--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:02:52 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cdd/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -554.29 -560.15
2 -554.29 -557.74
--------------------------------------
TOTAL -554.29 -559.54
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.898935 0.086296 0.359596 1.466641 0.865573 1501.00 1501.00 1.000
r(A<->C){all} 0.165423 0.019519 0.000209 0.442229 0.130350 122.89 157.60 1.002
r(A<->G){all} 0.178765 0.020719 0.000059 0.470556 0.144785 202.05 287.63 1.005
r(A<->T){all} 0.165472 0.021507 0.000005 0.474504 0.124020 296.53 319.88 1.002
r(C<->G){all} 0.172268 0.021010 0.000005 0.470142 0.133650 136.97 197.57 1.000
r(C<->T){all} 0.158064 0.018103 0.000019 0.437183 0.119327 120.37 149.53 1.000
r(G<->T){all} 0.160009 0.019877 0.000001 0.443619 0.119417 144.17 190.78 1.001
pi(A){all} 0.216438 0.000414 0.177760 0.256286 0.216121 1403.17 1449.24 1.000
pi(C){all} 0.273101 0.000512 0.229554 0.317124 0.272532 1126.49 1260.71 1.000
pi(G){all} 0.300722 0.000524 0.257089 0.345393 0.300527 1258.82 1336.98 1.001
pi(T){all} 0.209739 0.000418 0.170467 0.248942 0.209113 1359.86 1422.75 1.000
alpha{1,2} 0.407837 0.218573 0.000117 1.352050 0.243213 1253.09 1377.04 1.000
alpha{3} 0.448433 0.238966 0.000431 1.422336 0.286614 1040.22 1132.30 1.000
pinvar{all} 0.995992 0.000023 0.986907 0.999999 0.997471 937.31 1153.98 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -537.605214
Model 2: PositiveSelection -537.605274
Model 0: one-ratio -537.605214
Model 7: beta -537.605214
Model 8: beta&w>1 -537.605254
Model 0 vs 1 0.0
Model 2 vs 1 1.199999999244028E-4
Model 8 vs 7 7.999999979801942E-5
>C1
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C2
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C3
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C4
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C5
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C6
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=134
C1 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C2 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C3 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C4 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C5 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C6 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
**************************************************
C1 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C2 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C3 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C4 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C5 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C6 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
**************************************************
C1 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C2 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C3 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C4 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C5 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C6 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
**********************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 134 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 134 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [4020]--->[4020]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.463 Mb, Max= 30.665 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C2 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C3 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C4 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C5 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
C6 MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
**************************************************
C1 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C2 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C3 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C4 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C5 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
C6 YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
**************************************************
C1 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C2 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C3 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C4 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C5 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
C6 GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
**********************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C2 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C3 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C4 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C5 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
C6 ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
**************************************************
C1 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C2 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C3 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C4 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C5 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
C6 AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
**************************************************
C1 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C2 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C3 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C4 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C5 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
C6 TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
**************************************************
C1 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C2 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C3 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C4 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C5 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
C6 TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
**************************************************
C1 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C2 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C3 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C4 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C5 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
C6 TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
**************************************************
C1 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C2 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C3 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C4 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C5 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
C6 ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
**************************************************
C1 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C2 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C3 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C4 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C5 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
C6 GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
**************************************************
C1 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C2 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C3 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C4 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C5 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
C6 GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
**************************************************
C1 AA
C2 AA
C3 AA
C4 AA
C5 AA
C6 AA
**
>C1
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C2
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C3
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C4
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C5
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C6
ATGGGTGACGTGAATTGGGACACGCTGCAGAAGGCCGCGGTCGCGGCCAG
AGCGAATTCCTATGCGCCCTACTCGAATTTCCCGGTCGGGGTAGCTGGGT
TCGTCAACGACGGCCGGCTCATTACAGGGGTGAATGTTGAGAACGCTTCA
TACGGACTCGCGCTATGTGCCGAGTGTTCGATGATTTCGGCATTATACGC
TACCGGTGGTGGCCGACTTGTTGCCGTCTACTGCGTCGACGGCAACGGGG
ACTCGCTCATGCCATGCGGTCGCTGTCGCCAATTGCTTTACGAGCATGGC
GGACCCGAACTGAAAATCATGACCCCGAAAGGCGTGCAGACAATGGCCCA
GCTCCTTCCCCAAGCATTCAACCCGCAGGAAAGGATATTCGGAAATGACG
AA
>C1
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C2
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C3
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C4
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C5
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
>C6
MGDVNWDTLQKAAVAARANSYAPYSNFPVGVAGFVNDGRLITGVNVENAS
YGLALCAECSMISALYATGGGRLVAVYCVDGNGDSLMPCGRCRQLLYEHG
GPELKIMