419) (-555.265) [-554.611] (-553.931) -- 0:00:31
472500 -- (-553.813) (-554.635) [-558.484] (-554.922) * (-555.535) (-554.903) (-553.827) [-556.311] -- 0:00:31
473000 -- [-553.830] (-555.734) (-559.950) (-553.002) * (-554.054) [-552.998] (-556.260) (-555.057) -- 0:00:31
473500 -- (-555.192) [-553.918] (-555.866) (-557.024) * [-555.543] (-555.550) (-556.895) (-554.341) -- 0:00:31
474000 -- (-554.787) (-553.413) (-554.308) [-552.979] * (-556.386) (-556.162) (-556.681) [-553.124] -- 0:00:31
474500 -- (-553.623) [-554.530] (-553.274) (-552.978) * (-556.659) (-553.208) [-554.200] (-557.311) -- 0:00:31
475000 -- (-556.791) (-552.909) (-554.435) [-556.007] * (-557.331) [-554.776] (-554.247) (-556.703) -- 0:00:30
Average standard deviation of split frequencies: 0.012256
475500 -- (-554.772) (-553.615) [-553.433] (-557.024) * (-558.026) (-553.741) (-554.810) [-554.148] -- 0:00:30
476000 -- (-552.887) (-556.353) (-554.474) [-554.851] * [-555.096] (-553.775) (-555.053) (-554.397) -- 0:00:30
476500 -- (-554.595) (-553.513) (-553.279) [-555.500] * (-553.923) (-554.939) [-554.253] (-557.083) -- 0:00:30
477000 -- (-554.128) (-554.130) [-555.903] (-553.614) * [-554.351] (-554.138) (-554.314) (-555.962) -- 0:00:30
477500 -- (-552.794) (-552.663) (-553.324) [-554.362] * [-556.905] (-556.060) (-553.196) (-554.250) -- 0:00:30
478000 -- (-553.589) (-556.504) (-553.298) [-554.358] * (-556.759) (-553.772) (-554.397) [-555.588] -- 0:00:30
478500 -- (-557.250) (-558.293) (-557.117) [-557.943] * [-554.805] (-554.230) (-554.201) (-555.276) -- 0:00:30
479000 -- [-555.900] (-554.909) (-555.760) (-559.028) * (-556.308) [-555.960] (-555.467) (-554.643) -- 0:00:30
479500 -- [-555.547] (-557.417) (-553.660) (-553.396) * (-558.204) [-554.205] (-555.260) (-553.876) -- 0:00:30
480000 -- [-554.185] (-555.837) (-553.799) (-555.570) * (-553.531) [-555.170] (-556.369) (-554.440) -- 0:00:30
Average standard deviation of split frequencies: 0.011953
480500 -- [-554.626] (-555.579) (-554.559) (-559.282) * (-556.370) (-557.294) [-559.120] (-555.147) -- 0:00:30
481000 -- [-554.453] (-554.438) (-554.460) (-556.307) * (-554.376) [-555.391] (-558.922) (-554.269) -- 0:00:30
481500 -- (-556.110) [-553.478] (-554.961) (-555.856) * (-560.356) (-557.014) (-557.702) [-553.976] -- 0:00:30
482000 -- [-555.326] (-554.509) (-555.404) (-554.615) * (-567.111) (-555.086) [-554.047] (-553.893) -- 0:00:30
482500 -- [-553.649] (-557.304) (-560.176) (-555.165) * (-561.099) [-555.528] (-554.204) (-555.317) -- 0:00:31
483000 -- [-553.597] (-555.198) (-555.563) (-555.655) * (-557.264) [-556.231] (-553.629) (-553.966) -- 0:00:31
483500 -- (-554.038) (-554.092) [-554.529] (-553.475) * (-557.263) (-555.038) (-563.149) [-554.808] -- 0:00:30
484000 -- (-553.909) (-561.519) [-556.346] (-557.111) * [-556.495] (-555.122) (-558.017) (-556.247) -- 0:00:30
484500 -- (-553.956) (-558.510) [-561.810] (-556.976) * (-554.708) (-556.033) (-554.936) [-557.574] -- 0:00:30
485000 -- [-552.944] (-554.230) (-553.843) (-555.158) * (-554.236) [-553.309] (-553.936) (-555.505) -- 0:00:30
Average standard deviation of split frequencies: 0.012367
485500 -- (-553.501) (-556.428) [-553.877] (-553.121) * (-555.485) [-553.881] (-553.499) (-554.068) -- 0:00:30
486000 -- (-554.575) [-557.615] (-553.670) (-554.199) * [-555.871] (-559.705) (-555.523) (-555.501) -- 0:00:30
486500 -- (-554.797) (-555.562) [-555.536] (-554.690) * [-553.538] (-554.775) (-557.894) (-554.911) -- 0:00:30
487000 -- (-557.182) [-553.082] (-554.308) (-555.860) * (-552.825) (-555.779) [-555.231] (-554.791) -- 0:00:30
487500 -- (-554.683) (-556.878) [-554.156] (-554.823) * (-554.594) (-554.582) [-556.795] (-554.409) -- 0:00:30
488000 -- [-555.242] (-554.577) (-554.787) (-557.957) * [-556.775] (-556.618) (-554.079) (-555.497) -- 0:00:30
488500 -- [-555.121] (-558.369) (-558.398) (-554.931) * [-556.433] (-553.240) (-557.402) (-556.119) -- 0:00:30
489000 -- [-553.735] (-555.571) (-556.336) (-553.790) * (-555.553) (-556.193) (-553.524) [-553.282] -- 0:00:30
489500 -- (-553.447) (-554.704) [-553.632] (-554.761) * (-555.173) [-555.549] (-554.021) (-553.653) -- 0:00:30
490000 -- (-558.652) (-555.290) [-556.060] (-553.738) * [-553.551] (-555.160) (-555.255) (-561.273) -- 0:00:30
Average standard deviation of split frequencies: 0.012310
490500 -- (-560.578) (-555.325) [-557.347] (-553.866) * (-553.341) (-555.574) (-553.898) [-554.630] -- 0:00:30
491000 -- [-554.475] (-558.614) (-553.412) (-554.686) * (-554.148) (-557.649) (-553.180) [-556.765] -- 0:00:30
491500 -- [-554.097] (-557.798) (-555.383) (-554.828) * [-555.095] (-555.259) (-554.426) (-553.817) -- 0:00:30
492000 -- (-553.192) (-557.568) (-555.171) [-554.929] * (-553.972) (-554.455) [-553.713] (-557.001) -- 0:00:29
492500 -- [-556.139] (-555.404) (-556.304) (-555.230) * (-554.746) [-555.338] (-556.325) (-554.194) -- 0:00:29
493000 -- (-555.803) [-557.510] (-554.185) (-555.365) * (-554.675) [-555.222] (-556.510) (-555.840) -- 0:00:29
493500 -- [-553.622] (-552.851) (-556.163) (-553.984) * [-555.124] (-553.625) (-554.899) (-554.436) -- 0:00:29
494000 -- (-553.189) (-553.433) (-556.637) [-556.839] * [-556.090] (-552.911) (-554.647) (-555.263) -- 0:00:29
494500 -- (-554.410) (-555.758) (-553.405) [-556.447] * (-554.420) (-553.810) (-553.097) [-558.226] -- 0:00:29
495000 -- [-553.789] (-559.505) (-554.560) (-556.749) * (-556.576) (-555.202) [-554.230] (-556.248) -- 0:00:29
Average standard deviation of split frequencies: 0.012652
495500 -- (-555.952) [-554.951] (-554.113) (-557.435) * (-557.212) (-560.337) [-552.762] (-555.697) -- 0:00:29
496000 -- (-555.486) [-554.814] (-556.135) (-553.642) * [-555.807] (-554.904) (-553.782) (-556.665) -- 0:00:29
496500 -- [-553.761] (-555.632) (-554.724) (-554.209) * (-553.590) (-559.106) (-552.817) [-557.675] -- 0:00:29
497000 -- [-554.084] (-556.121) (-553.908) (-554.281) * [-553.927] (-557.991) (-553.302) (-554.675) -- 0:00:29
497500 -- [-553.608] (-555.454) (-554.159) (-552.804) * (-555.623) (-555.368) [-553.523] (-555.580) -- 0:00:29
498000 -- (-553.470) (-554.958) (-554.637) [-554.201] * (-553.985) (-555.921) (-558.414) [-554.520] -- 0:00:29
498500 -- (-552.886) (-556.406) (-555.719) [-553.195] * (-553.238) (-555.483) (-556.647) [-553.934] -- 0:00:29
499000 -- [-553.843] (-554.607) (-557.284) (-557.383) * (-553.186) (-555.407) (-559.345) [-555.285] -- 0:00:29
499500 -- (-553.376) [-553.746] (-554.911) (-555.611) * [-556.884] (-554.182) (-554.025) (-556.760) -- 0:00:30
500000 -- (-554.645) (-555.644) (-554.807) [-554.879] * (-553.433) (-553.244) (-558.756) [-556.014] -- 0:00:30
Average standard deviation of split frequencies: 0.012358
500500 -- (-554.426) (-555.264) [-555.410] (-555.095) * (-555.193) (-555.674) (-554.160) [-557.962] -- 0:00:29
501000 -- (-554.818) [-556.372] (-556.999) (-555.998) * (-553.446) (-555.459) (-556.235) [-554.551] -- 0:00:29
501500 -- [-557.538] (-554.254) (-554.152) (-557.375) * [-555.542] (-557.830) (-555.868) (-553.997) -- 0:00:29
502000 -- (-553.884) (-553.982) [-554.120] (-554.352) * [-554.027] (-557.861) (-554.680) (-554.642) -- 0:00:29
502500 -- (-553.742) (-554.518) [-554.110] (-556.536) * (-555.700) [-555.642] (-555.700) (-554.701) -- 0:00:29
503000 -- [-556.306] (-558.425) (-555.617) (-554.628) * [-555.009] (-553.998) (-552.576) (-556.623) -- 0:00:29
503500 -- (-553.140) (-555.969) (-558.037) [-555.062] * (-556.241) [-554.202] (-553.175) (-554.219) -- 0:00:29
504000 -- (-554.254) [-553.761] (-553.538) (-553.024) * (-556.483) [-553.673] (-554.182) (-555.549) -- 0:00:29
504500 -- (-561.244) (-555.304) [-554.327] (-553.121) * (-556.189) (-555.098) [-554.373] (-554.468) -- 0:00:29
505000 -- (-553.483) (-555.130) [-554.320] (-553.989) * (-559.868) [-554.172] (-555.315) (-553.530) -- 0:00:29
Average standard deviation of split frequencies: 0.012473
505500 -- (-554.356) (-553.792) [-554.123] (-554.893) * (-561.103) (-554.085) (-558.628) [-554.784] -- 0:00:29
506000 -- (-556.960) (-556.327) [-555.848] (-553.195) * (-552.885) [-556.608] (-558.057) (-554.427) -- 0:00:29
506500 -- (-553.586) (-554.825) (-553.093) [-554.355] * (-557.766) (-555.426) (-555.896) [-555.690] -- 0:00:29
507000 -- (-554.134) (-556.005) [-552.993] (-555.763) * (-556.419) (-558.013) (-552.994) [-557.351] -- 0:00:29
507500 -- (-553.015) [-555.986] (-553.411) (-554.531) * (-555.559) [-557.762] (-555.025) (-558.161) -- 0:00:29
508000 -- [-554.413] (-553.564) (-554.154) (-553.698) * (-555.996) (-555.089) [-555.991] (-553.670) -- 0:00:29
508500 -- (-557.408) [-553.039] (-554.557) (-556.393) * (-557.922) [-555.603] (-555.963) (-555.565) -- 0:00:28
509000 -- (-556.390) (-553.174) [-555.971] (-557.365) * (-553.420) (-556.458) [-553.609] (-555.241) -- 0:00:28
509500 -- (-554.940) [-556.322] (-555.764) (-554.492) * [-554.115] (-556.039) (-554.331) (-555.388) -- 0:00:28
510000 -- [-554.327] (-557.648) (-556.314) (-560.359) * [-555.565] (-558.754) (-555.144) (-555.534) -- 0:00:28
Average standard deviation of split frequencies: 0.012435
510500 -- (-555.187) [-556.426] (-554.705) (-555.763) * (-552.911) (-554.410) [-553.417] (-555.578) -- 0:00:28
511000 -- [-553.482] (-553.234) (-555.855) (-554.769) * (-553.576) (-556.349) [-555.109] (-555.122) -- 0:00:28
511500 -- [-552.982] (-553.300) (-554.746) (-555.897) * (-553.707) (-554.834) [-554.884] (-554.855) -- 0:00:28
512000 -- (-555.579) (-554.237) [-554.539] (-554.307) * (-553.412) [-555.872] (-557.755) (-552.780) -- 0:00:28
512500 -- (-560.702) (-555.281) [-553.249] (-554.688) * (-552.795) [-554.011] (-553.336) (-554.457) -- 0:00:28
513000 -- (-556.597) [-554.625] (-553.078) (-554.550) * (-557.477) (-553.440) (-556.369) [-554.430] -- 0:00:28
513500 -- (-556.331) [-553.916] (-555.688) (-555.595) * (-554.045) (-555.730) [-555.065] (-556.220) -- 0:00:28
514000 -- [-554.537] (-554.299) (-555.285) (-555.346) * [-553.152] (-557.447) (-558.302) (-555.416) -- 0:00:28
514500 -- (-559.275) [-553.594] (-554.143) (-556.051) * (-559.121) [-556.503] (-554.045) (-554.760) -- 0:00:28
515000 -- (-554.797) [-556.747] (-559.962) (-555.350) * (-554.722) (-555.943) [-555.070] (-553.930) -- 0:00:28
Average standard deviation of split frequencies: 0.012306
515500 -- (-555.507) [-555.121] (-554.784) (-555.400) * (-555.182) (-558.161) [-557.081] (-558.163) -- 0:00:28
516000 -- (-553.473) [-555.428] (-553.825) (-559.223) * (-556.972) [-555.495] (-558.778) (-552.876) -- 0:00:28
516500 -- (-556.094) [-557.891] (-556.800) (-552.939) * (-556.425) [-552.855] (-558.751) (-555.692) -- 0:00:29
517000 -- (-556.332) [-557.950] (-554.771) (-553.609) * (-554.564) [-554.585] (-559.761) (-554.517) -- 0:00:28
517500 -- (-555.009) (-554.502) [-555.855] (-554.752) * (-556.386) (-555.872) (-563.120) [-556.508] -- 0:00:28
518000 -- [-554.514] (-553.664) (-554.808) (-554.604) * (-559.000) [-555.895] (-555.128) (-555.788) -- 0:00:28
518500 -- (-554.185) (-554.258) (-558.582) [-557.287] * (-559.391) (-554.895) (-556.549) [-553.634] -- 0:00:28
519000 -- (-558.287) (-562.388) [-554.605] (-554.340) * (-556.278) (-557.018) (-553.700) [-554.439] -- 0:00:28
519500 -- (-557.966) (-555.734) (-555.023) [-556.449] * (-554.585) (-559.852) (-553.096) [-554.291] -- 0:00:28
520000 -- (-554.269) (-554.518) [-553.734] (-556.523) * (-560.636) [-554.101] (-557.278) (-554.804) -- 0:00:28
Average standard deviation of split frequencies: 0.011504
520500 -- (-554.997) [-554.063] (-553.348) (-554.011) * (-559.902) (-553.690) (-555.983) [-554.495] -- 0:00:28
521000 -- (-556.331) (-553.996) (-552.929) [-554.441] * (-558.545) (-554.384) (-557.003) [-553.534] -- 0:00:28
521500 -- (-557.624) (-553.220) [-556.207] (-554.494) * [-554.125] (-557.389) (-554.179) (-553.152) -- 0:00:28
522000 -- (-554.073) (-553.056) (-553.085) [-555.658] * [-553.925] (-554.231) (-555.337) (-556.782) -- 0:00:28
522500 -- (-554.811) (-553.636) [-553.257] (-561.186) * [-553.741] (-556.046) (-554.094) (-558.231) -- 0:00:28
523000 -- (-555.107) (-555.202) [-554.042] (-553.802) * [-554.774] (-555.343) (-553.745) (-558.192) -- 0:00:28
523500 -- (-553.709) [-554.916] (-556.439) (-556.369) * (-554.254) [-555.526] (-559.224) (-556.024) -- 0:00:28
524000 -- (-553.545) (-554.989) [-557.742] (-555.542) * (-554.354) (-559.793) [-553.497] (-559.950) -- 0:00:28
524500 -- (-554.757) (-556.866) (-554.460) [-557.877] * (-556.713) (-555.125) [-557.767] (-558.115) -- 0:00:28
525000 -- [-555.311] (-559.700) (-553.928) (-556.111) * (-555.962) (-553.858) [-556.227] (-554.846) -- 0:00:28
Average standard deviation of split frequencies: 0.011493
525500 -- (-555.174) (-559.125) [-557.725] (-554.830) * (-552.814) [-553.783] (-558.194) (-556.960) -- 0:00:27
526000 -- (-553.895) [-554.747] (-554.292) (-558.853) * (-554.148) [-555.760] (-554.681) (-557.216) -- 0:00:27
526500 -- (-555.133) (-553.261) (-555.422) [-557.408] * [-553.724] (-556.438) (-555.079) (-555.595) -- 0:00:27
527000 -- [-555.938] (-553.749) (-554.435) (-555.006) * (-556.165) (-552.600) (-555.377) [-555.996] -- 0:00:27
527500 -- (-553.846) (-556.071) (-555.112) [-554.424] * (-555.802) [-555.197] (-554.403) (-555.811) -- 0:00:27
528000 -- (-554.599) (-553.816) [-554.239] (-557.396) * [-553.349] (-554.274) (-554.084) (-553.834) -- 0:00:27
528500 -- [-554.216] (-553.556) (-555.667) (-555.629) * [-553.293] (-553.002) (-558.932) (-554.786) -- 0:00:27
529000 -- (-553.821) [-555.387] (-555.487) (-555.005) * (-554.763) [-556.790] (-556.263) (-557.743) -- 0:00:27
529500 -- [-553.947] (-555.359) (-554.651) (-556.872) * (-555.643) [-555.800] (-555.364) (-556.424) -- 0:00:27
530000 -- (-553.886) (-554.457) (-555.240) [-554.282] * (-555.051) (-556.252) (-555.226) [-555.152] -- 0:00:27
Average standard deviation of split frequencies: 0.011049
530500 -- (-553.317) (-558.050) (-557.164) [-553.386] * (-552.933) [-554.049] (-553.499) (-553.398) -- 0:00:27
531000 -- (-553.550) (-554.500) (-554.787) [-555.156] * (-554.330) (-556.173) [-553.924] (-555.458) -- 0:00:27
531500 -- [-555.029] (-555.664) (-554.271) (-558.698) * (-554.966) (-555.824) [-554.102] (-556.254) -- 0:00:27
532000 -- (-553.491) (-555.262) [-555.387] (-554.309) * (-554.007) (-555.241) (-554.576) [-553.161] -- 0:00:27
532500 -- [-555.899] (-555.358) (-555.814) (-553.070) * (-558.193) (-553.542) (-555.922) [-554.450] -- 0:00:27
533000 -- (-557.590) (-553.806) [-558.538] (-554.058) * (-557.495) (-555.985) [-555.114] (-555.128) -- 0:00:27
533500 -- (-555.942) (-559.119) [-557.188] (-555.881) * (-555.531) [-555.942] (-555.206) (-555.448) -- 0:00:27
534000 -- (-559.596) [-555.478] (-554.017) (-555.024) * (-558.676) (-555.846) [-554.327] (-555.041) -- 0:00:27
534500 -- [-555.027] (-554.953) (-554.599) (-556.792) * [-556.109] (-554.201) (-553.761) (-555.065) -- 0:00:27
535000 -- (-553.922) (-555.101) (-555.598) [-554.234] * (-556.505) (-555.225) [-556.048] (-555.222) -- 0:00:27
Average standard deviation of split frequencies: 0.011485
535500 -- (-554.634) (-560.057) (-556.647) [-553.662] * [-553.965] (-554.613) (-554.976) (-556.344) -- 0:00:27
536000 -- (-553.041) [-553.571] (-557.566) (-554.341) * [-554.834] (-554.156) (-554.349) (-554.849) -- 0:00:27
536500 -- [-554.782] (-553.126) (-557.784) (-556.380) * (-554.388) (-555.600) [-553.458] (-555.542) -- 0:00:27
537000 -- [-553.960] (-555.556) (-560.227) (-553.724) * (-553.955) (-555.542) (-554.662) [-556.095] -- 0:00:27
537500 -- (-556.040) (-557.573) [-554.577] (-553.114) * (-554.822) (-554.443) (-555.102) [-554.852] -- 0:00:27
538000 -- (-555.094) [-553.991] (-557.534) (-554.779) * (-555.973) (-553.410) (-553.614) [-556.142] -- 0:00:27
538500 -- (-554.121) (-557.992) [-555.236] (-555.571) * [-554.209] (-556.319) (-554.632) (-555.519) -- 0:00:27
539000 -- (-554.063) [-555.142] (-553.327) (-553.275) * (-555.905) (-555.551) (-555.011) [-553.854] -- 0:00:27
539500 -- (-554.485) (-555.454) (-558.437) [-554.310] * (-553.782) (-554.466) [-555.510] (-553.438) -- 0:00:27
540000 -- [-554.932] (-559.671) (-555.843) (-560.198) * (-553.914) [-555.078] (-553.558) (-554.523) -- 0:00:27
Average standard deviation of split frequencies: 0.010899
540500 -- (-555.739) (-555.587) (-555.273) [-561.487] * (-555.071) (-557.087) (-554.218) [-555.427] -- 0:00:27
541000 -- [-556.157] (-556.851) (-556.050) (-554.926) * (-553.206) [-554.512] (-555.030) (-557.681) -- 0:00:27
541500 -- (-560.404) [-558.742] (-553.226) (-554.168) * (-556.819) (-554.042) (-556.032) [-554.838] -- 0:00:27
542000 -- (-565.898) [-553.361] (-554.336) (-555.225) * (-556.119) [-555.078] (-554.664) (-555.163) -- 0:00:27
542500 -- (-561.743) (-558.085) (-554.037) [-558.594] * (-554.846) [-554.310] (-555.160) (-555.625) -- 0:00:26
543000 -- (-556.370) (-553.602) [-554.081] (-553.733) * (-554.334) (-554.317) (-555.620) [-554.455] -- 0:00:26
543500 -- [-558.166] (-553.276) (-558.499) (-556.949) * [-554.553] (-554.968) (-557.011) (-557.047) -- 0:00:26
544000 -- (-555.060) [-554.408] (-556.344) (-556.157) * (-553.928) (-554.036) (-555.295) [-554.363] -- 0:00:26
544500 -- [-553.488] (-553.074) (-556.863) (-555.830) * (-559.702) (-553.834) (-555.858) [-554.189] -- 0:00:26
545000 -- [-555.702] (-554.226) (-557.424) (-553.768) * (-558.192) (-555.196) (-553.222) [-557.072] -- 0:00:26
Average standard deviation of split frequencies: 0.010564
545500 -- (-555.532) (-553.710) (-555.589) [-553.966] * (-558.665) [-553.642] (-554.058) (-557.162) -- 0:00:26
546000 -- (-554.219) (-553.189) [-554.591] (-557.273) * (-554.913) [-554.257] (-555.678) (-553.624) -- 0:00:26
546500 -- [-556.513] (-554.615) (-553.635) (-555.339) * (-554.980) (-554.486) [-558.442] (-556.668) -- 0:00:26
547000 -- (-555.216) (-555.385) [-555.260] (-556.710) * (-553.604) [-554.043] (-555.034) (-554.604) -- 0:00:26
547500 -- (-554.486) (-556.348) [-554.734] (-554.079) * (-557.577) [-553.912] (-554.756) (-556.730) -- 0:00:26
548000 -- (-553.895) (-555.017) [-563.945] (-555.931) * (-555.541) (-554.485) (-557.756) [-556.019] -- 0:00:26
548500 -- [-553.515] (-555.842) (-558.447) (-556.643) * (-554.311) [-554.888] (-555.123) (-553.313) -- 0:00:26
549000 -- (-553.918) (-554.109) [-554.592] (-556.548) * (-555.166) (-554.749) (-557.213) [-555.724] -- 0:00:26
549500 -- (-558.712) (-554.019) (-555.881) [-555.579] * (-555.994) (-556.013) [-555.577] (-557.442) -- 0:00:26
550000 -- (-556.684) [-558.003] (-554.521) (-555.880) * (-555.772) (-557.586) [-553.418] (-557.390) -- 0:00:26
Average standard deviation of split frequencies: 0.010433
550500 -- (-557.134) (-563.685) (-554.322) [-553.608] * [-554.200] (-554.338) (-555.820) (-555.300) -- 0:00:26
551000 -- (-556.281) (-555.379) [-554.428] (-556.448) * [-553.072] (-556.098) (-555.123) (-553.726) -- 0:00:26
551500 -- [-555.882] (-553.931) (-559.014) (-556.241) * (-554.390) (-555.471) [-554.536] (-555.553) -- 0:00:26
552000 -- (-555.440) (-553.811) [-554.706] (-557.533) * (-558.721) (-555.915) [-556.557] (-555.477) -- 0:00:26
552500 -- (-554.932) (-556.024) [-554.733] (-555.159) * (-555.936) (-557.872) [-557.461] (-554.220) -- 0:00:26
553000 -- (-554.076) [-556.681] (-554.993) (-555.814) * (-553.640) [-554.332] (-555.905) (-555.974) -- 0:00:26
553500 -- [-554.629] (-556.075) (-554.379) (-556.176) * [-559.424] (-553.273) (-555.918) (-555.676) -- 0:00:26
554000 -- (-556.320) (-554.721) [-555.178] (-555.971) * (-555.819) [-555.234] (-554.757) (-555.963) -- 0:00:26
554500 -- (-555.455) [-553.966] (-557.018) (-555.917) * (-565.171) (-554.550) (-559.246) [-554.674] -- 0:00:26
555000 -- [-555.613] (-554.414) (-552.856) (-555.391) * (-556.981) (-553.773) [-553.565] (-557.852) -- 0:00:26
Average standard deviation of split frequencies: 0.010492
555500 -- (-556.543) (-555.004) [-553.156] (-562.695) * (-554.353) [-555.138] (-553.143) (-554.013) -- 0:00:26
556000 -- (-560.106) [-553.864] (-553.725) (-558.649) * [-555.677] (-554.707) (-553.632) (-554.110) -- 0:00:26
556500 -- (-563.608) (-554.138) [-553.468] (-553.480) * (-554.312) [-553.792] (-553.902) (-555.991) -- 0:00:26
557000 -- (-557.505) [-554.603] (-555.514) (-554.481) * (-559.133) [-554.329] (-553.848) (-557.558) -- 0:00:26
557500 -- [-553.458] (-554.246) (-557.628) (-556.804) * (-555.270) [-554.435] (-560.786) (-555.358) -- 0:00:26
558000 -- (-557.671) [-556.057] (-554.112) (-556.792) * (-553.360) (-554.859) (-557.911) [-555.846] -- 0:00:26
558500 -- (-555.922) (-554.306) (-554.412) [-553.520] * (-552.965) [-554.901] (-552.815) (-557.997) -- 0:00:26
559000 -- (-553.073) [-559.738] (-554.718) (-554.913) * (-553.527) (-553.298) [-554.564] (-557.981) -- 0:00:26
559500 -- (-557.590) (-554.113) (-554.002) [-555.287] * [-553.460] (-556.560) (-553.709) (-555.488) -- 0:00:25
560000 -- [-554.236] (-555.563) (-556.913) (-555.608) * [-553.603] (-554.552) (-556.790) (-554.743) -- 0:00:25
Average standard deviation of split frequencies: 0.010482
560500 -- (-554.416) (-554.775) (-555.351) [-553.481] * (-553.709) [-556.751] (-558.127) (-555.217) -- 0:00:25
561000 -- [-553.385] (-555.969) (-554.180) (-553.560) * (-554.807) (-556.878) (-554.080) [-553.906] -- 0:00:25
561500 -- [-555.889] (-553.076) (-555.054) (-553.456) * (-556.169) [-555.309] (-554.687) (-556.476) -- 0:00:25
562000 -- [-553.520] (-557.462) (-553.467) (-554.009) * (-556.619) (-555.287) (-554.453) [-553.013] -- 0:00:25
562500 -- [-554.429] (-555.236) (-553.534) (-553.233) * (-555.042) (-557.532) [-554.280] (-558.016) -- 0:00:25
563000 -- (-554.183) (-557.228) [-552.951] (-554.931) * (-555.443) (-555.649) [-553.508] (-557.150) -- 0:00:25
563500 -- (-561.112) [-554.035] (-557.181) (-555.168) * (-560.618) (-556.821) [-554.193] (-553.103) -- 0:00:25
564000 -- (-561.423) (-553.252) [-555.425] (-557.029) * [-555.832] (-553.164) (-555.837) (-556.430) -- 0:00:25
564500 -- (-557.569) (-553.304) (-553.167) [-554.621] * (-555.026) [-553.710] (-554.600) (-555.295) -- 0:00:25
565000 -- (-557.146) (-555.798) [-555.356] (-556.637) * (-556.753) [-552.965] (-555.346) (-557.449) -- 0:00:25
Average standard deviation of split frequencies: 0.010716
565500 -- (-553.247) (-558.105) (-554.714) [-554.589] * (-559.752) (-553.148) [-557.593] (-556.275) -- 0:00:25
566000 -- (-556.199) [-556.253] (-554.523) (-554.386) * (-554.849) (-553.157) (-557.204) [-554.452] -- 0:00:25
566500 -- [-555.744] (-553.489) (-554.309) (-553.684) * (-555.956) [-552.780] (-556.581) (-554.361) -- 0:00:25
567000 -- (-554.754) [-555.739] (-554.739) (-554.339) * [-555.297] (-554.277) (-553.476) (-554.750) -- 0:00:25
567500 -- (-555.932) (-555.028) [-554.422] (-559.477) * (-553.717) (-553.403) [-553.928] (-556.078) -- 0:00:25
568000 -- (-554.690) (-558.285) (-562.542) [-557.821] * [-555.183] (-553.944) (-556.604) (-556.046) -- 0:00:25
568500 -- (-553.225) (-554.380) [-552.941] (-557.930) * (-554.985) (-556.111) [-555.676] (-555.620) -- 0:00:25
569000 -- (-556.372) (-553.270) (-555.369) [-555.467] * [-553.362] (-556.551) (-559.833) (-553.863) -- 0:00:25
569500 -- [-556.265] (-559.114) (-557.843) (-555.027) * (-553.705) (-554.656) (-554.909) [-553.665] -- 0:00:25
570000 -- (-553.454) (-554.067) (-554.287) [-553.098] * [-558.203] (-555.194) (-555.465) (-556.996) -- 0:00:25
Average standard deviation of split frequencies: 0.010518
570500 -- (-553.796) (-554.010) (-555.821) [-553.527] * (-556.370) (-555.721) [-555.752] (-552.600) -- 0:00:25
571000 -- [-556.460] (-554.211) (-554.095) (-553.432) * (-556.498) (-558.670) (-557.634) [-554.027] -- 0:00:25
571500 -- (-553.489) (-554.873) [-560.726] (-553.235) * (-557.033) (-555.695) [-554.703] (-553.880) -- 0:00:25
572000 -- (-556.542) (-558.371) [-555.122] (-559.007) * (-555.698) (-553.773) [-554.566] (-557.961) -- 0:00:25
572500 -- (-555.615) (-557.376) [-556.764] (-553.679) * (-554.449) [-554.553] (-555.325) (-552.978) -- 0:00:25
573000 -- (-554.561) [-558.381] (-553.974) (-557.471) * (-552.827) (-555.175) [-553.996] (-556.895) -- 0:00:25
573500 -- [-556.342] (-555.235) (-554.338) (-556.854) * (-553.119) [-553.105] (-555.744) (-556.071) -- 0:00:25
574000 -- (-553.475) [-554.364] (-554.502) (-556.282) * [-554.387] (-554.437) (-554.168) (-554.389) -- 0:00:25
574500 -- (-554.294) (-553.906) (-558.244) [-553.880] * (-553.156) (-558.386) [-554.154] (-557.262) -- 0:00:25
575000 -- (-556.533) (-553.927) [-553.504] (-557.831) * [-554.132] (-555.174) (-556.824) (-555.228) -- 0:00:25
Average standard deviation of split frequencies: 0.010895
575500 -- (-556.995) (-557.126) [-553.866] (-556.247) * (-555.250) (-554.731) [-554.559] (-556.720) -- 0:00:25
576000 -- (-557.679) (-554.025) [-557.621] (-558.231) * (-554.406) (-553.376) (-554.207) [-553.620] -- 0:00:25
576500 -- (-556.281) [-556.028] (-553.910) (-555.252) * (-558.676) [-555.292] (-554.290) (-556.685) -- 0:00:24
577000 -- (-553.391) [-554.651] (-553.611) (-556.512) * (-557.356) [-556.510] (-556.527) (-554.310) -- 0:00:24
577500 -- (-556.688) (-554.213) (-554.810) [-556.005] * [-554.510] (-556.126) (-555.299) (-555.834) -- 0:00:24
578000 -- (-558.425) (-558.638) [-554.514] (-554.822) * (-558.197) (-557.627) [-559.845] (-556.680) -- 0:00:24
578500 -- (-559.524) (-556.020) [-555.892] (-554.683) * (-555.655) (-557.612) [-553.593] (-554.821) -- 0:00:24
579000 -- (-553.523) (-555.166) [-553.617] (-556.113) * (-556.074) (-556.586) (-556.006) [-556.587] -- 0:00:24
579500 -- [-555.962] (-557.228) (-553.601) (-556.656) * (-553.622) (-564.297) [-554.890] (-554.915) -- 0:00:24
580000 -- (-554.285) (-554.564) (-555.579) [-554.193] * (-554.798) [-554.408] (-558.736) (-556.634) -- 0:00:24
Average standard deviation of split frequencies: 0.010757
580500 -- (-554.819) (-553.957) (-557.470) [-554.615] * [-553.958] (-554.309) (-555.911) (-555.886) -- 0:00:24
581000 -- [-555.166] (-553.304) (-558.376) (-553.644) * (-555.347) (-557.493) [-554.228] (-554.274) -- 0:00:24
581500 -- (-557.079) [-553.253] (-556.407) (-563.925) * (-557.642) (-555.861) [-553.814] (-553.815) -- 0:00:24
582000 -- [-560.212] (-553.692) (-556.293) (-556.562) * (-555.187) (-554.816) [-554.026] (-554.203) -- 0:00:24
582500 -- [-554.722] (-556.085) (-554.422) (-554.217) * (-554.192) [-554.256] (-555.598) (-554.596) -- 0:00:24
583000 -- [-555.642] (-554.663) (-554.106) (-555.142) * (-556.988) (-555.462) (-553.877) [-553.091] -- 0:00:24
583500 -- (-555.664) (-555.382) (-553.066) [-554.333] * [-556.635] (-556.571) (-557.782) (-553.615) -- 0:00:24
584000 -- [-554.374] (-554.337) (-555.224) (-554.156) * (-556.378) [-554.076] (-556.029) (-554.653) -- 0:00:24
584500 -- [-554.790] (-553.022) (-555.935) (-556.483) * (-555.999) (-558.587) (-554.020) [-553.503] -- 0:00:24
585000 -- (-555.450) (-553.373) (-554.001) [-555.106] * (-556.081) [-553.739] (-553.638) (-553.460) -- 0:00:24
Average standard deviation of split frequencies: 0.011735
585500 -- (-554.302) (-553.542) (-556.104) [-553.458] * (-555.168) (-553.865) [-554.682] (-557.426) -- 0:00:24
586000 -- [-555.502] (-554.990) (-553.513) (-553.779) * (-555.328) (-553.508) (-554.676) [-555.537] -- 0:00:24
586500 -- [-555.196] (-557.165) (-554.075) (-560.139) * (-556.038) (-555.336) [-553.833] (-553.864) -- 0:00:24
587000 -- (-555.965) (-556.950) (-552.958) [-553.300] * (-555.811) (-554.252) (-555.341) [-553.628] -- 0:00:24
587500 -- [-553.074] (-554.835) (-553.743) (-555.988) * (-553.732) (-553.990) (-552.942) [-553.233] -- 0:00:24
588000 -- (-553.246) (-554.850) [-553.944] (-555.164) * (-554.860) (-555.097) (-553.833) [-554.601] -- 0:00:24
588500 -- (-555.751) (-554.738) [-554.748] (-555.788) * [-559.221] (-557.519) (-554.304) (-555.572) -- 0:00:24
589000 -- (-556.523) [-553.685] (-555.840) (-556.084) * (-561.965) (-562.097) (-555.198) [-553.875] -- 0:00:24
589500 -- [-555.498] (-554.728) (-555.518) (-557.296) * (-555.684) (-555.604) (-555.026) [-553.049] -- 0:00:24
590000 -- (-554.201) [-555.233] (-555.096) (-556.506) * (-554.174) [-556.468] (-553.744) (-556.772) -- 0:00:24
Average standard deviation of split frequencies: 0.011123
590500 -- (-554.289) [-555.586] (-554.379) (-553.884) * (-553.584) (-557.616) [-552.967] (-555.810) -- 0:00:24
591000 -- [-554.101] (-555.176) (-556.879) (-555.044) * (-554.869) [-558.463] (-554.671) (-553.073) -- 0:00:24
591500 -- [-553.041] (-555.132) (-553.512) (-554.203) * [-554.901] (-553.898) (-554.658) (-554.814) -- 0:00:24
592000 -- (-552.817) [-560.483] (-552.866) (-555.592) * (-556.321) (-554.813) [-554.730] (-556.909) -- 0:00:24
592500 -- (-555.250) (-556.194) [-555.367] (-554.767) * [-553.642] (-553.908) (-555.516) (-556.639) -- 0:00:24
593000 -- (-554.225) [-555.699] (-555.129) (-556.069) * [-556.659] (-554.833) (-553.101) (-554.242) -- 0:00:24
593500 -- (-553.557) (-557.312) [-553.193] (-554.447) * (-553.875) (-553.900) [-553.675] (-557.779) -- 0:00:23
594000 -- [-555.676] (-554.746) (-555.930) (-559.907) * [-553.548] (-555.305) (-556.400) (-561.150) -- 0:00:23
594500 -- (-556.152) (-555.901) (-556.795) [-558.152] * [-553.161] (-554.939) (-562.534) (-556.430) -- 0:00:23
595000 -- [-556.774] (-557.676) (-556.121) (-554.389) * (-552.914) (-554.486) [-555.425] (-552.956) -- 0:00:23
Average standard deviation of split frequencies: 0.011172
595500 -- (-554.338) (-553.435) [-556.291] (-553.282) * (-556.084) (-553.780) (-556.156) [-553.453] -- 0:00:23
596000 -- (-554.594) (-554.104) (-555.945) [-554.609] * [-553.420] (-555.697) (-552.996) (-559.862) -- 0:00:23
596500 -- [-556.016] (-555.672) (-554.489) (-552.804) * (-555.509) (-554.479) (-554.280) [-553.186] -- 0:00:23
597000 -- (-554.398) (-554.831) (-553.429) [-555.131] * (-554.513) (-557.665) (-554.709) [-553.011] -- 0:00:23
597500 -- (-555.523) (-553.925) [-554.086] (-555.702) * (-554.144) [-555.070] (-553.934) (-553.525) -- 0:00:23
598000 -- (-552.713) (-557.167) [-557.529] (-555.173) * [-554.096] (-559.193) (-557.460) (-553.209) -- 0:00:23
598500 -- (-552.713) (-564.972) [-553.404] (-554.439) * (-553.622) [-555.644] (-555.025) (-554.870) -- 0:00:23
599000 -- (-553.310) (-559.917) [-554.355] (-553.453) * (-556.117) (-553.815) (-554.579) [-556.181] -- 0:00:23
599500 -- (-559.974) (-557.072) [-557.927] (-553.622) * (-555.683) (-562.926) [-556.424] (-555.692) -- 0:00:23
600000 -- (-554.108) [-554.783] (-554.913) (-556.652) * (-553.964) (-555.453) [-555.900] (-556.700) -- 0:00:23
Average standard deviation of split frequencies: 0.010742
600500 -- (-554.382) (-557.432) (-555.507) [-556.707] * (-552.696) [-556.900] (-556.635) (-554.507) -- 0:00:23
601000 -- [-554.235] (-553.810) (-554.567) (-554.165) * [-558.421] (-555.818) (-557.244) (-554.404) -- 0:00:23
601500 -- (-553.785) (-554.565) [-555.176] (-554.394) * [-553.973] (-553.108) (-555.766) (-555.009) -- 0:00:23
602000 -- (-555.114) (-557.867) [-555.715] (-557.457) * [-555.559] (-553.318) (-555.714) (-554.671) -- 0:00:23
602500 -- (-556.975) [-557.662] (-557.658) (-555.183) * (-553.243) (-555.901) [-553.958] (-555.680) -- 0:00:23
603000 -- (-553.637) (-554.864) (-555.587) [-554.819] * (-554.896) (-555.912) (-553.818) [-553.219] -- 0:00:23
603500 -- [-553.109] (-562.100) (-553.873) (-556.235) * [-554.677] (-556.351) (-555.795) (-554.313) -- 0:00:23
604000 -- (-561.365) [-555.266] (-554.703) (-554.407) * [-553.994] (-556.722) (-554.800) (-555.491) -- 0:00:23
604500 -- (-553.368) [-557.408] (-554.081) (-552.923) * (-554.104) [-557.135] (-555.826) (-558.247) -- 0:00:23
605000 -- [-554.011] (-558.405) (-554.617) (-552.958) * [-553.541] (-554.136) (-559.756) (-553.461) -- 0:00:23
Average standard deviation of split frequencies: 0.010842
605500 -- (-553.176) (-554.751) [-556.076] (-553.690) * [-552.692] (-557.521) (-552.670) (-555.634) -- 0:00:23
606000 -- (-552.873) (-556.058) [-553.714] (-553.114) * (-554.144) (-553.658) (-556.263) [-554.600] -- 0:00:23
606500 -- (-562.902) (-555.151) [-553.805] (-553.331) * (-555.475) [-553.184] (-555.701) (-555.937) -- 0:00:23
607000 -- (-552.891) (-553.869) (-555.137) [-553.308] * [-554.313] (-556.990) (-554.806) (-553.133) -- 0:00:23
607500 -- (-555.250) [-555.233] (-555.767) (-555.004) * (-557.411) (-559.291) [-557.233] (-557.214) -- 0:00:23
608000 -- (-557.615) (-555.048) (-556.607) [-554.564] * (-554.318) (-555.161) [-554.081] (-554.567) -- 0:00:23
608500 -- (-555.758) (-554.033) (-556.771) [-553.370] * (-553.405) [-553.605] (-556.606) (-556.192) -- 0:00:23
609000 -- [-553.052] (-554.946) (-556.042) (-558.691) * (-554.625) [-555.722] (-557.349) (-562.606) -- 0:00:23
609500 -- (-554.735) [-554.723] (-556.179) (-556.006) * (-554.744) (-559.002) (-553.559) [-560.757] -- 0:00:23
610000 -- (-556.460) [-554.352] (-559.654) (-555.380) * [-553.217] (-557.221) (-553.833) (-555.878) -- 0:00:23
Average standard deviation of split frequencies: 0.010711
610500 -- (-552.764) (-554.286) [-557.440] (-554.350) * (-555.973) (-557.616) [-554.239] (-555.948) -- 0:00:22
611000 -- [-555.523] (-557.800) (-555.709) (-553.672) * (-556.777) (-555.903) [-555.126] (-555.933) -- 0:00:22
611500 -- (-554.790) (-555.030) [-556.776] (-554.773) * [-553.773] (-555.553) (-552.945) (-554.647) -- 0:00:22
612000 -- (-554.504) (-554.989) (-555.492) [-554.151] * (-553.875) [-553.807] (-556.191) (-554.274) -- 0:00:22
612500 -- (-553.406) (-558.906) (-553.558) [-553.783] * (-554.130) [-554.462] (-557.542) (-557.673) -- 0:00:22
613000 -- (-554.351) [-555.446] (-554.792) (-556.380) * [-553.493] (-555.868) (-556.799) (-554.318) -- 0:00:22
613500 -- (-554.284) (-553.370) [-553.543] (-553.541) * [-554.396] (-553.753) (-556.380) (-553.195) -- 0:00:22
614000 -- (-556.741) (-553.750) (-554.341) [-555.366] * (-555.001) [-553.910] (-556.357) (-553.682) -- 0:00:22
614500 -- (-553.483) (-554.132) (-554.900) [-554.455] * (-553.497) [-554.718] (-555.255) (-553.583) -- 0:00:22
615000 -- (-553.815) (-553.566) (-554.280) [-558.137] * [-558.583] (-555.021) (-555.584) (-552.836) -- 0:00:22
Average standard deviation of split frequencies: 0.010522
615500 -- (-558.328) (-553.857) (-554.712) [-557.380] * (-554.995) [-553.730] (-553.211) (-555.546) -- 0:00:22
616000 -- [-555.948] (-555.225) (-553.775) (-554.531) * (-554.477) (-556.950) (-554.416) [-553.784] -- 0:00:22
616500 -- (-554.838) (-558.304) [-555.333] (-555.081) * (-560.038) [-555.923] (-556.111) (-553.944) -- 0:00:22
617000 -- (-555.719) (-559.072) [-558.185] (-553.608) * (-553.343) (-554.185) [-554.693] (-556.907) -- 0:00:22
617500 -- (-554.471) (-555.057) (-556.115) [-555.752] * [-555.864] (-554.406) (-556.264) (-554.867) -- 0:00:22
618000 -- (-554.590) (-554.411) [-554.331] (-557.523) * (-555.874) [-555.940] (-553.116) (-554.584) -- 0:00:22
618500 -- (-554.258) (-553.738) (-555.173) [-554.077] * (-554.023) (-553.780) (-560.274) [-553.644] -- 0:00:22
619000 -- [-553.813] (-554.260) (-553.262) (-566.787) * (-552.950) (-555.153) (-558.265) [-553.517] -- 0:00:22
619500 -- (-557.562) (-553.553) [-555.694] (-554.142) * (-559.891) (-554.673) [-554.507] (-556.793) -- 0:00:22
620000 -- (-556.017) (-552.912) [-553.709] (-553.709) * (-558.074) [-553.500] (-554.435) (-555.980) -- 0:00:22
Average standard deviation of split frequencies: 0.010681
620500 -- (-555.255) [-553.514] (-557.096) (-553.761) * [-555.575] (-555.103) (-554.225) (-556.501) -- 0:00:22
621000 -- (-554.393) (-555.967) [-554.493] (-555.574) * (-555.173) (-556.012) [-554.023] (-556.766) -- 0:00:22
621500 -- (-554.544) [-555.309] (-554.602) (-555.314) * (-558.049) (-553.346) [-553.368] (-556.464) -- 0:00:22
622000 -- (-557.309) (-553.197) [-553.875] (-557.377) * [-555.585] (-554.540) (-556.628) (-563.749) -- 0:00:22
622500 -- (-558.526) (-553.153) (-558.544) [-557.770] * (-557.917) [-555.268] (-556.905) (-555.916) -- 0:00:22
623000 -- (-557.583) [-555.652] (-560.036) (-554.894) * [-554.714] (-558.706) (-555.605) (-554.635) -- 0:00:22
623500 -- (-555.042) (-553.221) (-555.352) [-555.835] * (-554.378) (-557.779) (-558.831) [-556.948] -- 0:00:22
624000 -- (-555.146) (-555.695) [-553.945] (-555.549) * [-553.893] (-555.660) (-564.723) (-555.308) -- 0:00:22
624500 -- (-555.001) [-553.439] (-553.439) (-553.892) * (-557.469) (-555.655) [-557.479] (-554.925) -- 0:00:22
625000 -- (-558.620) [-556.516] (-553.000) (-554.617) * (-559.495) (-555.392) (-554.157) [-553.149] -- 0:00:22
Average standard deviation of split frequencies: 0.010941
625500 -- (-556.601) (-556.176) (-554.703) [-554.788] * (-555.426) [-553.247] (-554.254) (-554.114) -- 0:00:22
626000 -- [-556.997] (-558.352) (-554.371) (-555.613) * (-559.722) (-554.273) (-555.235) [-556.678] -- 0:00:22
626500 -- (-554.149) [-554.114] (-555.879) (-554.485) * (-552.974) [-560.783] (-555.983) (-554.100) -- 0:00:22
627000 -- [-554.028] (-556.599) (-558.261) (-552.939) * [-557.057] (-554.919) (-553.547) (-554.463) -- 0:00:22
627500 -- (-555.538) (-561.960) (-554.670) [-553.925] * (-553.720) (-553.900) [-555.711] (-557.389) -- 0:00:21
628000 -- (-555.085) [-555.520] (-557.857) (-552.952) * [-558.967] (-554.189) (-553.201) (-553.904) -- 0:00:21
628500 -- [-554.709] (-554.376) (-556.000) (-554.543) * [-558.697] (-558.179) (-553.999) (-554.217) -- 0:00:21
629000 -- (-553.731) (-558.343) (-555.523) [-553.250] * (-556.220) (-553.230) (-555.897) [-553.844] -- 0:00:21
629500 -- (-555.045) (-555.736) (-554.783) [-553.989] * [-555.212] (-556.891) (-557.257) (-557.301) -- 0:00:21
630000 -- [-554.138] (-553.456) (-554.108) (-553.379) * (-556.518) (-557.463) (-559.109) [-558.577] -- 0:00:21
Average standard deviation of split frequencies: 0.011025
630500 -- [-556.304] (-555.819) (-553.648) (-554.907) * (-557.721) (-554.287) [-556.007] (-554.313) -- 0:00:21
631000 -- (-555.490) [-555.358] (-553.819) (-556.971) * (-554.353) (-554.730) [-557.414] (-554.908) -- 0:00:21
631500 -- [-554.350] (-559.773) (-553.259) (-555.602) * (-553.514) (-558.015) (-555.790) [-555.763] -- 0:00:21
632000 -- (-558.008) [-554.823] (-553.604) (-554.295) * (-554.739) [-553.229] (-555.507) (-558.439) -- 0:00:21
632500 -- (-555.965) (-556.753) (-553.443) [-555.918] * (-557.152) [-554.803] (-553.454) (-555.039) -- 0:00:21
633000 -- (-555.178) (-554.187) (-556.040) [-554.306] * (-558.148) (-555.219) (-555.727) [-554.072] -- 0:00:21
633500 -- (-554.114) (-561.359) (-559.672) [-553.283] * (-555.361) [-555.455] (-555.980) (-554.435) -- 0:00:21
634000 -- [-554.628] (-561.629) (-556.335) (-554.405) * (-555.646) (-555.024) [-553.363] (-554.185) -- 0:00:21
634500 -- (-559.540) (-563.964) [-556.491] (-556.478) * (-557.570) (-554.787) [-555.539] (-553.787) -- 0:00:21
635000 -- (-553.479) [-558.834] (-556.739) (-554.871) * (-555.628) (-553.377) (-554.263) [-556.018] -- 0:00:21
Average standard deviation of split frequencies: 0.011072
635500 -- [-552.760] (-555.514) (-556.976) (-557.351) * (-553.868) [-553.408] (-557.671) (-555.189) -- 0:00:21
636000 -- (-554.389) (-558.816) (-556.215) [-554.491] * (-556.108) [-554.646] (-556.895) (-555.390) -- 0:00:21
636500 -- (-554.635) (-557.404) [-555.110] (-552.914) * (-555.944) (-554.399) (-553.728) [-555.388] -- 0:00:21
637000 -- (-554.935) (-555.401) [-555.201] (-553.996) * (-559.254) (-554.973) [-554.390] (-554.111) -- 0:00:21
637500 -- (-555.065) [-553.937] (-553.644) (-553.221) * [-554.749] (-554.411) (-554.010) (-554.198) -- 0:00:21
638000 -- (-557.322) (-559.762) (-553.308) [-554.986] * (-555.376) [-554.097] (-556.420) (-554.877) -- 0:00:21
638500 -- [-555.276] (-554.533) (-556.143) (-553.796) * [-554.226] (-554.609) (-554.981) (-553.404) -- 0:00:21
639000 -- [-554.180] (-556.152) (-556.276) (-553.954) * (-553.734) [-554.934] (-554.192) (-555.427) -- 0:00:21
639500 -- [-563.238] (-556.265) (-552.857) (-556.147) * (-554.075) (-554.269) [-553.700] (-557.848) -- 0:00:21
640000 -- (-554.730) (-555.819) (-552.695) [-556.747] * [-555.416] (-554.558) (-553.568) (-555.408) -- 0:00:21
Average standard deviation of split frequencies: 0.011221
640500 -- (-555.080) (-555.785) (-553.232) [-554.485] * (-555.033) [-555.536] (-557.706) (-554.149) -- 0:00:21
641000 -- (-554.093) [-554.065] (-555.799) (-556.090) * (-554.093) (-557.840) [-556.163] (-554.023) -- 0:00:21
641500 -- (-555.396) [-553.914] (-555.655) (-554.684) * (-553.291) (-560.330) (-556.902) [-553.041] -- 0:00:21
642000 -- [-557.085] (-558.048) (-558.231) (-556.184) * (-554.029) (-553.154) [-553.886] (-554.243) -- 0:00:21
642500 -- [-555.555] (-555.418) (-554.601) (-554.117) * (-556.227) [-555.348] (-559.248) (-557.091) -- 0:00:21
643000 -- (-553.639) [-553.008] (-555.684) (-556.731) * (-557.266) (-554.684) [-556.185] (-556.236) -- 0:00:21
643500 -- [-557.810] (-553.417) (-554.737) (-554.316) * (-556.444) [-555.500] (-558.993) (-554.254) -- 0:00:21
644000 -- (-557.313) (-553.465) (-554.861) [-554.816] * (-554.046) (-558.107) [-552.770] (-553.298) -- 0:00:21
644500 -- (-556.992) [-554.062] (-556.850) (-555.255) * (-556.641) (-553.054) (-554.656) [-558.405] -- 0:00:20
645000 -- (-554.351) (-555.636) (-554.400) [-552.970] * (-556.889) (-556.163) (-556.158) [-555.831] -- 0:00:20
Average standard deviation of split frequencies: 0.010989
645500 -- [-555.436] (-554.776) (-555.616) (-553.138) * (-558.753) [-552.773] (-558.704) (-554.172) -- 0:00:20
646000 -- (-553.756) (-553.711) [-554.542] (-555.539) * [-557.296] (-553.260) (-554.228) (-554.175) -- 0:00:20
646500 -- (-555.832) [-559.440] (-554.932) (-554.242) * [-554.240] (-562.376) (-553.376) (-553.557) -- 0:00:20
647000 -- (-556.304) [-553.667] (-554.695) (-554.124) * (-558.858) (-560.220) (-557.807) [-555.094] -- 0:00:20
647500 -- (-559.636) (-556.434) (-555.173) [-554.971] * (-552.838) (-560.882) [-555.712] (-554.242) -- 0:00:20
648000 -- (-555.582) [-553.244] (-556.310) (-554.981) * (-553.388) [-557.770] (-554.886) (-555.846) -- 0:00:20
648500 -- (-556.592) (-556.108) [-555.101] (-554.186) * (-555.786) (-557.351) [-552.703] (-554.969) -- 0:00:20
649000 -- [-560.921] (-554.023) (-554.519) (-558.642) * (-554.699) (-554.366) (-555.956) [-556.157] -- 0:00:20
649500 -- (-556.992) (-555.925) (-555.324) [-559.339] * [-554.475] (-553.877) (-556.650) (-554.086) -- 0:00:20
650000 -- (-557.479) [-556.199] (-554.758) (-559.308) * [-556.233] (-553.630) (-553.625) (-557.050) -- 0:00:20
Average standard deviation of split frequencies: 0.010910
650500 -- (-555.873) (-554.572) (-554.415) [-558.957] * [-554.270] (-553.591) (-553.433) (-557.755) -- 0:00:20
651000 -- [-557.004] (-553.186) (-553.791) (-558.618) * (-554.326) (-558.112) [-555.197] (-557.419) -- 0:00:20
651500 -- (-554.142) [-553.393] (-554.023) (-557.082) * (-555.614) [-558.544] (-554.530) (-554.590) -- 0:00:20
652000 -- [-554.978] (-557.449) (-554.175) (-554.443) * (-555.280) [-554.280] (-553.542) (-557.625) -- 0:00:20
652500 -- (-562.630) (-554.674) [-553.268] (-556.413) * (-554.916) (-555.066) (-555.177) [-554.520] -- 0:00:20
653000 -- (-557.265) (-558.500) [-556.161] (-555.950) * (-557.316) (-556.872) [-553.234] (-554.586) -- 0:00:20
653500 -- [-552.782] (-559.863) (-555.030) (-554.168) * (-555.549) (-553.514) [-556.877] (-556.125) -- 0:00:20
654000 -- (-556.858) (-558.293) (-554.165) [-554.477] * (-553.516) (-553.593) (-553.919) [-553.122] -- 0:00:20
654500 -- (-554.081) (-554.195) (-554.375) [-556.742] * (-553.831) (-553.400) [-556.962] (-552.851) -- 0:00:20
655000 -- (-555.333) [-553.630] (-554.070) (-557.042) * [-555.070] (-554.173) (-556.268) (-556.676) -- 0:00:20
Average standard deviation of split frequencies: 0.011408
655500 -- (-554.933) [-553.754] (-555.913) (-553.922) * [-554.649] (-555.252) (-554.080) (-558.142) -- 0:00:20
656000 -- (-555.888) (-553.137) [-553.611] (-553.884) * [-554.246] (-557.153) (-552.836) (-556.061) -- 0:00:20
656500 -- (-555.176) (-555.174) [-553.516] (-554.161) * [-555.855] (-553.596) (-555.502) (-552.793) -- 0:00:20
657000 -- [-561.844] (-555.256) (-557.102) (-553.497) * (-563.001) [-554.096] (-554.424) (-555.264) -- 0:00:20
657500 -- (-554.691) (-558.888) (-554.890) [-554.699] * [-556.294] (-553.526) (-557.118) (-553.190) -- 0:00:20
658000 -- (-554.864) [-554.781] (-553.965) (-553.349) * (-553.443) [-554.776] (-555.178) (-554.647) -- 0:00:20
658500 -- (-554.649) (-557.596) [-554.659] (-553.455) * (-560.334) [-557.060] (-555.478) (-561.593) -- 0:00:20
659000 -- (-554.645) (-555.005) [-554.911] (-557.131) * (-558.559) [-555.941] (-556.603) (-562.937) -- 0:00:20
659500 -- [-556.384] (-555.708) (-553.065) (-555.285) * (-556.288) [-553.807] (-556.388) (-555.968) -- 0:00:20
660000 -- (-556.043) [-555.598] (-556.142) (-553.701) * (-556.620) [-555.918] (-553.545) (-554.604) -- 0:00:20
Average standard deviation of split frequencies: 0.011729
660500 -- (-555.257) [-561.502] (-558.808) (-556.164) * (-553.656) (-562.107) [-554.124] (-557.471) -- 0:00:20
661000 -- [-555.112] (-554.676) (-553.945) (-554.501) * (-556.433) (-553.308) (-554.858) [-555.936] -- 0:00:20
661500 -- (-554.583) (-554.379) (-556.606) [-556.412] * [-553.815] (-553.321) (-554.262) (-558.963) -- 0:00:19
662000 -- (-553.920) [-554.659] (-559.607) (-554.020) * (-555.839) [-553.120] (-553.082) (-554.910) -- 0:00:19
662500 -- (-553.244) [-553.714] (-555.249) (-560.532) * (-554.425) (-555.306) [-556.457] (-558.754) -- 0:00:19
663000 -- (-553.325) (-554.326) (-555.418) [-553.536] * (-554.764) [-557.204] (-556.980) (-559.918) -- 0:00:19
663500 -- (-553.343) (-555.346) [-558.621] (-553.439) * (-554.854) (-556.440) [-555.726] (-552.986) -- 0:00:19
664000 -- (-554.725) [-554.312] (-555.430) (-555.149) * (-555.425) (-558.436) (-553.488) [-553.554] -- 0:00:19
664500 -- [-555.533] (-553.869) (-554.374) (-553.945) * [-553.206] (-557.794) (-555.460) (-558.255) -- 0:00:19
665000 -- [-555.664] (-553.865) (-552.670) (-553.623) * [-554.361] (-559.251) (-555.651) (-555.350) -- 0:00:19
Average standard deviation of split frequencies: 0.011950
665500 -- (-553.131) [-555.424] (-559.040) (-554.091) * (-554.114) [-554.617] (-553.976) (-558.488) -- 0:00:19
666000 -- [-555.321] (-557.055) (-554.464) (-555.574) * (-554.114) (-554.867) [-554.070] (-556.167) -- 0:00:19
666500 -- (-553.773) [-556.687] (-554.125) (-552.922) * [-556.224] (-554.981) (-554.649) (-554.921) -- 0:00:19
667000 -- [-552.926] (-553.758) (-554.032) (-557.272) * [-556.820] (-554.686) (-555.924) (-554.893) -- 0:00:19
667500 -- (-554.008) [-556.588] (-553.989) (-559.105) * (-555.005) [-553.972] (-554.032) (-554.283) -- 0:00:19
668000 -- (-556.459) (-556.234) (-556.142) [-554.584] * [-555.197] (-554.213) (-555.243) (-561.315) -- 0:00:19
668500 -- (-555.739) [-553.872] (-558.358) (-555.315) * (-555.372) [-555.591] (-553.347) (-557.456) -- 0:00:19
669000 -- (-555.671) (-553.184) [-553.264] (-554.683) * [-555.385] (-553.983) (-555.885) (-555.957) -- 0:00:19
669500 -- (-557.037) (-553.779) (-553.556) [-554.035] * (-554.407) [-554.727] (-554.037) (-555.646) -- 0:00:19
670000 -- (-554.319) [-554.474] (-553.669) (-556.836) * (-554.056) (-555.260) [-557.156] (-554.979) -- 0:00:19
Average standard deviation of split frequencies: 0.011949
670500 -- (-554.452) [-555.646] (-558.105) (-555.838) * (-553.898) [-554.583] (-555.378) (-557.433) -- 0:00:19
671000 -- (-554.226) (-557.241) [-554.514] (-560.686) * (-554.797) (-554.326) [-555.139] (-558.394) -- 0:00:19
671500 -- (-553.979) [-554.403] (-554.223) (-554.124) * [-553.419] (-554.076) (-553.581) (-556.930) -- 0:00:19
672000 -- (-554.712) (-556.468) (-555.664) [-555.061] * [-553.247] (-554.137) (-555.432) (-554.728) -- 0:00:19
672500 -- (-554.746) (-558.967) [-555.271] (-555.242) * (-553.694) (-553.952) [-555.354] (-554.148) -- 0:00:19
673000 -- [-556.428] (-554.498) (-554.392) (-554.980) * (-555.536) (-559.693) [-555.343] (-553.126) -- 0:00:19
673500 -- (-553.858) [-554.373] (-554.380) (-553.219) * (-560.418) (-558.428) (-559.208) [-555.344] -- 0:00:19
674000 -- [-553.781] (-557.166) (-555.264) (-553.613) * (-557.645) [-555.724] (-557.495) (-557.426) -- 0:00:19
674500 -- (-557.371) (-560.015) [-555.808] (-554.018) * (-556.548) (-557.312) (-556.997) [-553.390] -- 0:00:19
675000 -- (-554.429) (-557.223) (-554.179) [-556.007] * [-556.517] (-554.572) (-557.642) (-555.911) -- 0:00:19
Average standard deviation of split frequencies: 0.011568
675500 -- (-556.089) (-553.883) [-552.870] (-553.912) * [-553.167] (-553.139) (-556.238) (-558.147) -- 0:00:19
676000 -- (-555.637) (-554.802) [-553.646] (-559.025) * (-556.330) (-556.220) (-554.664) [-554.054] -- 0:00:19
676500 -- (-556.065) [-558.986] (-553.394) (-559.049) * [-553.788] (-554.393) (-557.330) (-553.843) -- 0:00:19
677000 -- (-553.884) [-554.707] (-554.382) (-554.348) * [-553.622] (-554.967) (-556.011) (-554.637) -- 0:00:19
677500 -- (-555.067) [-557.139] (-555.091) (-560.502) * (-555.414) (-555.643) (-556.024) [-558.062] -- 0:00:19
678000 -- (-556.655) (-559.071) (-555.739) [-555.776] * (-554.970) (-555.271) [-558.826] (-558.146) -- 0:00:18
678500 -- (-563.378) [-558.271] (-555.925) (-554.368) * (-554.035) [-554.008] (-556.371) (-557.110) -- 0:00:18
679000 -- (-558.572) (-555.717) [-556.407] (-556.390) * (-555.013) (-556.704) [-554.508] (-553.631) -- 0:00:18
679500 -- (-555.786) (-555.101) [-553.542] (-558.095) * (-553.754) (-553.159) [-556.058] (-554.570) -- 0:00:18
680000 -- [-556.746] (-556.055) (-554.011) (-556.084) * [-553.592] (-564.348) (-556.081) (-554.162) -- 0:00:18
Average standard deviation of split frequencies: 0.011427
680500 -- (-553.896) (-554.972) (-556.523) [-556.643] * [-553.632] (-560.252) (-559.798) (-556.940) -- 0:00:18
681000 -- [-553.564] (-554.451) (-555.957) (-555.108) * (-555.543) (-554.257) (-555.884) [-555.848] -- 0:00:18
681500 -- (-553.591) [-554.477] (-554.031) (-558.722) * (-554.686) (-555.981) (-554.195) [-560.068] -- 0:00:18
682000 -- (-553.054) (-554.374) [-555.255] (-556.530) * [-555.081] (-554.438) (-557.522) (-553.358) -- 0:00:18
682500 -- [-552.760] (-554.266) (-558.483) (-554.093) * (-555.584) [-554.736] (-556.516) (-554.309) -- 0:00:18
683000 -- (-552.847) (-554.654) (-558.794) [-554.266] * [-554.333] (-554.455) (-554.808) (-553.968) -- 0:00:18
683500 -- (-552.886) (-558.190) (-556.731) [-552.678] * (-553.702) [-556.772] (-555.871) (-555.193) -- 0:00:18
684000 -- (-555.637) [-554.020] (-554.492) (-556.500) * (-557.974) [-555.204] (-563.379) (-558.983) -- 0:00:18
684500 -- (-553.664) [-554.040] (-554.151) (-555.867) * [-554.675] (-560.125) (-554.945) (-556.588) -- 0:00:18
685000 -- [-553.120] (-554.619) (-554.272) (-554.001) * [-555.587] (-555.583) (-555.505) (-555.348) -- 0:00:18
Average standard deviation of split frequencies: 0.011965
685500 -- [-553.924] (-555.311) (-555.420) (-554.302) * [-555.313] (-560.150) (-552.942) (-554.063) -- 0:00:18
686000 -- (-553.227) (-555.562) (-556.966) [-553.787] * (-557.553) (-554.122) (-556.081) [-554.813] -- 0:00:18
686500 -- (-553.853) [-556.346] (-554.023) (-556.044) * [-556.563] (-555.166) (-557.630) (-555.048) -- 0:00:18
687000 -- [-553.919] (-554.421) (-553.969) (-553.974) * (-554.041) (-554.334) (-554.047) [-553.469] -- 0:00:18
687500 -- (-553.475) [-553.431] (-556.239) (-554.881) * (-554.990) (-554.644) [-553.105] (-559.420) -- 0:00:18
688000 -- [-553.956] (-553.633) (-553.725) (-556.573) * (-554.044) (-555.243) [-553.855] (-557.432) -- 0:00:18
688500 -- (-554.526) (-554.691) [-555.485] (-558.187) * (-556.545) [-557.865] (-554.034) (-563.404) -- 0:00:18
689000 -- (-554.917) [-553.276] (-558.833) (-557.905) * (-554.124) (-555.370) (-555.368) [-554.983] -- 0:00:18
689500 -- (-554.920) (-553.834) (-556.090) [-558.290] * (-559.294) [-554.185] (-555.269) (-555.452) -- 0:00:18
690000 -- (-555.355) (-554.246) [-556.529] (-558.573) * (-556.381) [-553.414] (-559.380) (-555.457) -- 0:00:18
Average standard deviation of split frequencies: 0.012486
690500 -- (-554.358) (-556.556) [-555.658] (-556.014) * [-554.309] (-554.549) (-555.885) (-554.199) -- 0:00:18
691000 -- (-555.477) [-553.164] (-554.884) (-557.584) * [-555.423] (-554.956) (-556.455) (-554.861) -- 0:00:18
691500 -- (-556.830) [-553.153] (-554.372) (-557.826) * (-555.256) [-555.540] (-553.401) (-557.764) -- 0:00:18
692000 -- (-558.230) (-555.785) [-555.146] (-557.658) * [-558.936] (-554.046) (-558.625) (-558.114) -- 0:00:18
692500 -- (-556.603) (-559.061) [-554.754] (-558.627) * (-555.331) (-554.176) [-557.956] (-555.112) -- 0:00:18
693000 -- (-553.989) (-556.428) [-557.327] (-555.805) * [-554.247] (-554.091) (-552.587) (-553.557) -- 0:00:18
693500 -- (-556.096) [-554.223] (-553.368) (-553.595) * (-554.447) [-553.452] (-553.480) (-554.344) -- 0:00:18
694000 -- (-556.306) [-553.581] (-554.912) (-554.916) * (-553.262) (-554.787) [-556.574] (-554.248) -- 0:00:18
694500 -- (-556.820) (-554.543) (-554.486) [-553.335] * (-552.946) (-554.188) [-562.293] (-555.155) -- 0:00:18
695000 -- [-555.231] (-557.550) (-553.961) (-553.583) * [-554.164] (-554.499) (-555.583) (-554.513) -- 0:00:17
Average standard deviation of split frequencies: 0.012431
695500 -- [-562.513] (-559.370) (-553.796) (-558.807) * [-557.018] (-554.887) (-553.415) (-555.394) -- 0:00:17
696000 -- (-555.020) (-558.364) [-555.048] (-554.626) * (-564.647) (-555.340) (-557.255) [-554.716] -- 0:00:17
696500 -- (-555.889) (-556.117) [-557.449] (-553.536) * (-556.729) [-554.520] (-554.946) (-553.784) -- 0:00:17
697000 -- (-558.571) [-557.512] (-555.730) (-553.737) * (-553.130) [-555.359] (-557.460) (-553.692) -- 0:00:17
697500 -- (-555.558) (-557.289) [-555.268] (-553.427) * (-555.497) [-553.885] (-555.564) (-557.811) -- 0:00:17
698000 -- (-553.995) (-553.865) [-554.134] (-557.268) * [-554.203] (-554.295) (-556.762) (-558.711) -- 0:00:17
698500 -- [-558.320] (-555.057) (-557.736) (-553.691) * (-553.716) (-555.623) (-554.175) [-559.062] -- 0:00:17
699000 -- (-555.045) (-553.267) [-556.693] (-555.107) * [-555.310] (-555.489) (-555.995) (-554.567) -- 0:00:17
699500 -- (-555.295) (-555.273) (-558.097) [-555.856] * (-552.822) (-556.965) (-553.902) [-553.566] -- 0:00:17
700000 -- (-554.477) (-557.930) (-558.194) [-556.784] * (-556.812) (-558.797) (-555.754) [-553.546] -- 0:00:17
Average standard deviation of split frequencies: 0.011648
700500 -- (-553.998) [-558.982] (-556.555) (-552.929) * [-555.670] (-553.753) (-557.688) (-558.056) -- 0:00:17
701000 -- (-555.932) (-553.453) [-557.104] (-554.632) * [-554.671] (-556.585) (-554.754) (-554.510) -- 0:00:17
701500 -- (-555.130) (-554.154) (-555.167) [-555.178] * (-555.747) [-555.062] (-553.750) (-553.879) -- 0:00:17
702000 -- (-555.684) (-554.150) [-554.700] (-553.073) * (-554.832) (-553.307) (-554.610) [-553.493] -- 0:00:17
702500 -- (-554.190) (-553.528) [-554.521] (-554.556) * (-556.057) (-555.252) [-560.325] (-553.316) -- 0:00:17
703000 -- (-555.024) [-554.272] (-555.196) (-555.345) * (-558.639) (-556.235) [-557.160] (-556.693) -- 0:00:17
703500 -- (-555.469) (-554.055) [-554.853] (-555.988) * (-555.469) [-555.130] (-555.115) (-557.265) -- 0:00:17
704000 -- (-556.911) [-554.996] (-555.390) (-557.122) * (-554.955) [-555.456] (-556.742) (-562.528) -- 0:00:17
704500 -- (-554.314) (-553.745) (-560.698) [-555.139] * [-553.278] (-553.908) (-554.986) (-560.343) -- 0:00:17
705000 -- [-552.968] (-555.326) (-558.546) (-557.871) * [-556.025] (-554.764) (-557.070) (-554.118) -- 0:00:17
Average standard deviation of split frequencies: 0.012804
705500 -- (-553.395) (-560.173) (-556.333) [-555.513] * (-556.903) (-555.968) (-557.054) [-552.848] -- 0:00:17
706000 -- (-555.154) [-559.348] (-559.174) (-555.266) * [-556.190] (-556.618) (-555.169) (-552.948) -- 0:00:17
706500 -- (-555.250) (-559.182) (-555.924) [-555.057] * (-556.024) (-554.036) [-555.034] (-553.134) -- 0:00:17
707000 -- (-556.413) [-555.456] (-555.588) (-555.875) * [-556.310] (-558.029) (-555.192) (-553.417) -- 0:00:17
707500 -- (-555.257) (-552.795) (-553.220) [-554.397] * [-555.328] (-557.236) (-553.419) (-556.027) -- 0:00:17
708000 -- (-554.913) [-554.798] (-554.298) (-555.436) * [-553.621] (-556.599) (-554.300) (-555.182) -- 0:00:17
708500 -- [-554.323] (-554.649) (-552.817) (-561.847) * (-553.375) [-555.011] (-554.893) (-553.165) -- 0:00:17
709000 -- (-555.633) [-557.084] (-553.841) (-554.762) * (-557.269) [-553.881] (-554.721) (-558.569) -- 0:00:17
709500 -- (-554.241) (-559.739) (-554.911) [-553.372] * (-556.859) (-552.961) [-554.103] (-554.473) -- 0:00:17
710000 -- [-554.229] (-554.334) (-554.253) (-554.624) * [-553.264] (-554.909) (-558.269) (-556.991) -- 0:00:17
Average standard deviation of split frequencies: 0.012096
710500 -- (-553.947) (-556.996) (-555.002) [-555.063] * (-554.064) [-554.549] (-554.866) (-554.259) -- 0:00:17
711000 -- (-555.859) [-556.323] (-557.636) (-558.451) * (-563.536) [-554.424] (-554.707) (-553.130) -- 0:00:17
711500 -- (-553.892) [-554.397] (-554.029) (-555.429) * [-554.873] (-552.842) (-558.917) (-554.762) -- 0:00:17
712000 -- (-554.897) (-554.104) [-553.476] (-553.627) * [-553.168] (-553.703) (-555.977) (-555.295) -- 0:00:16
712500 -- (-555.348) (-554.374) (-553.358) [-554.778] * (-553.908) (-554.088) [-554.861] (-555.577) -- 0:00:16
713000 -- (-558.740) [-557.105] (-553.879) (-556.085) * (-553.126) [-558.217] (-556.017) (-556.094) -- 0:00:16
713500 -- (-553.940) (-553.159) [-556.918] (-553.849) * (-555.565) (-560.162) (-560.060) [-553.183] -- 0:00:16
714000 -- (-554.097) (-553.843) [-555.356] (-553.116) * (-558.417) (-559.514) (-560.711) [-553.093] -- 0:00:16
714500 -- (-553.081) (-553.275) [-555.464] (-554.253) * [-554.536] (-558.635) (-557.625) (-555.597) -- 0:00:16
715000 -- (-553.556) (-555.380) (-554.950) [-553.640] * (-554.125) [-557.316] (-553.759) (-556.842) -- 0:00:16
Average standard deviation of split frequencies: 0.011686
715500 -- (-553.796) (-554.574) (-554.738) [-555.230] * (-554.606) [-555.617] (-553.010) (-556.827) -- 0:00:16
716000 -- (-553.785) (-556.874) [-556.437] (-554.253) * (-554.903) (-555.922) (-553.066) [-556.203] -- 0:00:16
716500 -- (-554.551) (-556.062) [-556.338] (-553.729) * (-554.804) (-558.125) [-553.710] (-554.662) -- 0:00:16
717000 -- (-557.348) (-558.815) [-560.212] (-553.428) * (-555.810) [-558.745] (-557.442) (-553.492) -- 0:00:16
717500 -- (-559.177) [-554.471] (-557.080) (-560.032) * [-556.392] (-557.934) (-553.415) (-554.458) -- 0:00:16
718000 -- (-562.251) [-553.142] (-555.717) (-559.995) * (-555.295) [-556.651] (-554.181) (-555.180) -- 0:00:16
718500 -- [-554.761] (-553.982) (-554.355) (-555.860) * (-552.748) (-553.381) [-553.913] (-560.353) -- 0:00:16
719000 -- (-554.035) (-553.940) [-556.942] (-556.877) * (-553.794) (-555.298) (-557.537) [-557.019] -- 0:00:16
719500 -- (-558.235) [-555.330] (-554.660) (-561.641) * (-553.417) [-554.801] (-555.216) (-557.163) -- 0:00:16
720000 -- [-553.609] (-555.288) (-557.035) (-554.872) * [-553.931] (-556.102) (-555.262) (-559.335) -- 0:00:16
Average standard deviation of split frequencies: 0.012224
720500 -- (-553.610) (-556.355) (-559.514) [-554.136] * (-553.257) [-555.163] (-557.145) (-553.268) -- 0:00:16
721000 -- (-556.683) (-556.122) (-554.083) [-555.108] * (-553.594) [-558.329] (-554.912) (-553.961) -- 0:00:16
721500 -- (-554.579) (-558.522) (-553.634) [-556.960] * (-555.597) [-553.521] (-555.503) (-555.823) -- 0:00:16
722000 -- (-556.499) (-558.430) (-553.679) [-553.787] * (-554.352) (-558.524) [-554.482] (-553.774) -- 0:00:16
722500 -- [-559.396] (-554.970) (-554.825) (-554.032) * (-554.920) (-554.626) (-554.804) [-553.451] -- 0:00:16
723000 -- (-555.222) (-555.412) (-556.671) [-554.995] * (-555.712) (-557.313) [-553.565] (-555.550) -- 0:00:16
723500 -- (-553.925) (-556.325) [-554.340] (-555.244) * [-553.148] (-558.235) (-554.352) (-552.641) -- 0:00:16
724000 -- (-558.053) [-555.495] (-553.978) (-554.595) * [-554.924] (-559.193) (-553.321) (-556.796) -- 0:00:16
724500 -- (-555.026) (-560.233) [-558.080] (-555.913) * (-554.506) (-559.135) (-553.902) [-555.166] -- 0:00:16
725000 -- (-553.336) (-556.586) (-559.058) [-555.061] * (-554.868) (-556.543) [-553.977] (-554.467) -- 0:00:16
Average standard deviation of split frequencies: 0.012743
725500 -- (-555.353) (-555.339) (-554.941) [-553.925] * (-553.040) (-554.993) (-554.608) [-556.516] -- 0:00:16
726000 -- [-554.752] (-554.062) (-553.564) (-554.449) * (-553.046) (-555.790) (-555.999) [-554.127] -- 0:00:16
726500 -- (-555.445) (-554.300) (-554.136) [-556.155] * [-552.695] (-554.184) (-555.620) (-554.235) -- 0:00:16
727000 -- (-553.355) [-553.746] (-556.199) (-554.090) * (-555.892) [-554.239] (-554.315) (-554.829) -- 0:00:16
727500 -- (-553.740) (-555.864) [-553.879] (-556.811) * [-553.963] (-552.976) (-555.473) (-552.930) -- 0:00:16
728000 -- (-554.924) (-553.992) [-553.878] (-554.075) * (-554.577) [-554.714] (-558.640) (-553.577) -- 0:00:16
728500 -- (-555.617) (-556.426) [-553.930] (-555.025) * (-554.785) [-553.795] (-556.510) (-554.600) -- 0:00:16
729000 -- (-554.127) [-555.042] (-554.721) (-555.634) * [-556.315] (-557.931) (-554.802) (-554.596) -- 0:00:15
729500 -- (-554.662) (-556.236) (-554.793) [-554.056] * [-554.667] (-555.461) (-553.695) (-556.021) -- 0:00:15
730000 -- (-554.417) (-554.838) [-554.948] (-554.564) * (-556.552) (-556.673) [-555.493] (-560.016) -- 0:00:15
Average standard deviation of split frequencies: 0.012621
730500 -- (-557.178) [-553.464] (-554.343) (-554.355) * (-552.873) [-553.332] (-554.020) (-558.493) -- 0:00:15
731000 -- (-557.495) [-553.230] (-553.299) (-554.377) * (-553.630) (-558.325) [-555.742] (-558.395) -- 0:00:15
731500 -- (-556.597) (-553.573) [-554.685] (-554.641) * (-553.963) (-554.366) (-553.602) [-553.890] -- 0:00:15
732000 -- [-559.107] (-553.629) (-557.644) (-555.034) * (-553.262) (-559.895) [-554.580] (-557.235) -- 0:00:15
732500 -- (-558.794) [-554.980] (-560.595) (-555.569) * [-555.177] (-553.766) (-559.630) (-555.817) -- 0:00:15
733000 -- (-553.681) [-554.806] (-555.638) (-554.366) * (-557.295) [-554.364] (-554.135) (-556.468) -- 0:00:15
733500 -- (-556.454) (-554.896) [-554.153] (-554.339) * [-556.813] (-554.427) (-555.385) (-560.600) -- 0:00:15
734000 -- [-556.419] (-553.969) (-554.063) (-554.024) * (-553.771) [-553.661] (-559.227) (-554.034) -- 0:00:15
734500 -- (-558.093) [-553.103] (-555.646) (-556.026) * (-555.917) (-554.706) (-561.852) [-561.650] -- 0:00:15
735000 -- [-558.503] (-554.957) (-555.980) (-554.671) * [-556.774] (-553.405) (-556.152) (-555.321) -- 0:00:15
Average standard deviation of split frequencies: 0.013050
735500 -- (-556.133) (-553.670) [-556.547] (-554.588) * [-553.736] (-553.531) (-553.489) (-555.756) -- 0:00:15
736000 -- (-554.753) (-553.831) [-554.259] (-555.921) * (-559.746) (-553.699) [-553.237] (-554.468) -- 0:00:15
736500 -- (-553.835) (-556.619) (-554.289) [-555.010] * (-555.568) [-556.132] (-553.238) (-557.697) -- 0:00:15
737000 -- (-553.919) [-555.931] (-555.800) (-554.823) * (-554.335) (-555.818) [-553.646] (-553.378) -- 0:00:15
737500 -- (-557.671) (-553.805) [-552.991] (-554.918) * [-557.062] (-554.272) (-553.900) (-554.482) -- 0:00:15
738000 -- (-559.630) [-553.679] (-554.887) (-553.253) * (-556.854) [-553.418] (-556.744) (-554.908) -- 0:00:15
738500 -- (-554.894) (-554.207) (-554.887) [-553.268] * [-554.496] (-557.247) (-556.745) (-553.851) -- 0:00:15
739000 -- (-555.346) [-553.069] (-555.348) (-553.317) * (-556.759) (-553.062) (-555.744) [-554.021] -- 0:00:15
739500 -- (-556.367) [-553.390] (-556.176) (-555.257) * (-558.814) [-555.117] (-553.888) (-558.733) -- 0:00:15
740000 -- (-553.577) (-557.833) [-555.783] (-553.607) * (-555.657) (-554.959) (-553.486) [-554.733] -- 0:00:15
Average standard deviation of split frequencies: 0.012769
740500 -- (-555.675) (-556.806) (-554.397) [-555.009] * (-553.764) (-556.572) (-554.468) [-553.133] -- 0:00:15
741000 -- (-553.178) (-555.614) [-553.543] (-556.419) * (-554.775) (-554.480) [-554.187] (-555.928) -- 0:00:15
741500 -- [-553.145] (-553.610) (-553.673) (-558.382) * (-554.109) [-554.207] (-554.869) (-554.408) -- 0:00:15
742000 -- (-554.650) (-555.837) [-560.111] (-557.075) * (-557.960) [-553.557] (-554.993) (-554.441) -- 0:00:15
742500 -- (-559.385) (-554.037) [-555.711] (-552.790) * (-554.376) (-553.558) [-554.276] (-555.572) -- 0:00:15
743000 -- (-556.770) (-554.332) (-559.328) [-554.451] * (-553.511) (-554.442) [-553.218] (-555.852) -- 0:00:15
743500 -- (-556.822) (-555.093) (-558.968) [-555.005] * (-558.501) [-552.933] (-553.188) (-553.984) -- 0:00:15
744000 -- (-555.415) (-554.361) (-553.722) [-559.889] * (-557.553) (-552.913) [-556.788] (-557.256) -- 0:00:15
744500 -- [-553.979] (-554.131) (-554.271) (-555.734) * (-557.138) [-553.532] (-555.115) (-554.008) -- 0:00:15
745000 -- [-554.281] (-554.375) (-555.921) (-556.469) * (-552.649) [-553.288] (-555.080) (-554.377) -- 0:00:15
Average standard deviation of split frequencies: 0.012717
745500 -- (-568.203) (-554.728) [-553.385] (-557.614) * (-553.702) [-554.573] (-553.253) (-561.352) -- 0:00:15
746000 -- (-557.542) (-554.569) [-556.587] (-556.006) * (-553.722) [-552.843] (-553.712) (-557.656) -- 0:00:14
746500 -- (-560.203) (-557.604) (-554.040) [-555.105] * (-557.027) [-556.147] (-555.722) (-559.255) -- 0:00:14
747000 -- [-553.050] (-557.381) (-555.656) (-554.098) * (-555.931) [-552.840] (-557.598) (-557.399) -- 0:00:14
747500 -- (-554.715) (-555.213) (-554.068) [-554.494] * (-554.051) (-559.316) (-557.332) [-553.280] -- 0:00:14
748000 -- (-554.805) [-554.892] (-552.943) (-554.879) * (-559.158) (-555.587) [-558.458] (-552.556) -- 0:00:14
748500 -- (-556.885) (-556.882) (-557.274) [-555.864] * (-553.951) (-560.584) [-553.420] (-555.778) -- 0:00:14
749000 -- (-556.049) (-553.528) (-555.543) [-555.736] * [-554.968] (-556.274) (-558.792) (-557.253) -- 0:00:14
749500 -- (-554.440) (-556.164) (-553.547) [-556.035] * (-557.306) [-557.238] (-556.246) (-554.429) -- 0:00:14
750000 -- [-556.640] (-553.339) (-553.525) (-557.302) * (-554.251) (-558.843) (-553.772) [-554.497] -- 0:00:14
Average standard deviation of split frequencies: 0.013305
750500 -- [-553.741] (-554.218) (-554.898) (-554.296) * (-554.174) (-557.096) (-556.311) [-554.473] -- 0:00:14
751000 -- [-555.346] (-554.943) (-555.279) (-554.328) * (-555.327) [-553.868] (-557.740) (-553.944) -- 0:00:14
751500 -- (-553.967) (-555.012) [-554.474] (-553.979) * (-559.156) (-553.428) (-554.519) [-556.148] -- 0:00:14
752000 -- (-559.532) [-555.309] (-552.794) (-554.564) * (-554.234) (-553.725) [-554.406] (-557.538) -- 0:00:14
752500 -- (-555.158) [-556.356] (-556.398) (-554.301) * [-556.295] (-554.177) (-555.367) (-554.424) -- 0:00:14
753000 -- (-555.445) [-552.939] (-555.581) (-560.145) * (-556.507) [-554.741] (-555.516) (-558.914) -- 0:00:14
753500 -- (-553.553) (-553.472) [-554.242] (-557.988) * (-553.281) [-555.233] (-554.280) (-558.282) -- 0:00:14
754000 -- (-557.764) [-555.375] (-557.576) (-555.460) * [-555.193] (-555.194) (-554.415) (-557.141) -- 0:00:14
754500 -- (-555.655) (-557.869) [-555.378] (-555.509) * [-555.581] (-553.886) (-553.716) (-554.867) -- 0:00:14
755000 -- (-553.338) (-556.136) (-554.101) [-554.553] * (-555.308) (-559.162) [-554.486] (-556.332) -- 0:00:14
Average standard deviation of split frequencies: 0.013367
755500 -- (-553.948) (-554.701) [-554.013] (-556.647) * (-557.464) (-556.405) (-554.580) [-553.713] -- 0:00:14
756000 -- (-554.873) [-553.699] (-557.248) (-557.004) * (-554.067) (-553.954) [-553.260] (-554.456) -- 0:00:14
756500 -- (-553.907) [-554.334] (-557.237) (-553.025) * [-555.553] (-554.730) (-553.385) (-555.244) -- 0:00:14
757000 -- (-552.884) (-554.465) [-554.965] (-553.632) * (-561.816) (-553.724) [-554.599] (-554.862) -- 0:00:14
757500 -- (-554.650) (-554.867) (-555.898) [-554.322] * (-562.180) [-553.555] (-556.362) (-557.019) -- 0:00:14
758000 -- (-553.291) (-555.380) (-555.586) [-554.497] * (-556.849) [-554.001] (-555.760) (-557.786) -- 0:00:14
758500 -- [-555.287] (-553.638) (-556.513) (-553.485) * (-561.910) (-557.446) [-554.321] (-555.265) -- 0:00:14
759000 -- [-554.420] (-552.764) (-556.798) (-555.167) * [-553.695] (-556.507) (-559.550) (-556.119) -- 0:00:14
759500 -- (-554.045) (-557.396) (-556.041) [-555.017] * [-556.487] (-556.076) (-556.194) (-558.092) -- 0:00:14
760000 -- [-555.996] (-566.075) (-557.334) (-554.977) * [-553.896] (-554.890) (-555.197) (-554.384) -- 0:00:14
Average standard deviation of split frequencies: 0.013324
760500 -- (-555.917) (-553.580) [-553.409] (-558.875) * (-553.734) [-554.648] (-557.060) (-554.211) -- 0:00:14
761000 -- (-554.864) [-555.532] (-556.237) (-556.143) * (-556.907) (-554.200) (-554.114) [-554.009] -- 0:00:14
761500 -- [-554.748] (-553.791) (-556.601) (-555.879) * (-555.520) (-559.969) [-554.246] (-554.038) -- 0:00:14
762000 -- [-557.431] (-555.726) (-561.613) (-554.442) * [-556.646] (-558.315) (-554.349) (-554.735) -- 0:00:14
762500 -- [-555.626] (-554.244) (-557.843) (-555.694) * [-554.509] (-554.694) (-554.741) (-555.777) -- 0:00:14
763000 -- [-554.203] (-554.252) (-553.692) (-554.845) * (-555.045) [-554.284] (-557.916) (-554.009) -- 0:00:13
763500 -- (-555.850) (-555.267) [-557.528] (-556.366) * [-555.810] (-554.308) (-557.558) (-557.939) -- 0:00:13
764000 -- (-556.074) [-553.037] (-555.778) (-558.654) * (-554.564) [-552.868] (-555.790) (-556.259) -- 0:00:13
764500 -- (-553.286) (-557.589) (-554.459) [-560.730] * (-555.409) (-554.205) [-554.547] (-552.967) -- 0:00:13
765000 -- (-556.908) (-556.387) (-555.316) [-555.727] * [-555.715] (-554.288) (-553.640) (-556.114) -- 0:00:13
Average standard deviation of split frequencies: 0.013193
765500 -- (-555.595) (-554.245) (-557.672) [-556.458] * (-554.999) (-554.582) (-555.599) [-555.856] -- 0:00:13
766000 -- [-556.163] (-555.058) (-554.680) (-559.583) * (-561.830) [-553.234] (-558.060) (-555.070) -- 0:00:13
766500 -- (-555.364) (-555.505) (-555.904) [-554.332] * (-554.011) (-554.761) (-558.955) [-553.305] -- 0:00:13
767000 -- (-555.837) (-553.240) (-554.028) [-558.686] * (-554.830) (-554.759) (-555.489) [-554.697] -- 0:00:13
767500 -- [-554.986] (-553.577) (-559.186) (-555.269) * [-555.661] (-555.443) (-554.162) (-558.893) -- 0:00:13
768000 -- [-553.794] (-553.677) (-553.342) (-553.808) * (-555.110) (-554.215) [-553.687] (-555.969) -- 0:00:13
768500 -- [-553.579] (-554.715) (-554.023) (-553.773) * [-553.087] (-555.078) (-554.776) (-554.379) -- 0:00:13
769000 -- (-552.955) [-554.516] (-553.362) (-555.984) * [-555.705] (-556.699) (-558.391) (-554.443) -- 0:00:13
769500 -- (-555.449) [-555.898] (-554.353) (-555.175) * (-554.994) [-553.654] (-556.649) (-557.083) -- 0:00:13
770000 -- (-553.940) (-555.690) [-554.545] (-553.589) * [-556.056] (-552.756) (-556.820) (-558.956) -- 0:00:13
Average standard deviation of split frequencies: 0.012692
770500 -- [-554.720] (-553.647) (-553.345) (-554.402) * [-554.079] (-555.224) (-554.150) (-555.810) -- 0:00:13
771000 -- (-554.378) (-553.375) [-554.011] (-558.491) * (-556.534) (-554.896) [-554.803] (-554.522) -- 0:00:13
771500 -- (-553.774) (-554.186) (-559.156) [-553.576] * [-554.669] (-553.289) (-554.145) (-560.965) -- 0:00:13
772000 -- (-554.315) (-556.489) (-555.082) [-554.503] * (-557.074) (-555.437) (-553.588) [-554.206] -- 0:00:13
772500 -- (-554.253) [-554.007] (-554.215) (-553.600) * (-555.685) [-554.801] (-554.098) (-554.237) -- 0:00:13
773000 -- (-554.266) (-555.814) (-556.200) [-554.433] * (-561.906) [-555.678] (-554.492) (-554.375) -- 0:00:13
773500 -- (-558.387) [-554.207] (-555.346) (-558.851) * (-556.781) (-558.986) (-555.304) [-557.074] -- 0:00:13
774000 -- (-562.694) (-554.176) (-556.848) [-557.443] * (-555.080) [-552.857] (-553.546) (-554.045) -- 0:00:13
774500 -- (-559.296) (-553.639) [-557.401] (-557.707) * (-552.979) [-553.828] (-553.779) (-556.482) -- 0:00:13
775000 -- (-559.456) (-554.085) [-556.875] (-552.988) * (-554.784) (-558.430) (-556.176) [-557.037] -- 0:00:13
Average standard deviation of split frequencies: 0.012833
775500 -- [-554.879] (-560.363) (-555.075) (-554.056) * (-557.977) [-554.118] (-557.633) (-554.670) -- 0:00:13
776000 -- (-554.617) (-556.846) (-558.614) [-553.397] * [-559.623] (-556.996) (-555.176) (-555.433) -- 0:00:13
776500 -- (-558.074) (-555.447) [-554.459] (-554.286) * (-557.313) [-558.094] (-555.819) (-555.569) -- 0:00:13
777000 -- (-554.896) [-555.040] (-553.366) (-555.926) * (-554.843) [-553.480] (-556.315) (-553.736) -- 0:00:13
777500 -- (-555.481) (-556.422) [-554.606] (-557.011) * [-554.378] (-552.780) (-553.581) (-554.667) -- 0:00:13
778000 -- (-554.909) (-554.080) (-553.327) [-555.043] * (-554.861) (-552.845) [-553.122] (-553.508) -- 0:00:13
778500 -- (-554.294) [-553.316] (-554.006) (-554.639) * (-553.884) (-561.406) [-555.284] (-553.390) -- 0:00:13
779000 -- (-553.457) (-554.637) (-556.478) [-557.402] * (-555.137) (-556.982) (-554.366) [-556.606] -- 0:00:13
779500 -- (-557.300) [-555.664] (-559.141) (-556.537) * (-554.377) (-553.192) [-553.238] (-558.589) -- 0:00:13
780000 -- (-558.591) (-554.949) (-557.322) [-556.782] * (-558.578) (-553.723) (-555.465) [-553.642] -- 0:00:12
Average standard deviation of split frequencies: 0.012492
780500 -- (-554.290) (-555.462) (-553.717) [-553.111] * (-555.696) (-553.895) [-555.329] (-552.880) -- 0:00:12
781000 -- (-555.434) (-554.142) (-554.214) [-553.920] * (-557.357) (-553.953) (-556.352) [-553.516] -- 0:00:12
781500 -- (-555.141) [-553.053] (-557.995) (-554.498) * (-553.976) [-554.140] (-553.569) (-556.713) -- 0:00:12
782000 -- (-557.921) [-554.869] (-554.801) (-553.686) * (-556.786) (-554.256) [-554.228] (-557.401) -- 0:00:12
782500 -- (-556.604) (-553.807) (-554.847) [-554.513] * (-555.147) (-556.484) (-553.394) [-556.680] -- 0:00:12
783000 -- (-553.533) (-553.715) (-553.910) [-553.705] * (-553.372) (-556.658) [-557.783] (-555.273) -- 0:00:12
783500 -- (-553.820) [-557.623] (-553.861) (-555.150) * (-554.855) (-554.095) [-556.366] (-555.401) -- 0:00:12
784000 -- (-553.444) [-560.413] (-553.293) (-560.908) * (-557.062) [-563.745] (-559.266) (-555.756) -- 0:00:12
784500 -- (-553.781) (-559.574) [-553.944] (-555.658) * (-554.789) (-555.906) (-559.660) [-555.156] -- 0:00:12
785000 -- (-556.940) (-553.989) [-555.206] (-559.600) * (-554.449) (-557.407) (-553.980) [-552.643] -- 0:00:12
Average standard deviation of split frequencies: 0.012445
785500 -- (-557.680) (-555.436) [-553.359] (-555.591) * [-554.874] (-556.067) (-553.300) (-557.979) -- 0:00:12
786000 -- (-554.123) (-557.613) (-553.828) [-555.234] * [-554.619] (-556.466) (-553.359) (-558.168) -- 0:00:12
786500 -- [-554.576] (-554.103) (-555.162) (-555.184) * (-554.427) (-555.714) [-555.749] (-556.539) -- 0:00:12
787000 -- (-554.856) [-554.004] (-556.767) (-554.296) * (-554.900) (-555.612) (-560.032) [-553.606] -- 0:00:12
787500 -- [-553.386] (-553.636) (-553.533) (-553.600) * (-556.116) (-554.239) (-553.383) [-557.055] -- 0:00:12
788000 -- (-553.522) (-553.912) [-556.967] (-554.080) * (-554.190) (-554.583) (-556.484) [-555.953] -- 0:00:12
788500 -- (-555.523) [-553.773] (-554.433) (-554.237) * (-558.806) [-553.400] (-556.560) (-553.415) -- 0:00:12
789000 -- [-555.236] (-553.817) (-554.707) (-553.670) * (-556.131) [-555.194] (-555.102) (-554.825) -- 0:00:12
789500 -- [-554.717] (-554.582) (-554.186) (-554.859) * (-553.038) (-554.792) [-556.280] (-559.037) -- 0:00:12
790000 -- (-555.974) (-555.410) (-554.925) [-554.044] * (-554.584) (-555.114) [-557.548] (-553.651) -- 0:00:12
Average standard deviation of split frequencies: 0.012297
790500 -- (-555.406) [-554.803] (-553.955) (-557.130) * (-555.403) [-553.426] (-555.647) (-556.317) -- 0:00:12
791000 -- (-554.224) (-555.784) [-553.054] (-555.752) * [-555.072] (-553.726) (-560.459) (-556.133) -- 0:00:12
791500 -- (-553.222) [-555.781] (-555.698) (-554.081) * (-556.538) [-554.401] (-555.437) (-556.209) -- 0:00:12
792000 -- [-554.350] (-556.496) (-555.404) (-553.970) * (-554.495) [-554.122] (-556.002) (-553.805) -- 0:00:12
792500 -- (-555.518) (-557.596) [-554.444] (-554.894) * [-554.950] (-554.264) (-555.146) (-552.924) -- 0:00:12
793000 -- (-556.963) [-555.278] (-554.045) (-553.437) * (-553.720) (-553.178) [-555.131] (-554.996) -- 0:00:12
793500 -- (-554.998) (-556.580) (-554.317) [-552.848] * [-553.551] (-555.948) (-555.042) (-557.688) -- 0:00:12
794000 -- (-556.103) [-553.847] (-555.053) (-555.031) * (-553.122) (-555.424) (-555.530) [-553.397] -- 0:00:12
794500 -- [-555.693] (-556.430) (-555.741) (-556.010) * (-555.205) [-555.484] (-557.021) (-554.732) -- 0:00:12
795000 -- [-553.383] (-553.204) (-554.125) (-560.674) * (-554.488) (-554.253) (-557.131) [-554.672] -- 0:00:12
Average standard deviation of split frequencies: 0.012177
795500 -- (-556.950) [-553.594] (-556.141) (-554.104) * (-553.033) (-554.892) [-554.917] (-561.443) -- 0:00:12
796000 -- (-555.098) [-554.565] (-553.988) (-555.646) * (-558.176) (-554.445) (-555.115) [-556.614] -- 0:00:12
796500 -- (-555.025) [-557.146] (-555.823) (-556.211) * (-555.255) [-554.040] (-557.662) (-553.549) -- 0:00:12
797000 -- (-556.502) (-555.895) [-555.627] (-554.016) * (-552.826) (-554.752) (-557.523) [-554.986] -- 0:00:11
797500 -- (-554.617) (-557.466) (-553.936) [-553.733] * (-552.986) [-554.619] (-555.374) (-554.374) -- 0:00:11
798000 -- (-554.970) (-556.085) (-553.557) [-553.464] * (-555.509) (-560.189) [-556.954] (-553.807) -- 0:00:11
798500 -- [-553.486] (-555.946) (-553.598) (-554.077) * (-554.840) (-553.396) [-553.960] (-553.684) -- 0:00:11
799000 -- (-556.189) (-558.045) [-558.144] (-555.075) * (-555.613) [-554.525] (-553.526) (-556.064) -- 0:00:11
799500 -- [-554.708] (-556.355) (-556.594) (-556.949) * (-556.502) [-560.911] (-554.085) (-555.732) -- 0:00:11
800000 -- [-555.253] (-555.232) (-555.841) (-557.394) * (-555.442) [-557.477] (-554.351) (-559.459) -- 0:00:11
Average standard deviation of split frequencies: 0.012438
800500 -- (-557.184) (-557.460) [-555.180] (-554.183) * (-555.474) (-559.476) (-555.472) [-553.336] -- 0:00:11
801000 -- [-556.405] (-554.669) (-553.279) (-555.469) * [-554.648] (-555.099) (-555.289) (-556.819) -- 0:00:11
801500 -- (-553.107) (-553.837) (-557.154) [-555.185] * (-553.668) (-554.057) (-556.090) [-556.254] -- 0:00:11
802000 -- [-554.753] (-555.406) (-558.141) (-554.696) * (-553.817) [-555.678] (-567.321) (-555.990) -- 0:00:11
802500 -- [-556.463] (-555.895) (-558.696) (-554.410) * (-553.426) (-554.167) [-556.240] (-555.971) -- 0:00:11
803000 -- (-554.727) (-554.206) (-556.293) [-554.550] * (-553.163) (-555.667) (-555.176) [-554.120] -- 0:00:11
803500 -- (-555.934) (-553.734) [-554.200] (-553.590) * [-553.530] (-555.142) (-558.224) (-553.397) -- 0:00:11
804000 -- (-556.994) [-555.208] (-554.002) (-553.331) * [-556.313] (-555.054) (-557.232) (-556.170) -- 0:00:11
804500 -- (-559.095) [-555.650] (-554.718) (-554.593) * (-556.005) (-559.588) [-556.867] (-555.359) -- 0:00:11
805000 -- (-555.832) [-554.987] (-558.724) (-553.647) * (-556.487) (-561.125) [-553.628] (-555.547) -- 0:00:11
Average standard deviation of split frequencies: 0.012721
805500 -- (-553.608) (-554.955) [-554.635] (-555.107) * (-557.854) (-554.161) [-555.320] (-555.975) -- 0:00:11
806000 -- (-553.906) [-556.404] (-553.664) (-553.645) * (-555.621) [-553.403] (-553.808) (-555.074) -- 0:00:11
806500 -- (-553.759) (-556.640) (-558.991) [-552.689] * (-556.195) (-557.280) (-561.119) [-555.508] -- 0:00:11
807000 -- (-555.514) (-558.190) (-558.612) [-552.696] * (-554.730) (-560.489) (-561.530) [-554.188] -- 0:00:11
807500 -- [-556.723] (-553.342) (-555.785) (-556.242) * (-555.841) (-555.505) (-557.391) [-554.516] -- 0:00:11
808000 -- (-554.596) (-559.427) (-555.153) [-555.540] * (-553.228) [-554.514] (-556.029) (-553.545) -- 0:00:11
808500 -- (-554.501) [-555.211] (-554.266) (-555.975) * (-558.705) [-554.578] (-558.662) (-558.292) -- 0:00:11
809000 -- [-557.089] (-553.717) (-554.911) (-554.956) * [-556.247] (-558.924) (-556.507) (-555.821) -- 0:00:11
809500 -- (-553.160) [-558.126] (-557.438) (-554.470) * (-558.953) (-554.372) (-556.956) [-554.635] -- 0:00:11
810000 -- [-554.837] (-558.787) (-554.795) (-553.268) * (-558.681) (-554.326) [-555.398] (-554.651) -- 0:00:11
Average standard deviation of split frequencies: 0.012466
810500 -- (-555.748) (-559.308) [-554.062] (-554.581) * (-562.816) (-555.910) [-554.780] (-554.163) -- 0:00:11
811000 -- (-555.718) (-553.278) [-554.219] (-553.806) * (-554.157) (-557.814) [-554.235] (-556.833) -- 0:00:11
811500 -- (-555.213) (-554.170) [-554.854] (-555.198) * (-556.688) (-555.060) [-557.573] (-556.121) -- 0:00:11
812000 -- (-556.996) (-553.169) (-553.165) [-554.622] * (-557.463) [-556.880] (-555.854) (-555.803) -- 0:00:11
812500 -- (-556.983) (-553.503) (-553.518) [-555.625] * (-561.323) [-553.597] (-555.295) (-553.171) -- 0:00:11
813000 -- [-555.785] (-555.047) (-556.014) (-556.045) * [-554.593] (-554.050) (-556.930) (-553.881) -- 0:00:11
813500 -- [-554.339] (-557.275) (-553.828) (-555.549) * (-552.768) (-553.985) (-557.776) [-554.404] -- 0:00:11
814000 -- (-554.320) (-555.466) [-553.587] (-560.587) * [-553.160] (-554.019) (-560.118) (-556.084) -- 0:00:10
814500 -- [-556.386] (-555.137) (-554.885) (-559.114) * [-552.843] (-554.908) (-554.656) (-554.062) -- 0:00:10
815000 -- [-556.778] (-558.391) (-560.669) (-556.102) * [-552.843] (-555.948) (-555.243) (-553.946) -- 0:00:10
Average standard deviation of split frequencies: 0.012709
815500 -- (-554.093) (-555.332) [-553.888] (-558.285) * [-555.402] (-556.288) (-554.371) (-553.525) -- 0:00:10
816000 -- (-556.952) (-555.958) [-552.683] (-554.819) * (-553.392) (-554.991) [-554.949] (-553.778) -- 0:00:10
816500 -- [-554.545] (-559.057) (-554.710) (-554.644) * (-553.476) (-555.276) [-554.568] (-553.572) -- 0:00:10
817000 -- (-557.051) (-556.152) (-555.464) [-555.072] * (-554.809) (-554.278) (-554.239) [-556.626] -- 0:00:10
817500 -- (-556.111) [-552.702] (-555.057) (-554.558) * (-553.698) (-561.350) (-555.311) [-553.912] -- 0:00:10
818000 -- (-556.652) [-552.855] (-556.230) (-553.908) * (-554.345) (-555.559) [-552.908] (-553.985) -- 0:00:10
818500 -- (-555.603) (-555.856) [-557.782] (-553.288) * (-552.657) [-554.879] (-562.029) (-554.279) -- 0:00:10
819000 -- (-553.915) (-556.007) [-555.343] (-554.069) * (-557.887) [-553.314] (-554.614) (-554.492) -- 0:00:10
819500 -- (-554.468) [-554.314] (-555.322) (-555.365) * (-555.039) (-553.114) [-556.957] (-556.324) -- 0:00:10
820000 -- (-555.444) (-555.207) (-557.375) [-554.650] * (-553.698) (-556.875) [-554.549] (-553.459) -- 0:00:10
Average standard deviation of split frequencies: 0.012817
820500 -- (-556.138) (-560.257) [-554.985] (-554.442) * (-554.999) (-555.381) (-559.553) [-557.059] -- 0:00:10
821000 -- [-553.758] (-555.387) (-554.055) (-553.893) * (-555.478) (-556.443) (-556.281) [-559.831] -- 0:00:10
821500 -- (-555.462) (-555.286) [-554.172] (-556.354) * (-555.291) [-557.935] (-561.832) (-558.918) -- 0:00:10
822000 -- (-553.724) (-553.762) (-560.762) [-553.826] * (-556.424) (-555.085) [-559.737] (-558.997) -- 0:00:10
822500 -- (-553.151) [-552.902] (-561.431) (-556.135) * (-555.731) [-552.793] (-555.402) (-553.744) -- 0:00:10
823000 -- [-555.542] (-555.815) (-555.118) (-556.653) * (-555.066) [-552.893] (-553.704) (-553.378) -- 0:00:10
823500 -- (-554.721) (-555.502) (-555.460) [-554.596] * [-555.461] (-554.928) (-554.200) (-555.228) -- 0:00:10
824000 -- [-554.032] (-555.065) (-559.811) (-554.465) * (-554.875) [-557.297] (-553.818) (-555.436) -- 0:00:10
824500 -- (-553.793) (-553.914) (-555.994) [-554.254] * [-553.825] (-554.056) (-555.102) (-554.358) -- 0:00:10
825000 -- (-553.856) (-554.773) [-555.308] (-553.617) * (-555.249) [-555.321] (-556.171) (-554.092) -- 0:00:10
Average standard deviation of split frequencies: 0.012377
825500 -- [-552.864] (-554.469) (-553.505) (-554.724) * (-554.514) (-555.964) (-554.170) [-553.631] -- 0:00:10
826000 -- (-553.939) [-555.127] (-553.527) (-558.302) * [-554.769] (-552.692) (-555.975) (-553.564) -- 0:00:10
826500 -- (-553.628) [-554.147] (-555.174) (-556.940) * (-555.407) (-554.488) [-557.736] (-557.086) -- 0:00:10
827000 -- (-553.961) [-555.268] (-554.381) (-556.349) * (-554.446) [-553.794] (-561.861) (-555.114) -- 0:00:10
827500 -- (-553.576) (-554.727) [-554.797] (-556.423) * (-557.331) (-553.606) [-560.784] (-556.966) -- 0:00:10
828000 -- [-557.426] (-556.000) (-558.616) (-558.451) * (-555.572) [-553.881] (-554.735) (-554.231) -- 0:00:10
828500 -- (-554.351) [-556.673] (-555.427) (-565.199) * [-554.172] (-553.284) (-556.266) (-553.943) -- 0:00:10
829000 -- (-553.270) (-554.848) [-554.521] (-557.898) * (-555.920) [-553.230] (-554.915) (-559.930) -- 0:00:10
829500 -- (-555.749) (-554.843) (-557.121) [-554.770] * (-555.273) (-556.956) [-553.560] (-553.890) -- 0:00:10
830000 -- (-554.623) (-555.870) (-558.621) [-553.252] * (-556.854) [-556.787] (-552.665) (-554.050) -- 0:00:10
Average standard deviation of split frequencies: 0.012521
830500 -- (-552.777) (-554.162) (-555.689) [-554.018] * (-555.393) (-556.039) [-556.083] (-552.832) -- 0:00:10
831000 -- (-556.260) (-553.864) [-553.159] (-552.842) * (-555.318) (-561.482) (-555.070) [-555.293] -- 0:00:09
831500 -- (-556.332) (-554.888) (-558.289) [-553.708] * [-557.117] (-554.671) (-554.128) (-553.440) -- 0:00:09
832000 -- (-556.150) (-554.863) [-555.014] (-553.443) * (-555.832) (-555.210) (-553.762) [-555.829] -- 0:00:09
832500 -- (-556.895) [-555.077] (-554.897) (-555.320) * (-554.671) (-553.899) [-553.068] (-554.341) -- 0:00:09
833000 -- (-557.323) (-557.102) (-555.029) [-553.397] * (-556.663) (-560.771) (-552.732) [-555.537] -- 0:00:09
833500 -- (-557.424) [-553.402] (-555.686) (-554.015) * (-557.068) (-556.719) (-553.500) [-554.454] -- 0:00:09
834000 -- (-554.279) [-554.362] (-553.101) (-556.093) * (-554.428) (-554.359) (-554.171) [-553.149] -- 0:00:09
834500 -- (-554.723) [-553.354] (-555.313) (-558.733) * [-553.553] (-558.118) (-553.799) (-553.487) -- 0:00:09
835000 -- (-554.808) [-553.018] (-556.544) (-553.878) * (-553.575) (-553.677) [-553.328] (-555.227) -- 0:00:09
Average standard deviation of split frequencies: 0.012229
835500 -- (-557.773) (-555.428) (-555.761) [-555.578] * [-553.718] (-555.474) (-553.600) (-560.274) -- 0:00:09
836000 -- [-557.870] (-553.630) (-554.702) (-555.433) * (-556.653) (-555.233) [-555.107] (-554.789) -- 0:00:09
836500 -- (-555.374) (-552.733) (-556.468) [-552.797] * (-552.836) [-556.625] (-557.383) (-555.636) -- 0:00:09
837000 -- (-553.238) [-555.874] (-554.864) (-557.954) * (-552.748) (-555.100) (-553.993) [-553.503] -- 0:00:09
837500 -- [-553.138] (-555.057) (-556.788) (-553.676) * [-553.985] (-555.061) (-555.626) (-553.829) -- 0:00:09
838000 -- (-553.364) (-553.505) (-554.798) [-554.409] * (-556.277) (-558.141) (-555.701) [-555.840] -- 0:00:09
838500 -- (-554.598) (-556.934) (-555.475) [-560.141] * (-555.390) [-553.461] (-558.198) (-554.419) -- 0:00:09
839000 -- [-554.910] (-556.916) (-557.754) (-556.793) * (-560.241) (-552.960) (-556.817) [-553.346] -- 0:00:09
839500 -- (-553.991) [-556.304] (-554.642) (-557.530) * (-557.169) (-553.226) (-554.862) [-554.048] -- 0:00:09
840000 -- (-554.200) (-555.277) [-552.924] (-555.917) * (-554.926) [-556.255] (-558.431) (-555.050) -- 0:00:09
Average standard deviation of split frequencies: 0.012372
840500 -- (-554.259) [-553.621] (-555.762) (-553.198) * (-554.130) (-554.611) (-554.598) [-555.638] -- 0:00:09
841000 -- (-554.514) [-554.430] (-558.067) (-552.683) * (-556.978) (-555.436) (-557.734) [-554.968] -- 0:00:09
841500 -- (-553.236) (-556.268) [-553.978] (-553.567) * (-557.705) [-553.185] (-556.150) (-555.421) -- 0:00:09
842000 -- [-553.517] (-559.989) (-555.103) (-553.591) * (-555.701) [-555.752] (-557.623) (-555.352) -- 0:00:09
842500 -- (-554.382) (-555.642) [-556.323] (-553.845) * (-555.640) (-558.535) [-557.489] (-555.479) -- 0:00:09
843000 -- (-553.773) (-558.273) (-560.203) [-553.085] * (-557.923) (-560.630) (-555.253) [-556.290] -- 0:00:09
843500 -- (-558.433) (-555.929) (-555.941) [-552.727] * (-557.593) (-553.808) [-553.536] (-556.888) -- 0:00:09
844000 -- [-555.602] (-553.829) (-557.636) (-554.595) * (-556.342) (-555.913) [-554.472] (-553.553) -- 0:00:09
844500 -- (-556.359) (-556.562) (-553.978) [-554.884] * (-553.344) (-556.575) [-555.948] (-553.673) -- 0:00:09
845000 -- (-556.595) [-555.686] (-555.886) (-557.077) * [-555.937] (-555.904) (-553.432) (-554.048) -- 0:00:09
Average standard deviation of split frequencies: 0.012433
845500 -- (-556.219) [-552.943] (-555.912) (-558.569) * [-555.008] (-556.812) (-556.311) (-555.003) -- 0:00:09
846000 -- [-558.382] (-554.425) (-554.005) (-555.717) * (-554.312) [-558.676] (-555.958) (-556.210) -- 0:00:09
846500 -- (-554.680) (-554.197) (-553.770) [-560.457] * (-555.130) (-554.243) (-557.409) [-553.293] -- 0:00:09
847000 -- [-554.739] (-557.161) (-553.780) (-555.190) * (-555.508) (-555.538) (-553.737) [-554.873] -- 0:00:09
847500 -- [-555.562] (-555.673) (-565.347) (-556.556) * [-554.962] (-555.436) (-552.861) (-554.513) -- 0:00:08
848000 -- (-557.616) (-554.078) [-559.318] (-555.131) * (-554.802) (-555.614) [-555.370] (-557.641) -- 0:00:08
848500 -- (-554.570) (-554.121) (-553.991) [-555.000] * [-554.927] (-557.451) (-553.232) (-553.837) -- 0:00:08
849000 -- (-553.793) (-554.372) [-554.528] (-553.735) * (-555.268) [-555.573] (-553.429) (-555.769) -- 0:00:08
849500 -- [-555.302] (-566.230) (-554.636) (-553.468) * [-555.436] (-554.670) (-556.009) (-553.849) -- 0:00:08
850000 -- (-558.792) (-555.781) [-555.322] (-553.791) * (-554.712) (-556.257) [-555.597] (-553.873) -- 0:00:08
Average standard deviation of split frequencies: 0.012295
850500 -- (-556.146) [-554.754] (-555.377) (-557.794) * (-553.299) (-554.343) [-554.767] (-555.847) -- 0:00:08
851000 -- (-553.784) (-557.167) (-554.111) [-555.262] * (-553.592) [-555.314] (-557.085) (-553.456) -- 0:00:08
851500 -- (-554.681) (-560.017) (-554.481) [-553.821] * (-554.016) [-554.918] (-558.784) (-556.226) -- 0:00:08
852000 -- (-553.453) (-556.678) [-554.840] (-556.370) * (-554.908) (-555.407) (-554.121) [-554.835] -- 0:00:08
852500 -- (-554.359) [-554.000] (-554.118) (-556.142) * [-556.517] (-554.541) (-553.136) (-559.603) -- 0:00:08
853000 -- [-555.569] (-553.363) (-553.002) (-555.905) * (-554.514) (-552.942) [-553.258] (-557.655) -- 0:00:08
853500 -- (-553.585) (-552.687) [-555.361] (-556.755) * (-554.461) (-553.357) [-555.229] (-554.185) -- 0:00:08
854000 -- (-558.314) (-559.389) [-554.027] (-554.709) * (-556.975) (-559.780) [-554.167] (-554.177) -- 0:00:08
854500 -- (-556.692) (-554.250) (-554.568) [-557.531] * [-555.268] (-554.498) (-554.394) (-553.738) -- 0:00:08
855000 -- (-554.796) (-556.129) [-554.574] (-558.945) * (-559.419) [-554.053] (-555.912) (-554.846) -- 0:00:08
Average standard deviation of split frequencies: 0.012253
855500 -- (-560.937) [-553.613] (-552.785) (-554.690) * (-556.372) (-555.148) [-558.909] (-556.284) -- 0:00:08
856000 -- [-559.415] (-555.113) (-554.084) (-554.038) * (-555.456) [-553.266] (-557.833) (-556.466) -- 0:00:08
856500 -- (-555.873) [-557.626] (-559.451) (-553.541) * (-560.872) (-556.328) [-555.817] (-554.624) -- 0:00:08
857000 -- (-553.646) (-554.206) (-556.007) [-553.768] * (-556.298) (-554.621) [-558.019] (-557.820) -- 0:00:08
857500 -- [-554.836] (-555.035) (-555.760) (-554.248) * (-555.572) (-554.419) (-554.954) [-554.974] -- 0:00:08
858000 -- (-558.190) [-553.056] (-557.176) (-557.067) * (-553.843) (-554.114) (-553.722) [-555.052] -- 0:00:08
858500 -- [-554.496] (-553.919) (-553.240) (-555.761) * [-554.496] (-557.342) (-553.247) (-555.053) -- 0:00:08
859000 -- (-553.771) (-554.256) (-555.475) [-554.470] * (-554.997) (-554.852) (-553.117) [-554.691] -- 0:00:08
859500 -- (-554.058) (-553.803) (-555.802) [-552.864] * [-558.604] (-554.812) (-559.642) (-556.563) -- 0:00:08
860000 -- (-555.434) (-556.074) [-555.823] (-554.375) * (-559.169) (-555.315) [-554.075] (-553.218) -- 0:00:08
Average standard deviation of split frequencies: 0.012187
860500 -- (-557.011) (-556.788) (-555.218) [-554.184] * [-553.570] (-554.849) (-555.641) (-556.339) -- 0:00:08
861000 -- (-557.110) (-556.147) [-556.343] (-553.626) * (-555.672) [-553.257] (-557.229) (-556.654) -- 0:00:08
861500 -- (-554.280) (-555.930) [-554.043] (-557.297) * (-552.716) [-553.552] (-556.939) (-557.525) -- 0:00:08
862000 -- (-555.410) (-556.641) (-553.775) [-554.165] * (-554.314) (-554.180) [-554.086] (-558.194) -- 0:00:08
862500 -- (-553.870) [-555.793] (-560.032) (-554.988) * (-553.932) [-554.969] (-554.355) (-555.308) -- 0:00:08
863000 -- (-552.897) (-555.075) [-555.113] (-555.438) * [-553.404] (-554.404) (-554.258) (-554.517) -- 0:00:08
863500 -- (-553.818) [-554.433] (-553.692) (-556.766) * [-556.665] (-555.078) (-554.967) (-554.123) -- 0:00:08
864000 -- (-555.627) (-556.142) [-554.019] (-557.708) * [-553.922] (-561.902) (-554.106) (-556.150) -- 0:00:08
864500 -- (-558.843) [-555.452] (-554.587) (-556.246) * (-554.223) (-555.782) (-553.274) [-553.434] -- 0:00:07
865000 -- (-555.566) (-554.242) [-556.355] (-554.583) * (-553.711) [-557.433] (-555.248) (-556.543) -- 0:00:07
Average standard deviation of split frequencies: 0.012146
865500 -- (-556.875) [-552.735] (-557.851) (-552.912) * [-553.070] (-556.918) (-553.842) (-555.758) -- 0:00:07
866000 -- (-555.355) [-553.641] (-556.114) (-553.647) * (-554.526) [-554.955] (-553.973) (-557.156) -- 0:00:07
866500 -- (-558.404) [-554.908] (-556.443) (-555.049) * (-556.088) (-556.808) (-555.961) [-553.906] -- 0:00:07
867000 -- (-559.726) [-556.828] (-560.285) (-555.359) * (-554.854) (-554.563) (-557.302) [-553.987] -- 0:00:07
867500 -- (-555.679) (-554.878) [-553.404] (-553.977) * (-555.843) [-554.153] (-553.897) (-557.654) -- 0:00:07
868000 -- (-554.883) [-557.256] (-552.846) (-553.388) * [-554.089] (-557.640) (-556.795) (-555.231) -- 0:00:07
868500 -- (-560.241) [-556.811] (-555.454) (-553.827) * (-554.417) (-556.231) (-557.198) [-554.908] -- 0:00:07
869000 -- [-553.176] (-554.398) (-553.579) (-559.176) * [-554.769] (-555.987) (-553.788) (-555.318) -- 0:00:07
869500 -- (-553.333) (-555.933) (-557.030) [-557.743] * (-554.941) (-559.032) (-553.410) [-553.849] -- 0:00:07
870000 -- (-553.905) [-559.980] (-554.632) (-554.795) * [-553.556] (-556.002) (-553.831) (-553.697) -- 0:00:07
Average standard deviation of split frequencies: 0.012656
870500 -- (-553.619) (-553.532) [-555.180] (-560.096) * [-555.055] (-555.610) (-555.173) (-555.302) -- 0:00:07
871000 -- [-555.704] (-553.116) (-554.762) (-554.937) * (-554.196) [-553.325] (-555.531) (-555.813) -- 0:00:07
871500 -- [-554.578] (-554.159) (-555.277) (-556.650) * [-554.318] (-554.443) (-553.429) (-555.476) -- 0:00:07
872000 -- [-556.175] (-555.007) (-555.187) (-558.859) * (-553.129) (-558.271) [-553.741] (-556.944) -- 0:00:07
872500 -- (-555.843) (-555.254) (-554.737) [-553.269] * (-554.165) (-556.319) (-557.094) [-558.754] -- 0:00:07
873000 -- (-555.312) (-557.489) [-555.136] (-556.302) * (-554.967) (-556.022) [-555.050] (-555.999) -- 0:00:07
873500 -- (-553.592) [-555.949] (-555.212) (-557.732) * (-556.888) (-556.276) [-552.758] (-558.810) -- 0:00:07
874000 -- (-554.076) (-554.226) (-554.024) [-559.206] * (-554.925) [-554.335] (-553.669) (-554.390) -- 0:00:07
874500 -- [-556.668] (-556.237) (-556.804) (-559.055) * (-553.701) (-557.532) (-554.463) [-552.874] -- 0:00:07
875000 -- (-556.105) (-553.699) (-554.863) [-559.883] * (-557.099) [-554.854] (-555.347) (-554.795) -- 0:00:07
Average standard deviation of split frequencies: 0.012377
875500 -- [-554.767] (-554.282) (-555.481) (-560.301) * (-555.076) (-554.019) (-555.957) [-554.213] -- 0:00:07
876000 -- [-557.535] (-553.648) (-555.751) (-555.210) * (-553.598) (-556.302) (-555.354) [-554.276] -- 0:00:07
876500 -- [-556.598] (-556.357) (-553.293) (-554.510) * (-558.280) (-555.139) [-557.307] (-554.014) -- 0:00:07
877000 -- (-555.689) [-555.658] (-553.970) (-554.808) * (-559.281) (-555.641) [-556.031] (-556.746) -- 0:00:07
877500 -- (-553.714) [-553.844] (-555.584) (-558.159) * (-555.129) [-554.211] (-553.857) (-555.579) -- 0:00:07
878000 -- (-555.781) (-554.855) (-554.217) [-553.500] * (-555.116) (-554.025) [-558.435] (-556.558) -- 0:00:07
878500 -- (-556.987) (-555.400) [-554.339] (-552.936) * [-553.987] (-553.731) (-557.123) (-557.512) -- 0:00:07
879000 -- (-554.222) (-558.441) (-553.579) [-557.714] * (-557.764) [-556.559] (-555.866) (-559.855) -- 0:00:07
879500 -- [-555.197] (-555.668) (-553.885) (-554.548) * [-554.965] (-555.226) (-553.980) (-560.583) -- 0:00:07
880000 -- (-556.251) (-555.818) [-553.114] (-555.555) * (-553.963) (-553.580) (-558.017) [-553.265] -- 0:00:07
Average standard deviation of split frequencies: 0.012044
880500 -- [-553.580] (-554.941) (-559.765) (-555.852) * (-557.608) [-555.002] (-555.172) (-557.152) -- 0:00:07
881000 -- (-554.286) [-553.269] (-554.151) (-556.509) * (-554.447) [-553.529] (-560.294) (-555.301) -- 0:00:07
881500 -- (-554.086) (-558.200) (-554.638) [-555.242] * (-555.262) (-558.407) (-558.409) [-553.299] -- 0:00:06
882000 -- [-554.731] (-555.040) (-553.983) (-556.184) * (-554.863) (-556.778) [-554.339] (-554.485) -- 0:00:06
882500 -- (-559.160) [-555.521] (-555.369) (-556.561) * (-553.116) [-554.976] (-557.626) (-555.798) -- 0:00:06
883000 -- (-556.767) (-553.178) [-553.401] (-556.999) * (-556.409) (-555.330) (-553.477) [-554.069] -- 0:00:06
883500 -- (-553.006) (-555.407) [-555.001] (-554.712) * (-556.146) [-558.722] (-553.459) (-557.394) -- 0:00:06
884000 -- (-552.603) (-554.258) (-556.151) [-554.542] * (-555.154) [-556.086] (-555.446) (-557.946) -- 0:00:06
884500 -- (-553.609) (-555.109) (-553.467) [-553.229] * [-555.016] (-557.298) (-557.277) (-553.735) -- 0:00:06
885000 -- (-555.973) (-554.497) (-552.899) [-556.915] * (-558.018) (-553.522) (-555.555) [-553.034] -- 0:00:06
Average standard deviation of split frequencies: 0.012071
885500 -- (-556.758) (-554.049) (-556.073) [-557.432] * (-561.090) (-554.468) [-553.900] (-553.029) -- 0:00:06
886000 -- [-553.142] (-554.340) (-557.411) (-557.879) * (-554.295) [-553.932] (-555.603) (-553.501) -- 0:00:06
886500 -- (-556.105) (-554.536) [-554.014] (-556.282) * (-556.197) [-554.669] (-555.842) (-557.860) -- 0:00:06
887000 -- [-555.287] (-555.781) (-556.607) (-553.933) * [-557.473] (-552.880) (-553.743) (-556.100) -- 0:00:06
887500 -- (-555.332) (-556.394) (-560.176) [-554.421] * (-558.032) (-553.457) [-554.084] (-553.171) -- 0:00:06
888000 -- (-560.347) (-553.933) [-554.820] (-558.288) * (-553.728) [-554.041] (-554.377) (-554.101) -- 0:00:06
888500 -- (-553.673) (-554.494) (-556.044) [-556.488] * [-554.262] (-553.633) (-554.709) (-554.082) -- 0:00:06
889000 -- [-555.201] (-555.158) (-556.908) (-555.373) * (-555.294) (-554.056) [-554.152] (-554.678) -- 0:00:06
889500 -- (-555.276) [-556.768] (-556.246) (-557.413) * (-554.742) (-555.069) (-555.129) [-553.746] -- 0:00:06
890000 -- (-555.002) (-553.686) [-554.732] (-554.791) * (-554.678) (-557.307) [-554.449] (-556.018) -- 0:00:06
Average standard deviation of split frequencies: 0.011512
890500 -- (-553.330) [-556.601] (-556.112) (-553.845) * (-559.094) (-555.151) (-554.470) [-553.131] -- 0:00:06
891000 -- (-556.133) (-553.403) (-554.849) [-556.313] * (-553.203) [-553.423] (-555.349) (-555.771) -- 0:00:06
891500 -- (-555.813) [-554.594] (-556.314) (-554.269) * (-556.368) [-553.941] (-555.276) (-554.640) -- 0:00:06
892000 -- (-554.812) (-557.044) (-555.677) [-558.186] * [-559.540] (-557.322) (-554.789) (-555.068) -- 0:00:06
892500 -- [-557.715] (-556.414) (-554.669) (-555.406) * (-553.527) [-553.003] (-556.660) (-558.144) -- 0:00:06
893000 -- (-556.492) (-554.773) (-554.920) [-553.702] * [-553.105] (-554.565) (-554.950) (-558.663) -- 0:00:06
893500 -- [-555.882] (-555.621) (-554.473) (-554.050) * [-554.152] (-554.174) (-555.365) (-554.076) -- 0:00:06
894000 -- [-554.707] (-555.499) (-553.348) (-553.503) * (-554.406) (-554.442) [-556.119] (-556.991) -- 0:00:06
894500 -- (-554.815) (-554.492) (-553.207) [-553.465] * (-556.551) (-553.251) [-555.593] (-554.252) -- 0:00:06
895000 -- (-553.063) (-553.599) (-559.391) [-554.207] * (-554.604) (-553.340) (-554.396) [-557.911] -- 0:00:06
Average standard deviation of split frequencies: 0.011213
895500 -- [-553.466] (-557.269) (-556.061) (-554.479) * [-554.172] (-556.324) (-554.141) (-558.149) -- 0:00:06
896000 -- (-555.027) [-554.295] (-556.106) (-554.841) * (-553.886) [-554.667] (-555.566) (-555.983) -- 0:00:06
896500 -- (-556.442) (-555.036) [-558.102] (-556.424) * (-558.358) (-554.968) (-552.745) [-556.285] -- 0:00:06
897000 -- (-556.207) (-555.999) (-554.566) [-556.598] * (-554.977) (-555.223) [-554.841] (-554.551) -- 0:00:06
897500 -- (-554.950) (-556.185) (-553.900) [-555.818] * (-553.877) (-555.749) (-552.619) [-554.118] -- 0:00:06
898000 -- (-553.040) (-556.324) [-553.573] (-553.735) * (-554.552) (-554.602) (-553.006) [-553.946] -- 0:00:06
898500 -- [-552.908] (-555.010) (-555.283) (-553.776) * (-560.067) [-555.474] (-554.432) (-554.448) -- 0:00:05
899000 -- (-552.918) [-556.085] (-554.026) (-557.669) * (-555.140) [-556.598] (-555.369) (-554.514) -- 0:00:05
899500 -- (-555.360) (-554.066) [-555.483] (-553.966) * (-555.355) (-556.274) [-553.811] (-553.932) -- 0:00:05
900000 -- [-554.632] (-554.870) (-557.742) (-554.479) * (-555.685) (-554.809) [-556.095] (-553.345) -- 0:00:05
Average standard deviation of split frequencies: 0.010926
900500 -- [-553.568] (-554.363) (-555.308) (-556.860) * (-553.345) (-553.420) (-553.943) [-556.251] -- 0:00:05
901000 -- (-553.985) [-556.299] (-553.512) (-559.394) * (-553.693) (-553.244) (-559.187) [-552.983] -- 0:00:05
901500 -- (-555.856) (-553.823) [-553.411] (-554.126) * [-552.969] (-554.114) (-555.915) (-555.727) -- 0:00:05
902000 -- (-555.637) (-553.336) [-556.669] (-555.965) * (-553.084) [-559.719] (-553.589) (-554.984) -- 0:00:05
902500 -- (-557.243) (-553.761) (-554.825) [-557.271] * [-553.403] (-554.429) (-555.732) (-555.176) -- 0:00:05
903000 -- (-556.017) (-553.686) (-553.720) [-555.152] * (-553.392) (-556.849) [-554.374] (-553.475) -- 0:00:05
903500 -- [-554.181] (-553.445) (-556.327) (-556.061) * (-558.268) [-558.089] (-556.349) (-554.913) -- 0:00:05
904000 -- [-553.481] (-553.658) (-554.560) (-553.322) * [-556.210] (-560.322) (-553.097) (-553.299) -- 0:00:05
904500 -- [-554.219] (-555.643) (-554.686) (-553.295) * (-553.356) (-554.319) [-554.220] (-553.382) -- 0:00:05
905000 -- (-555.714) (-556.721) (-554.689) [-553.183] * (-553.350) (-553.589) (-552.739) [-553.759] -- 0:00:05
Average standard deviation of split frequencies: 0.011057
905500 -- [-553.807] (-558.097) (-556.094) (-554.412) * [-554.817] (-553.719) (-553.192) (-556.105) -- 0:00:05
906000 -- [-554.160] (-556.153) (-558.200) (-554.409) * [-554.398] (-554.679) (-554.353) (-555.093) -- 0:00:05
906500 -- (-553.382) [-556.359] (-555.108) (-556.032) * (-556.823) (-556.190) [-554.356] (-553.770) -- 0:00:05
907000 -- (-553.408) (-556.843) (-554.244) [-556.076] * (-557.860) (-557.466) (-552.739) [-553.554] -- 0:00:05
907500 -- (-553.273) (-556.142) (-556.876) [-555.477] * [-553.953] (-553.711) (-554.555) (-554.575) -- 0:00:05
908000 -- (-555.647) [-556.262] (-556.944) (-555.310) * (-555.519) (-555.467) (-555.356) [-554.180] -- 0:00:05
908500 -- (-554.653) (-553.178) [-557.468] (-554.191) * (-555.572) (-557.722) (-556.854) [-554.715] -- 0:00:05
909000 -- (-556.255) [-555.931] (-560.555) (-554.349) * (-556.413) [-554.333] (-553.080) (-556.795) -- 0:00:05
909500 -- (-556.710) [-554.687] (-558.127) (-556.132) * [-555.969] (-553.808) (-553.141) (-558.199) -- 0:00:05
910000 -- [-553.635] (-553.243) (-553.549) (-555.225) * [-555.348] (-553.575) (-555.737) (-558.687) -- 0:00:05
Average standard deviation of split frequencies: 0.010903
910500 -- (-554.624) [-553.774] (-557.786) (-560.784) * [-553.657] (-554.127) (-561.364) (-555.579) -- 0:00:05
911000 -- [-553.578] (-554.273) (-554.161) (-553.815) * (-554.388) (-553.768) (-558.803) [-557.077] -- 0:00:05
911500 -- (-556.363) [-554.343] (-555.753) (-557.051) * (-553.390) [-554.440] (-555.651) (-557.690) -- 0:00:05
912000 -- (-556.500) (-555.721) [-552.986] (-556.441) * [-557.577] (-553.879) (-557.765) (-556.593) -- 0:00:05
912500 -- [-555.505] (-554.144) (-555.370) (-555.560) * (-558.478) (-554.454) [-557.254] (-555.697) -- 0:00:05
913000 -- [-553.896] (-553.052) (-554.713) (-554.405) * (-555.107) (-555.043) (-554.915) [-558.589] -- 0:00:05
913500 -- [-552.990] (-553.600) (-553.828) (-557.126) * (-555.316) (-553.994) (-554.123) [-555.454] -- 0:00:05
914000 -- [-554.773] (-553.166) (-553.729) (-556.602) * [-554.134] (-553.721) (-554.199) (-554.019) -- 0:00:05
914500 -- (-555.094) (-557.684) (-553.872) [-556.631] * (-553.329) (-554.022) [-553.549] (-553.346) -- 0:00:05
915000 -- (-554.959) (-556.240) (-557.022) [-554.304] * (-554.970) [-553.392] (-553.227) (-555.703) -- 0:00:05
Average standard deviation of split frequencies: 0.011219
915500 -- (-555.501) (-558.452) [-554.305] (-553.486) * (-557.037) [-552.751] (-555.687) (-553.273) -- 0:00:04
916000 -- [-554.720] (-555.972) (-553.473) (-559.597) * (-553.348) (-553.261) (-559.705) [-556.246] -- 0:00:04
916500 -- [-552.856] (-557.525) (-556.903) (-555.547) * (-553.751) (-554.400) [-554.726] (-556.789) -- 0:00:04
917000 -- (-553.691) (-554.842) (-557.302) [-554.103] * (-553.948) [-556.300] (-554.545) (-553.691) -- 0:00:04
917500 -- (-556.065) (-554.054) (-557.524) [-555.306] * [-553.681] (-555.227) (-555.237) (-553.815) -- 0:00:04
918000 -- [-553.913] (-555.539) (-554.527) (-553.247) * (-554.799) (-554.544) [-557.323] (-555.218) -- 0:00:04
918500 -- [-555.899] (-556.358) (-554.170) (-553.332) * (-554.640) (-554.304) [-553.678] (-558.265) -- 0:00:04
919000 -- [-555.495] (-555.076) (-555.808) (-558.730) * (-555.054) (-554.670) (-553.004) [-553.407] -- 0:00:04
919500 -- (-555.687) (-557.626) [-555.013] (-556.655) * [-555.248] (-554.433) (-554.587) (-555.624) -- 0:00:04
920000 -- [-558.196] (-558.001) (-560.022) (-556.150) * (-552.975) (-554.797) [-554.684] (-553.762) -- 0:00:04
Average standard deviation of split frequencies: 0.011230
920500 -- (-556.348) (-556.660) (-553.223) [-553.962] * (-553.395) (-556.500) (-556.124) [-556.905] -- 0:00:04
921000 -- (-553.844) (-553.287) [-554.585] (-553.667) * [-553.037] (-554.625) (-555.797) (-557.284) -- 0:00:04
921500 -- [-554.923] (-557.900) (-554.833) (-557.674) * (-554.674) (-554.702) [-555.073] (-555.417) -- 0:00:04
922000 -- [-556.035] (-556.749) (-556.883) (-556.332) * (-558.616) [-555.425] (-554.719) (-554.623) -- 0:00:04
922500 -- (-558.144) (-554.848) [-556.548] (-557.062) * (-554.752) (-555.401) (-554.561) [-555.791] -- 0:00:04
923000 -- [-553.519] (-555.106) (-556.415) (-553.973) * (-556.556) [-553.054] (-555.075) (-555.997) -- 0:00:04
923500 -- (-554.723) (-554.482) (-554.850) [-554.045] * (-558.558) (-558.705) (-553.898) [-554.597] -- 0:00:04
924000 -- [-553.830] (-555.642) (-554.905) (-553.952) * (-561.140) [-553.591] (-554.259) (-557.673) -- 0:00:04
924500 -- [-555.521] (-555.540) (-553.194) (-556.010) * (-554.371) (-557.335) [-555.351] (-554.345) -- 0:00:04
925000 -- (-556.225) (-558.647) (-554.295) [-556.623] * (-554.665) [-554.044] (-554.429) (-553.055) -- 0:00:04
Average standard deviation of split frequencies: 0.010850
925500 -- [-555.141] (-554.676) (-555.052) (-552.662) * (-554.359) (-552.842) (-556.382) [-553.241] -- 0:00:04
926000 -- (-553.114) (-553.937) (-552.598) [-554.231] * [-555.216] (-553.450) (-556.552) (-557.115) -- 0:00:04
926500 -- (-553.704) (-553.912) [-552.622] (-554.506) * [-556.295] (-556.293) (-559.196) (-555.745) -- 0:00:04
927000 -- [-555.024] (-553.947) (-554.659) (-554.001) * [-554.262] (-554.063) (-559.613) (-555.417) -- 0:00:04
927500 -- (-554.466) [-555.574] (-554.551) (-556.334) * [-554.582] (-553.896) (-554.405) (-556.496) -- 0:00:04
928000 -- [-553.475] (-553.296) (-555.007) (-556.468) * (-553.866) [-555.874] (-553.560) (-555.633) -- 0:00:04
928500 -- [-554.383] (-555.816) (-554.015) (-556.726) * (-556.747) [-555.075] (-555.427) (-553.568) -- 0:00:04
929000 -- (-554.454) [-554.798] (-555.089) (-555.665) * [-555.810] (-555.648) (-553.978) (-556.999) -- 0:00:04
929500 -- [-553.363] (-553.590) (-555.570) (-553.761) * (-553.128) (-555.350) (-553.918) [-553.076] -- 0:00:04
930000 -- [-553.759] (-554.955) (-556.196) (-553.891) * [-555.543] (-562.117) (-553.944) (-553.860) -- 0:00:04
Average standard deviation of split frequencies: 0.010637
930500 -- [-556.724] (-552.860) (-556.499) (-555.904) * (-554.706) (-555.300) [-552.927] (-555.312) -- 0:00:04
931000 -- (-553.948) (-553.731) [-555.980] (-557.056) * (-554.228) (-554.723) [-553.926] (-555.020) -- 0:00:04
931500 -- (-553.829) (-555.985) (-554.125) [-557.828] * (-553.078) [-553.242] (-554.536) (-553.406) -- 0:00:04
932000 -- (-555.116) (-557.089) [-556.406] (-555.365) * [-553.198] (-559.207) (-555.760) (-553.071) -- 0:00:04
932500 -- (-553.572) (-556.284) (-556.014) [-556.773] * (-554.635) (-557.400) (-553.988) [-557.270] -- 0:00:03
933000 -- (-554.643) (-556.016) (-556.960) [-554.725] * (-556.791) (-556.346) [-554.395] (-557.683) -- 0:00:03
933500 -- (-555.771) (-555.816) [-556.080] (-554.103) * (-557.444) (-557.593) (-553.216) [-553.857] -- 0:00:03
934000 -- (-554.424) (-555.324) (-553.441) [-554.691] * (-553.489) [-555.923] (-555.928) (-554.868) -- 0:00:03
934500 -- (-556.983) [-555.143] (-552.985) (-554.521) * (-553.033) (-554.931) [-554.133] (-554.439) -- 0:00:03
935000 -- (-555.318) (-553.374) [-553.356] (-554.635) * [-553.046] (-554.851) (-553.842) (-554.327) -- 0:00:03
Average standard deviation of split frequencies: 0.010797
935500 -- (-553.692) [-553.843] (-553.479) (-553.720) * (-553.602) [-555.032] (-553.834) (-555.760) -- 0:00:03
936000 -- (-553.381) (-552.945) [-554.142] (-557.145) * (-556.286) (-554.914) [-553.597] (-554.435) -- 0:00:03
936500 -- (-555.058) [-553.627] (-553.052) (-553.971) * [-555.803] (-556.917) (-555.334) (-554.852) -- 0:00:03
937000 -- (-559.633) (-557.985) (-554.673) [-553.960] * (-555.958) (-555.603) [-554.875] (-553.603) -- 0:00:03
937500 -- (-554.134) [-555.186] (-552.967) (-556.056) * (-557.895) (-554.749) (-560.200) [-555.200] -- 0:00:03
938000 -- (-556.792) (-553.877) [-553.203] (-555.570) * (-559.191) (-554.003) [-555.233] (-555.897) -- 0:00:03
938500 -- (-553.255) (-553.345) (-556.348) [-555.478] * (-554.555) (-553.441) [-553.703] (-552.839) -- 0:00:03
939000 -- [-556.805] (-554.096) (-555.055) (-555.264) * [-558.020] (-555.473) (-555.862) (-553.411) -- 0:00:03
939500 -- (-554.153) (-554.229) (-554.402) [-555.723] * (-555.375) (-553.776) [-557.473] (-554.667) -- 0:00:03
940000 -- (-554.564) [-555.234] (-555.546) (-557.208) * (-554.695) [-553.874] (-554.555) (-556.365) -- 0:00:03
Average standard deviation of split frequencies: 0.010367
940500 -- (-554.861) (-554.171) (-555.937) [-554.371] * [-553.879] (-554.214) (-555.965) (-553.402) -- 0:00:03
941000 -- (-556.036) [-555.582] (-554.235) (-555.758) * (-557.290) (-556.655) (-555.908) [-553.682] -- 0:00:03
941500 -- (-555.871) (-563.570) [-554.578] (-558.694) * (-556.637) [-555.918] (-555.954) (-557.209) -- 0:00:03
942000 -- [-558.180] (-554.675) (-553.704) (-555.182) * (-559.400) (-553.856) (-556.665) [-554.079] -- 0:00:03
942500 -- (-555.940) (-554.945) (-553.147) [-554.697] * (-556.363) [-554.300] (-554.753) (-553.954) -- 0:00:03
943000 -- [-557.109] (-554.243) (-553.304) (-555.064) * (-556.021) (-556.915) [-554.457] (-555.651) -- 0:00:03
943500 -- [-555.315] (-557.312) (-556.907) (-554.694) * [-554.065] (-554.798) (-555.870) (-556.385) -- 0:00:03
944000 -- (-554.373) (-557.451) (-556.095) [-554.103] * (-554.144) (-556.510) [-556.954] (-556.586) -- 0:00:03
944500 -- (-555.496) (-555.322) (-559.028) [-553.958] * (-559.289) (-554.937) [-561.544] (-557.238) -- 0:00:03
945000 -- (-557.122) [-555.737] (-554.724) (-554.986) * (-553.537) (-554.569) [-555.168] (-556.093) -- 0:00:03
Average standard deviation of split frequencies: 0.010402
945500 -- [-555.909] (-557.149) (-555.748) (-554.970) * [-553.159] (-558.140) (-553.829) (-560.220) -- 0:00:03
946000 -- (-553.141) (-558.331) (-558.041) [-558.769] * (-555.462) (-555.402) (-560.297) [-554.295] -- 0:00:03
946500 -- (-555.014) (-556.774) (-555.954) [-554.007] * (-556.430) (-557.580) (-555.654) [-554.585] -- 0:00:03
947000 -- (-555.614) (-554.548) (-553.908) [-553.185] * (-556.149) [-556.771] (-555.381) (-557.005) -- 0:00:03
947500 -- [-557.840] (-556.908) (-553.485) (-552.970) * (-556.075) (-557.408) [-554.847] (-557.163) -- 0:00:03
948000 -- (-556.922) (-555.296) [-553.472] (-557.593) * (-560.258) (-553.993) (-555.453) [-555.517] -- 0:00:03
948500 -- [-554.819] (-556.254) (-554.613) (-555.518) * (-555.522) (-556.725) [-556.215] (-556.548) -- 0:00:03
949000 -- (-557.622) (-553.168) [-555.553] (-554.483) * (-556.119) (-556.406) (-558.919) [-554.703] -- 0:00:03
949500 -- (-555.781) (-554.017) (-556.192) [-554.052] * (-555.758) [-554.178] (-553.861) (-554.353) -- 0:00:02
950000 -- (-557.199) [-554.324] (-555.540) (-560.447) * (-557.304) (-555.041) [-553.358] (-554.571) -- 0:00:02
Average standard deviation of split frequencies: 0.010227
950500 -- [-553.237] (-555.546) (-554.890) (-554.448) * (-553.225) (-556.389) [-553.764] (-554.568) -- 0:00:02
951000 -- (-556.079) (-553.907) (-553.634) [-553.216] * [-555.322] (-557.031) (-554.848) (-554.037) -- 0:00:02
951500 -- (-556.134) [-554.382] (-555.331) (-554.453) * (-555.787) (-554.839) [-553.909] (-554.306) -- 0:00:02
952000 -- (-556.141) (-554.610) (-555.724) [-555.042] * (-553.733) (-557.307) [-554.197] (-553.004) -- 0:00:02
952500 -- (-559.960) [-557.996] (-554.839) (-558.854) * (-556.046) [-555.089] (-554.686) (-557.683) -- 0:00:02
953000 -- [-552.852] (-555.669) (-554.021) (-559.784) * (-557.438) [-556.292] (-555.191) (-556.614) -- 0:00:02
953500 -- (-553.166) (-565.370) (-553.904) [-556.130] * (-554.912) (-557.215) (-558.276) [-553.090] -- 0:00:02
954000 -- [-555.441] (-554.542) (-553.453) (-552.718) * (-556.258) (-556.344) (-554.554) [-554.569] -- 0:00:02
954500 -- (-554.480) (-555.155) (-553.214) [-553.192] * (-557.261) (-557.203) [-555.260] (-554.676) -- 0:00:02
955000 -- (-557.109) (-554.414) [-553.000] (-553.206) * [-553.588] (-553.311) (-556.765) (-556.461) -- 0:00:02
Average standard deviation of split frequencies: 0.009985
955500 -- (-557.302) (-553.650) (-553.170) [-554.645] * (-556.225) (-554.639) [-559.094] (-562.171) -- 0:00:02
956000 -- [-557.525] (-557.165) (-553.216) (-556.031) * (-557.587) [-558.675] (-555.819) (-558.137) -- 0:00:02
956500 -- (-554.307) (-556.626) [-555.725] (-557.967) * (-555.108) (-554.319) (-556.410) [-554.118] -- 0:00:02
957000 -- (-553.807) (-556.378) (-556.025) [-554.792] * (-554.081) (-554.562) [-553.640] (-553.666) -- 0:00:02
957500 -- (-553.618) (-553.950) [-553.902] (-553.350) * (-554.582) (-553.453) [-556.626] (-553.717) -- 0:00:02
958000 -- (-554.478) (-555.477) (-556.177) [-552.951] * (-554.079) (-554.290) [-553.409] (-556.485) -- 0:00:02
958500 -- (-557.210) (-555.016) (-554.128) [-552.951] * (-557.287) (-555.000) (-556.201) [-556.514] -- 0:00:02
959000 -- (-553.670) (-557.055) [-553.787] (-558.800) * (-559.449) [-553.658] (-554.349) (-555.764) -- 0:00:02
959500 -- [-559.951] (-553.148) (-553.320) (-554.010) * (-556.514) [-554.821] (-555.923) (-554.792) -- 0:00:02
960000 -- (-554.094) (-558.986) [-556.383] (-555.589) * (-554.543) (-553.484) [-553.469] (-556.633) -- 0:00:02
Average standard deviation of split frequencies: 0.009783
960500 -- [-554.448] (-555.365) (-554.293) (-560.377) * (-553.502) [-553.617] (-553.633) (-559.740) -- 0:00:02
961000 -- (-554.210) (-555.022) (-558.118) [-556.017] * (-557.422) [-555.309] (-553.704) (-554.848) -- 0:00:02
961500 -- (-554.783) (-554.992) (-556.200) [-555.985] * (-554.077) (-558.925) [-553.682] (-558.654) -- 0:00:02
962000 -- (-554.235) (-558.771) (-556.470) [-556.087] * [-553.850] (-555.863) (-559.909) (-554.516) -- 0:00:02
962500 -- [-554.143] (-558.142) (-554.584) (-557.263) * (-557.130) [-556.620] (-556.030) (-554.891) -- 0:00:02
963000 -- [-553.410] (-554.584) (-553.819) (-554.067) * (-558.738) (-555.143) (-554.353) [-557.226] -- 0:00:02
963500 -- (-556.081) (-555.139) [-556.131] (-554.657) * [-556.056] (-553.766) (-556.891) (-554.498) -- 0:00:02
964000 -- (-555.207) [-556.985] (-554.655) (-554.045) * (-554.208) [-554.293] (-555.567) (-558.131) -- 0:00:02
964500 -- (-554.589) (-556.413) (-554.464) [-552.959] * [-555.371] (-553.004) (-556.308) (-555.590) -- 0:00:02
965000 -- (-555.122) (-554.487) (-553.239) [-559.264] * (-554.535) (-553.527) [-555.163] (-557.162) -- 0:00:02
Average standard deviation of split frequencies: 0.010053
965500 -- (-556.722) [-555.542] (-557.162) (-553.653) * (-560.250) (-552.804) [-553.047] (-557.372) -- 0:00:02
966000 -- [-553.576] (-555.748) (-558.633) (-554.708) * [-553.457] (-554.578) (-553.842) (-555.472) -- 0:00:02
966500 -- (-553.124) [-556.962] (-556.091) (-553.415) * (-553.873) [-554.481] (-556.959) (-555.444) -- 0:00:01
967000 -- (-552.952) (-555.797) (-556.597) [-554.027] * (-554.770) (-555.676) (-553.981) [-556.467] -- 0:00:01
967500 -- [-553.908] (-553.447) (-555.202) (-557.377) * (-552.976) [-555.275] (-553.184) (-555.861) -- 0:00:01
968000 -- (-553.827) [-553.984] (-555.951) (-554.989) * (-554.405) (-554.371) [-555.097] (-559.481) -- 0:00:01
968500 -- (-555.026) (-554.635) (-555.459) [-556.095] * [-552.731] (-557.805) (-560.650) (-553.090) -- 0:00:01
969000 -- [-553.839] (-555.480) (-555.797) (-555.525) * [-552.798] (-557.783) (-554.502) (-556.245) -- 0:00:01
969500 -- (-552.691) (-556.144) (-555.340) [-556.512] * [-555.101] (-554.383) (-553.791) (-554.228) -- 0:00:01
970000 -- [-553.082] (-557.555) (-557.918) (-554.113) * (-558.589) (-553.952) (-553.978) [-555.198] -- 0:00:01
Average standard deviation of split frequencies: 0.009972
970500 -- (-553.994) [-554.982] (-555.041) (-556.791) * (-555.292) (-555.987) (-552.724) [-554.852] -- 0:00:01
971000 -- [-554.112] (-553.473) (-555.581) (-563.317) * [-555.219] (-557.500) (-553.439) (-556.860) -- 0:00:01
971500 -- (-555.527) (-556.518) [-553.255] (-554.736) * [-553.991] (-562.748) (-556.100) (-556.345) -- 0:00:01
972000 -- (-555.386) [-555.068] (-555.484) (-554.374) * (-553.637) (-555.235) [-554.962] (-560.289) -- 0:00:01
972500 -- [-556.049] (-554.997) (-554.193) (-560.482) * (-554.930) (-553.621) (-554.460) [-555.671] -- 0:00:01
973000 -- [-557.003] (-556.739) (-553.863) (-556.880) * (-554.715) (-556.061) (-553.365) [-554.033] -- 0:00:01
973500 -- (-554.406) (-558.157) [-554.902] (-552.909) * (-554.029) (-557.670) (-553.392) [-555.704] -- 0:00:01
974000 -- (-555.868) (-559.796) (-552.682) [-552.907] * [-552.929] (-556.475) (-554.090) (-557.456) -- 0:00:01
974500 -- (-555.894) (-554.429) (-558.830) [-554.422] * (-553.510) (-557.704) [-554.647] (-556.632) -- 0:00:01
975000 -- [-555.786] (-553.271) (-556.924) (-556.129) * [-553.332] (-557.416) (-553.219) (-553.105) -- 0:00:01
Average standard deviation of split frequencies: 0.009563
975500 -- [-557.640] (-554.066) (-563.484) (-555.711) * (-553.963) (-554.270) (-553.532) [-553.165] -- 0:00:01
976000 -- (-563.242) (-555.109) (-555.532) [-554.861] * (-553.898) (-556.080) (-554.402) [-554.579] -- 0:00:01
976500 -- (-553.795) (-558.942) [-553.808] (-556.768) * (-554.234) [-555.521] (-557.710) (-555.258) -- 0:00:01
977000 -- (-553.426) (-559.595) (-553.754) [-553.745] * (-556.307) (-556.653) (-561.685) [-553.940] -- 0:00:01
977500 -- (-554.902) [-554.443] (-554.256) (-558.791) * [-555.432] (-555.514) (-557.476) (-553.858) -- 0:00:01
978000 -- [-554.715] (-554.897) (-557.090) (-554.614) * (-554.410) (-557.994) (-558.548) [-554.234] -- 0:00:01
978500 -- (-554.930) (-554.452) (-555.026) [-554.822] * (-553.372) (-556.987) [-554.650] (-557.507) -- 0:00:01
979000 -- (-557.229) [-555.419] (-554.995) (-555.274) * (-555.369) (-552.936) (-555.965) [-556.527] -- 0:00:01
979500 -- [-560.967] (-555.349) (-553.830) (-554.285) * (-553.871) [-553.648] (-553.114) (-553.517) -- 0:00:01
980000 -- (-557.698) (-554.390) (-561.981) [-556.607] * (-553.902) (-560.435) [-553.456] (-553.958) -- 0:00:01
Average standard deviation of split frequencies: 0.009934
980500 -- (-555.225) [-554.001] (-555.609) (-555.458) * (-559.014) (-554.139) [-554.791] (-554.865) -- 0:00:01
981000 -- (-552.859) (-553.982) (-552.666) [-556.424] * [-557.020] (-553.048) (-557.295) (-556.410) -- 0:00:01
981500 -- [-555.915] (-554.321) (-553.253) (-555.319) * (-554.897) (-554.180) (-554.376) [-555.038] -- 0:00:01
982000 -- (-556.194) (-556.140) [-554.992] (-553.897) * (-555.186) (-554.958) [-554.991] (-555.824) -- 0:00:01
982500 -- (-555.323) [-555.223] (-556.072) (-554.518) * (-556.680) (-554.240) [-555.074] (-556.673) -- 0:00:01
983000 -- (-555.407) (-553.733) [-557.861] (-553.191) * (-552.982) [-555.344] (-561.998) (-555.353) -- 0:00:01
983500 -- (-557.270) (-554.242) (-554.893) [-554.983] * (-552.982) (-556.890) [-554.111] (-555.195) -- 0:00:00
984000 -- [-555.315] (-554.513) (-556.362) (-553.647) * [-556.371] (-557.211) (-554.410) (-555.390) -- 0:00:00
984500 -- (-555.537) (-556.838) [-553.192] (-554.822) * [-554.417] (-556.741) (-556.866) (-553.519) -- 0:00:00
985000 -- (-552.907) (-556.883) (-555.033) [-555.667] * (-557.384) (-555.107) (-555.539) [-555.129] -- 0:00:00
Average standard deviation of split frequencies: 0.009944
985500 -- (-553.843) (-555.812) [-557.315] (-554.676) * (-557.466) [-554.527] (-554.170) (-554.744) -- 0:00:00
986000 -- [-553.341] (-553.266) (-556.730) (-556.282) * (-556.437) (-554.302) [-554.158] (-554.869) -- 0:00:00
986500 -- (-555.775) (-554.462) (-555.773) [-554.139] * (-555.563) [-554.906] (-558.621) (-554.900) -- 0:00:00
987000 -- [-554.251] (-554.814) (-555.751) (-557.017) * (-553.813) (-554.063) [-558.050] (-555.786) -- 0:00:00
987500 -- (-553.993) (-555.711) [-555.594] (-555.414) * (-556.810) (-555.816) (-554.388) [-553.018] -- 0:00:00
988000 -- (-555.731) [-556.930] (-558.839) (-553.762) * [-557.692] (-558.405) (-553.884) (-553.439) -- 0:00:00
988500 -- (-553.384) (-554.935) [-555.457] (-556.266) * (-556.822) (-557.221) [-553.989] (-553.727) -- 0:00:00
989000 -- (-557.092) [-554.952] (-558.534) (-556.734) * (-559.406) (-556.873) [-553.763] (-555.021) -- 0:00:00
989500 -- (-554.993) (-553.280) [-553.988] (-553.716) * (-556.483) (-555.895) [-553.640] (-555.919) -- 0:00:00
990000 -- (-556.540) [-557.621] (-556.758) (-554.308) * (-555.734) (-553.756) [-554.784] (-553.972) -- 0:00:00
Average standard deviation of split frequencies: 0.010056
990500 -- (-557.766) [-554.605] (-557.246) (-556.751) * (-556.147) [-553.739] (-558.299) (-553.061) -- 0:00:00
991000 -- [-554.132] (-556.703) (-558.922) (-556.642) * (-555.418) (-555.637) (-557.287) [-553.122] -- 0:00:00
991500 -- [-553.215] (-556.877) (-554.837) (-553.151) * (-553.895) [-553.761] (-554.917) (-553.947) -- 0:00:00
992000 -- [-557.188] (-556.110) (-557.645) (-554.102) * (-553.856) [-554.988] (-555.058) (-553.903) -- 0:00:00
992500 -- (-561.185) [-555.341] (-555.595) (-554.666) * (-555.617) [-554.323] (-553.662) (-553.653) -- 0:00:00
993000 -- (-555.415) [-556.999] (-554.156) (-554.521) * (-556.493) (-553.751) (-556.957) [-553.171] -- 0:00:00
993500 -- (-554.451) [-557.702] (-554.864) (-556.153) * (-554.270) (-555.452) (-556.428) [-554.841] -- 0:00:00
994000 -- [-553.941] (-554.227) (-560.777) (-554.326) * (-553.736) (-554.650) (-555.699) [-554.142] -- 0:00:00
994500 -- (-555.794) (-553.112) [-556.249] (-553.943) * (-555.659) (-555.969) [-557.907] (-555.866) -- 0:00:00
995000 -- (-556.177) [-554.562] (-555.221) (-554.404) * (-553.327) [-556.275] (-557.367) (-554.660) -- 0:00:00
Average standard deviation of split frequencies: 0.009876
995500 -- (-556.042) (-556.096) [-556.338] (-554.743) * (-554.889) (-554.846) (-559.521) [-553.936] -- 0:00:00
996000 -- (-556.649) [-556.640] (-555.221) (-556.676) * [-554.864] (-554.751) (-557.131) (-555.243) -- 0:00:00
996500 -- (-557.974) [-554.970] (-554.271) (-558.593) * [-558.270] (-554.304) (-561.590) (-553.531) -- 0:00:00
997000 -- (-557.902) [-553.068] (-553.708) (-554.428) * (-556.549) (-554.124) (-556.692) [-554.502] -- 0:00:00
997500 -- (-553.951) (-553.532) [-555.306] (-556.188) * (-555.739) (-554.004) (-557.006) [-555.055] -- 0:00:00
998000 -- (-555.664) [-553.942] (-557.249) (-553.134) * (-557.789) (-553.508) [-555.810] (-555.471) -- 0:00:00
998500 -- (-557.507) (-554.090) [-558.885] (-553.235) * (-557.083) (-556.047) [-558.329] (-560.806) -- 0:00:00
999000 -- (-554.574) [-553.396] (-554.481) (-555.056) * (-555.174) (-555.228) [-554.295] (-555.631) -- 0:00:00
999500 -- (-556.581) [-556.136] (-555.035) (-554.090) * (-554.282) (-553.878) (-560.813) [-552.647] -- 0:00:00
1000000 -- (-555.123) (-557.154) (-556.082) [-554.106] * (-554.588) [-555.268] (-556.126) (-554.335) -- 0:00:00
Average standard deviation of split frequencies: 0.009799
Analysis completed in 59 seconds
Analysis used 57.80 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -552.54
Likelihood of best state for "cold" chain of run 2 was -552.54
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.4 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.8 % ( 26 %) Dirichlet(Pi{all})
34.5 % ( 25 %) Slider(Pi{all})
78.6 % ( 51 %) Multiplier(Alpha{1,2})
77.4 % ( 48 %) Multiplier(Alpha{3})
24.8 % ( 16 %) Slider(Pinvar{all})
98.6 % ( 99 %) ExtSPR(Tau{all},V{all})
70.1 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.2 % ( 86 %) ParsSPR(Tau{all},V{all})
28.2 % ( 31 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.4 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
76.5 % ( 76 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
34.3 % ( 24 %) Dirichlet(Pi{all})
34.9 % ( 24 %) Slider(Pi{all})
78.6 % ( 54 %) Multiplier(Alpha{1,2})
77.6 % ( 45 %) Multiplier(Alpha{3})
24.7 % ( 28 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 77 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.2 % ( 32 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 26 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166269 0.82 0.67
3 | 167096 166548 0.84
4 | 166200 166397 167490
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 167011 0.82 0.67
3 | 166003 166754 0.84
4 | 166860 166338 167034
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -554.45
| 1 1 2 2 2 |
| 1 2 1 11 2 |
| 2 2 2 2 22 2 2 2 |
| 1 1 11 2 * 2 11 2 2|
| 1 1 1 2 2 1 11 2 *11 2 1 21 112 |
| 1 1 2 2 1 1 2 2 1 2 2 2 2 |
| 1 2 1 1 1 2 1 2 1 |
| 22 1 222 2 22 1 2 |
|2 12 2 * 1 1 1 2 1 1 1 1 |
|1 1 2 2 2 11|
| 22 1 * 1 |
| 1 2 1 |
| 1 1 1 |
| |
| 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -556.02
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -554.29 -560.15
2 -554.29 -557.74
--------------------------------------
TOTAL -554.29 -559.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898935 0.086296 0.359596 1.466641 0.865573 1501.00 1501.00 1.000
r(A<->C){all} 0.165423 0.019519 0.000209 0.442229 0.130350 122.89 157.60 1.002
r(A<->G){all} 0.178765 0.020719 0.000059 0.470556 0.144785 202.05 287.63 1.005
r(A<->T){all} 0.165472 0.021507 0.000005 0.474504 0.124020 296.53 319.88 1.002
r(C<->G){all} 0.172268 0.021010 0.000005 0.470142 0.133650 136.97 197.57 1.000
r(C<->T){all} 0.158064 0.018103 0.000019 0.437183 0.119327 120.37 149.53 1.000
r(G<->T){all} 0.160009 0.019877 0.000001 0.443619 0.119417 144.17 190.78 1.001
pi(A){all} 0.216438 0.000414 0.177760 0.256286 0.216121 1403.17 1449.24 1.000
pi(C){all} 0.273101 0.000512 0.229554 0.317124 0.272532 1126.49 1260.71 1.000
pi(G){all} 0.300722 0.000524 0.257089 0.345393 0.300527 1258.82 1336.98 1.001
pi(T){all} 0.209739 0.000418 0.170467 0.248942 0.209113 1359.86 1422.75 1.000
alpha{1,2} 0.407837 0.218573 0.000117 1.352050 0.243213 1253.09 1377.04 1.000
alpha{3} 0.448433 0.238966 0.000431 1.422336 0.286614 1040.22 1132.30 1.000
pinvar{all} 0.995992 0.000023 0.986907 0.999999 0.997471 937.31 1153.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .**...
8 -- ..*..*
9 -- ...**.
10 -- .**.**
11 -- ..*.*.
12 -- ....**
13 -- .*...*
14 -- .***.*
15 -- .*.***
16 -- ..****
17 -- ...*.*
18 -- .*..*.
19 -- ..**..
20 -- .*.*..
21 -- .****.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 469 0.156229 0.003298 0.153897 0.158561 2
8 454 0.151233 0.012248 0.142572 0.159893 2
9 445 0.148235 0.010835 0.140573 0.155896 2
10 443 0.147568 0.009893 0.140573 0.154564 2
11 439 0.146236 0.009893 0.139241 0.153231 2
12 437 0.145570 0.008951 0.139241 0.151899 2
13 434 0.144570 0.005653 0.140573 0.148568 2
14 425 0.141572 0.009893 0.134577 0.148568 2
15 424 0.141239 0.006595 0.136576 0.145903 2
16 419 0.139574 0.024968 0.121919 0.157229 2
17 416 0.138574 0.004711 0.135243 0.141905 2
18 411 0.136909 0.007066 0.131912 0.141905 2
19 411 0.136909 0.016488 0.125250 0.148568 2
20 398 0.132578 0.006595 0.127915 0.137242 2
21 397 0.132245 0.009893 0.125250 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.097282 0.009959 0.000066 0.300654 0.067729 1.000 2
length{all}[2] 0.101278 0.009696 0.000043 0.292061 0.071206 1.000 2
length{all}[3] 0.100374 0.010189 0.000012 0.293750 0.069685 1.000 2
length{all}[4] 0.101638 0.009577 0.000001 0.302492 0.071607 1.000 2
length{all}[5] 0.096483 0.009681 0.000127 0.282890 0.066973 1.000 2
length{all}[6] 0.103369 0.010081 0.000087 0.294820 0.074469 1.000 2
length{all}[7] 0.101762 0.008651 0.000175 0.275646 0.074333 1.001 2
length{all}[8] 0.106364 0.012296 0.001076 0.313449 0.067674 1.002 2
length{all}[9] 0.096351 0.011291 0.000219 0.277917 0.064117 1.002 2
length{all}[10] 0.093702 0.009166 0.000045 0.281003 0.065680 0.999 2
length{all}[11] 0.092701 0.009425 0.000074 0.274230 0.060012 1.002 2
length{all}[12] 0.096456 0.009228 0.000161 0.305143 0.067965 0.998 2
length{all}[13] 0.102369 0.011111 0.000452 0.303738 0.071519 0.999 2
length{all}[14] 0.097215 0.010000 0.000167 0.297027 0.064950 1.011 2
length{all}[15] 0.098100 0.010231 0.000172 0.305879 0.065902 1.000 2
length{all}[16] 0.093989 0.008236 0.000050 0.254552 0.069009 0.999 2
length{all}[17] 0.106815 0.009890 0.000071 0.313058 0.078791 1.000 2
length{all}[18] 0.103079 0.010702 0.000001 0.304896 0.073984 0.998 2
length{all}[19] 0.106540 0.012923 0.000012 0.320863 0.071767 1.000 2
length{all}[20] 0.097917 0.010345 0.000347 0.291009 0.070449 1.000 2
length{all}[21] 0.098707 0.009249 0.000602 0.290472 0.072679 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009799
Maximum standard deviation of split frequencies = 0.024968
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.011
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/----------------------------------------------------------------- C1 (1)
|
|--------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------- C3 (3)
+
|--------------------------------------------------------------------- C4 (4)
|
|----------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 402
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 52 patterns at 134 / 134 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 52 patterns at 134 / 134 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
50752 bytes for conP
4576 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046752 0.055771 0.035081 0.042336 0.017584 0.043525 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -569.443004
Iterating by ming2
Initial: fx= 569.443004
x= 0.04675 0.05577 0.03508 0.04234 0.01758 0.04353 0.30000 1.30000
1 h-m-p 0.0000 0.0001 322.5391 ++ 555.586668 m 0.0001 13 | 1/8
2 h-m-p 0.0028 0.0754 13.9977 ------------.. | 1/8
3 h-m-p 0.0000 0.0001 295.0969 ++ 544.008050 m 0.0001 45 | 2/8
4 h-m-p 0.0029 0.3475 12.2880 ------------.. | 2/8
5 h-m-p 0.0000 0.0001 264.6278 ++ 540.145983 m 0.0001 77 | 3/8
6 h-m-p 0.0011 0.3885 11.3723 -----------.. | 3/8
7 h-m-p 0.0000 0.0000 229.3976 ++ 539.670339 m 0.0000 108 | 4/8
8 h-m-p 0.0010 0.5041 9.3567 -----------.. | 4/8
9 h-m-p 0.0000 0.0000 187.2576 ++ 538.809741 m 0.0000 139 | 5/8
10 h-m-p 0.0015 0.7592 6.5111 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 132.3818 ++ 537.605303 m 0.0001 170 | 6/8
12 h-m-p 0.7070 8.0000 0.0000 ++ 537.605303 m 8.0000 181 | 6/8
13 h-m-p 0.5982 8.0000 0.0000 -C 537.605303 0 0.0374 195 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 Y 537.605303 0 0.0040 208 | 6/8
15 h-m-p 0.0160 8.0000 0.0002 -------------.. | 6/8
16 h-m-p 0.0160 8.0000 0.0000 +++++ 537.605303 m 8.0000 248 | 6/8
17 h-m-p 0.0054 2.6792 0.1270 -------C 537.605303 0 0.0000 268 | 6/8
18 h-m-p 0.0160 8.0000 0.0000 -------C 537.605303 0 0.0000 288 | 6/8
19 h-m-p 0.0160 8.0000 0.0000 +++++ 537.605303 m 8.0000 304 | 6/8
20 h-m-p 0.0068 3.4171 0.2122 ----------Y 537.605303 0 0.0000 327 | 6/8
21 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
22 h-m-p 0.0160 8.0000 0.0000 +++++ 537.605303 m 8.0000 367 | 6/8
23 h-m-p 0.0153 7.6603 0.3596 +++++ 537.605239 m 7.6603 383 | 7/8
24 h-m-p 0.1242 8.0000 19.5516 ++++ 537.605214 m 8.0000 398 | 7/8
25 h-m-p 1.6000 8.0000 0.2792 ++ 537.605214 m 8.0000 409 | 7/8
26 h-m-p 1.6000 8.0000 1.1221 ++ 537.605214 m 8.0000 421 | 7/8
27 h-m-p 1.6000 8.0000 0.0000 N 537.605214 0 1.6000 432 | 7/8
28 h-m-p 0.0160 8.0000 0.0000 C 537.605214 0 0.0160 444
Out..
lnL = -537.605214
445 lfun, 445 eigenQcodon, 2670 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064884 0.074141 0.065131 0.019062 0.035992 0.076610 170.351666 0.736082 0.510282
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 0.142472
np = 9
lnL0 = -580.753722
Iterating by ming2
Initial: fx= 580.753722
x= 0.06488 0.07414 0.06513 0.01906 0.03599 0.07661 170.35167 0.73608 0.51028
1 h-m-p 0.0000 0.0001 309.2926 ++ 566.456305 m 0.0001 14 | 1/9
2 h-m-p 0.0003 0.0014 98.6852 ++ 554.900002 m 0.0014 26 | 2/9
3 h-m-p 0.0000 0.0002 692.2046 ++ 540.686609 m 0.0002 38 | 3/9
4 h-m-p 0.0000 0.0000 182.3045 ++ 540.508341 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0001 1307.3831 ++ 538.122715 m 0.0001 62 | 5/9
6 h-m-p 0.0000 0.0000 2606.0056 ++ 537.605256 m 0.0000 74 | 6/9
7 h-m-p 1.6000 8.0000 0.0002 ++ 537.605256 m 8.0000 86 | 6/9
8 h-m-p 0.0052 0.1273 0.2904 +++ 537.605254 m 0.1273 102 | 7/9
9 h-m-p 0.1031 8.0000 0.0197 -----------Y 537.605254 0 0.0000 128 | 7/9
10 h-m-p 0.0000 0.0001 5924.5839 ++ 537.605214 m 0.0001 142 | 8/9
11 h-m-p 0.0226 8.0000 0.0015 ------Y 537.605214 0 0.0000 160 | 8/9
12 h-m-p 0.1073 8.0000 0.0000 ----Y 537.605214 0 0.0001 177
Out..
lnL = -537.605214
178 lfun, 534 eigenQcodon, 2136 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M2:NSpselection reset.
0.064779 0.059841 0.083826 0.021370 0.023294 0.017238 170.351645 1.202149 0.109855 0.258339 2.862349
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.116077
np = 11
lnL0 = -569.949326
Iterating by ming2
Initial: fx= 569.949326
x= 0.06478 0.05984 0.08383 0.02137 0.02329 0.01724 170.35164 1.20215 0.10986 0.25834 2.86235
1 h-m-p 0.0000 0.0002 270.8349 ++ 558.373434 m 0.0002 16 | 1/11
2 h-m-p 0.0006 0.0028 51.7455 ++ 551.552643 m 0.0028 30 | 2/11
3 h-m-p 0.0000 0.0000 5535.5445 ++ 549.411247 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0002 524.5642 ++ 546.893668 m 0.0002 58 | 4/11
5 h-m-p 0.0005 0.0023 17.8805 ++ 546.755881 m 0.0023 72 | 5/11
6 h-m-p 0.0000 0.0002 76.4313 ++ 544.674825 m 0.0002 86 | 6/11
7 h-m-p 0.0160 8.0000 5.5236 -------------.. | 6/11
8 h-m-p 0.0000 0.0005 117.9027 +++ 537.605275 m 0.0005 126 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 537.605275 m 8.0000 140 | 7/11
10 h-m-p 0.0160 8.0000 0.0210 ---------Y 537.605275 0 0.0000 167 | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 537.605275 m 8.0000 188 | 7/11
12 h-m-p 0.0160 8.0000 0.0556 +++++ 537.605274 m 8.0000 209 | 7/11
13 h-m-p 0.1022 8.0000 4.3554 -----------C 537.605274 0 0.0000 238 | 7/11
14 h-m-p 0.0177 8.0000 0.0000 -N 537.605274 0 0.0011 253 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 ----N 537.605274 0 0.0000 275
Out..
lnL = -537.605274
276 lfun, 1104 eigenQcodon, 4968 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -537.610186 S = -537.603473 -0.002566
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:03
did 20 / 52 patterns 0:03
did 30 / 52 patterns 0:03
did 40 / 52 patterns 0:03
did 50 / 52 patterns 0:03
did 52 / 52 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.064878 0.103624 0.054290 0.058429 0.066071 0.086030 170.095340 0.695753 1.174588
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 0.188961
np = 9
lnL0 = -591.472578
Iterating by ming2
Initial: fx= 591.472578
x= 0.06488 0.10362 0.05429 0.05843 0.06607 0.08603 170.09534 0.69575 1.17459
1 h-m-p 0.0000 0.0005 290.3290 +++ 551.847833 m 0.0005 15 | 1/9
2 h-m-p 0.0048 0.0279 24.7928 ++ 548.312259 m 0.0279 27 | 2/9
3 h-m-p 0.0001 0.0003 60.4422 ++ 547.442865 m 0.0003 39 | 3/9
4 h-m-p 0.0001 0.0004 83.8878 ++ 544.022472 m 0.0004 51 | 4/9
5 h-m-p 0.0000 0.0002 16.6719 ---------.. | 4/9
6 h-m-p 0.0000 0.0000 218.7198 ++ 543.640257 m 0.0000 82 | 5/9
7 h-m-p 0.0160 8.0000 1.2490 -------------.. | 5/9
8 h-m-p 0.0000 0.0001 177.0551 ++ 539.438743 m 0.0001 117 | 6/9
9 h-m-p 0.0200 8.0000 0.8215 -------------.. | 6/9
10 h-m-p 0.0000 0.0001 126.6469 ++ 537.605214 m 0.0001 155 | 7/9
11 h-m-p 0.5035 8.0000 0.0000 -Y 537.605214 0 0.0315 168 | 7/9
12 h-m-p 1.4644 8.0000 0.0000 C 537.605214 0 1.4644 182
Out..
lnL = -537.605214
183 lfun, 2013 eigenQcodon, 10980 P(t)
Time used: 0:05
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
initial w for M8:NSbetaw>1 reset.
0.075301 0.011765 0.108148 0.097926 0.050746 0.106002 170.095370 0.900000 0.676881 1.670823 2.104367
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.169126
np = 11
lnL0 = -590.134115
Iterating by ming2
Initial: fx= 590.134115
x= 0.07530 0.01176 0.10815 0.09793 0.05075 0.10600 170.09537 0.90000 0.67688 1.67082 2.10437
1 h-m-p 0.0000 0.0001 262.3700 ++ 582.756370 m 0.0001 16 | 1/11
2 h-m-p 0.0001 0.0004 356.9215 ++ 560.327474 m 0.0004 30 | 2/11
3 h-m-p 0.0000 0.0000 236129.6236 ++ 548.554750 m 0.0000 44 | 3/11
4 h-m-p 0.0047 0.0531 15.7145 ++ 543.121051 m 0.0531 58 | 4/11
5 h-m-p 0.0000 0.0000 180269.4458 ++ 540.235365 m 0.0000 72 | 5/11
6 h-m-p 0.0004 0.0019 106.6398 ++ 540.126871 m 0.0019 86 | 6/11
7 h-m-p 0.0052 0.0356 39.4599 ------------.. | 6/11
8 h-m-p 0.0000 0.0002 126.7441 ++ 537.605280 m 0.0002 124 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 537.605280 m 8.0000 138 | 7/11
10 h-m-p 0.0160 8.0000 0.0063 -------N 537.605280 0 0.0000 163 | 7/11
11 h-m-p 0.0001 0.0271 61.8406 +++++ 537.605254 m 0.0271 184 | 8/11
12 h-m-p 0.1691 3.4714 0.2147 -----------Y 537.605254 0 0.0000 209 | 8/11
13 h-m-p 0.0160 8.0000 0.0000 --C 537.605254 0 0.0003 228
Out..
lnL = -537.605254
229 lfun, 2748 eigenQcodon, 15114 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -537.617461 S = -537.604174 -0.005834
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 52 patterns 0:09
did 20 / 52 patterns 0:10
did 30 / 52 patterns 0:10
did 40 / 52 patterns 0:10
did 50 / 52 patterns 0:10
did 52 / 52 patterns 0:10
Time used: 0:10
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=134
NC_011896_1_WP_010908747_1_2322_MLBR_RS11000 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
NC_002677_1_NP_302427_1_1299_cdd MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
**************************************************
NC_011896_1_WP_010908747_1_2322_MLBR_RS11000 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
NC_002677_1_NP_302427_1_1299_cdd YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
**************************************************
NC_011896_1_WP_010908747_1_2322_MLBR_RS11000 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
NC_002677_1_NP_302427_1_1299_cdd GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
**********************************
>NC_011896_1_WP_010908747_1_2322_MLBR_RS11000 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA >NC_002677_1_NP_302427_1_1299_cdd ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA >NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA >NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA >NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA >NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG AA
>NC_011896_1_WP_010908747_1_2322_MLBR_RS11000 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE >NC_002677_1_NP_302427_1_1299_cdd MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE >NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE >NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE >NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE >NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
#NEXUS
[ID: 8333414215]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908747_1_2322_MLBR_RS11000
NC_002677_1_NP_302427_1_1299_cdd
NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875
NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120
NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900
NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908747_1_2322_MLBR_RS11000,
2 NC_002677_1_NP_302427_1_1299_cdd,
3 NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875,
4 NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120,
5 NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900,
6 NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06772875,2:0.07120598,3:0.06968538,4:0.07160654,5:0.06697254,6:0.07446861);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06772875,2:0.07120598,3:0.06968538,4:0.07160654,5:0.06697254,6:0.07446861);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -554.29 -560.15
2 -554.29 -557.74
--------------------------------------
TOTAL -554.29 -559.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898935 0.086296 0.359596 1.466641 0.865573 1501.00 1501.00 1.000
r(A<->C){all} 0.165423 0.019519 0.000209 0.442229 0.130350 122.89 157.60 1.002
r(A<->G){all} 0.178765 0.020719 0.000059 0.470556 0.144785 202.05 287.63 1.005
r(A<->T){all} 0.165472 0.021507 0.000005 0.474504 0.124020 296.53 319.88 1.002
r(C<->G){all} 0.172268 0.021010 0.000005 0.470142 0.133650 136.97 197.57 1.000
r(C<->T){all} 0.158064 0.018103 0.000019 0.437183 0.119327 120.37 149.53 1.000
r(G<->T){all} 0.160009 0.019877 0.000001 0.443619 0.119417 144.17 190.78 1.001
pi(A){all} 0.216438 0.000414 0.177760 0.256286 0.216121 1403.17 1449.24 1.000
pi(C){all} 0.273101 0.000512 0.229554 0.317124 0.272532 1126.49 1260.71 1.000
pi(G){all} 0.300722 0.000524 0.257089 0.345393 0.300527 1258.82 1336.98 1.001
pi(T){all} 0.209739 0.000418 0.170467 0.248942 0.209113 1359.86 1422.75 1.000
alpha{1,2} 0.407837 0.218573 0.000117 1.352050 0.243213 1253.09 1377.04 1.000
alpha{3} 0.448433 0.238966 0.000431 1.422336 0.286614 1040.22 1132.30 1.000
pinvar{all} 0.995992 0.000023 0.986907 0.999999 0.997471 937.31 1153.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/cdd/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 134
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 3 3 3 3 3 3
TTC 4 4 4 4 4 4 | TCC 1 1 1 1 1 1 | TAC 5 5 5 5 5 5 | TGC 2 2 2 2 2 2
Leu TTA 1 1 1 1 1 1 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 4 4 4 4 4 4 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 3 3 3 3 3 3 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 0 0 0
CTC 4 4 4 4 4 4 | CCC 3 3 3 3 3 3 | CAC 0 0 0 0 0 0 | CGC 2 2 2 2 2 2
CTA 1 1 1 1 1 1 | CCA 1 1 1 1 1 1 | Gln CAA 2 2 2 2 2 2 | CGA 1 1 1 1 1 1
CTG 2 2 2 2 2 2 | CCG 3 3 3 3 3 3 | CAG 4 4 4 4 4 4 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 0 0 0 0 0 0 | Asn AAT 5 5 5 5 5 5 | Ser AGT 0 0 0 0 0 0
ATC 1 1 1 1 1 1 | ACC 2 2 2 2 2 2 | AAC 4 4 4 4 4 4 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 1 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 1 1 1 1 1 1
Met ATG 5 5 5 5 5 5 | ACG 1 1 1 1 1 1 | AAG 1 1 1 1 1 1 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 0 0 0 0 0 0 | Gly GGT 4 4 4 4 4 4
GTC 5 5 5 5 5 5 | GCC 5 5 5 5 5 5 | GAC 6 6 6 6 6 6 | GGC 5 5 5 5 5 5
GTA 1 1 1 1 1 1 | GCA 2 2 2 2 2 2 | Glu GAA 3 3 3 3 3 3 | GGA 3 3 3 3 3 3
GTG 3 3 3 3 3 3 | GCG 5 5 5 5 5 5 | GAG 3 3 3 3 3 3 | GGG 4 4 4 4 4 4
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908747_1_2322_MLBR_RS11000
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
#2: NC_002677_1_NP_302427_1_1299_cdd
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
#3: NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
#4: NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
#5: NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
#6: NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 18
TTC 24 | TCC 6 | TAC 30 | TGC 12
Leu L TTA 6 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 24 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 18 | Pro P CCT 0 | His H CAT 6 | Arg R CGT 0
CTC 24 | CCC 18 | CAC 0 | CGC 12
CTA 6 | CCA 6 | Gln Q CAA 12 | CGA 6
CTG 12 | CCG 18 | CAG 24 | CGG 6
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 0 | Asn N AAT 30 | Ser S AGT 0
ATC 6 | ACC 12 | AAC 24 | AGC 0
ATA 6 | ACA 12 | Lys K AAA 12 | Arg R AGA 6
Met M ATG 30 | ACG 6 | AAG 6 | AGG 6
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 18 | Asp D GAT 0 | Gly G GGT 24
GTC 30 | GCC 30 | GAC 36 | GGC 30
GTA 6 | GCA 12 | Glu E GAA 18 | GGA 18
GTG 18 | GCG 30 | GAG 18 | GGG 24
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17910 C:0.20896 A:0.20896 G:0.40299
position 2: T:0.26866 C:0.24627 A:0.27612 G:0.20896
position 3: T:0.17910 C:0.36567 A:0.16418 G:0.29104
Average T:0.20896 C:0.27363 A:0.21642 G:0.30100
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -537.605214 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 170.351666 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908747_1_2322_MLBR_RS11000: 0.000004, NC_002677_1_NP_302427_1_1299_cdd: 0.000004, NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875: 0.000004, NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120: 0.000004, NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900: 0.000004, NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 170.35167
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
7..2 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
7..3 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
7..4 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
7..5 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
7..6 0.000 276.0 126.0 0.0001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -537.605214 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 170.351645 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908747_1_2322_MLBR_RS11000: 0.000004, NC_002677_1_NP_302427_1_1299_cdd: 0.000004, NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875: 0.000004, NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120: 0.000004, NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900: 0.000004, NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 170.35164
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -537.605274 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 170.095340 0.641836 0.158358 0.000001 2.741640
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908747_1_2322_MLBR_RS11000: 0.000004, NC_002677_1_NP_302427_1_1299_cdd: 0.000004, NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875: 0.000004, NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120: 0.000004, NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900: 0.000004, NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 170.09534
MLEs of dN/dS (w) for site classes (K=3)
p: 0.64184 0.15836 0.19981
w: 0.00000 1.00000 2.74164
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
7..2 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
7..3 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
7..4 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
7..5 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
7..6 0.000 276.0 126.0 0.7062 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908747_1_2322_MLBR_RS11000)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908747_1_2322_MLBR_RS11000)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -537.605214 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 170.095370 0.005000 1.206906
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908747_1_2322_MLBR_RS11000: 0.000004, NC_002677_1_NP_302427_1_1299_cdd: 0.000004, NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875: 0.000004, NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120: 0.000004, NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900: 0.000004, NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 170.09537
Parameters in M7 (beta):
p = 0.00500 q = 1.20691
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 276.0 126.0 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:05
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -537.605254 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 170.095365 0.690728 0.005000 1.942328 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908747_1_2322_MLBR_RS11000: 0.000004, NC_002677_1_NP_302427_1_1299_cdd: 0.000004, NZ_LVXE01000030_1_WP_010908747_1_1401_A3216_RS08875: 0.000004, NZ_LYPH01000066_1_WP_010908747_1_2320_A8144_RS11120: 0.000004, NZ_CP029543_1_WP_010908747_1_2340_DIJ64_RS11900: 0.000004, NZ_AP014567_1_WP_010908747_1_2407_JK2ML_RS12235: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 170.09537
Parameters in M8 (beta&w>1):
p0 = 0.69073 p = 0.00500 q = 1.94233
(p1 = 0.30927) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.06907 0.06907 0.06907 0.06907 0.06907 0.06907 0.06907 0.06907 0.06907 0.06907 0.30927
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
7..2 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
7..3 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
7..4 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
7..5 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
7..6 0.000 276.0 126.0 0.3093 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908747_1_2322_MLBR_RS11000)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.099 0.099 0.099 0.100 0.100 0.100 0.100 0.101 0.101 0.101
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Time used: 0:10
Model 1: NearlyNeutral -537.605214 Model 2: PositiveSelection -537.605274 Model 0: one-ratio -537.605214 Model 7: beta -537.605214 Model 8: beta&w>1 -537.605254 Model 0 vs 1 0.0 Model 2 vs 1 1.199999999244028E-4 Model 8 vs 7 7.999999979801942E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
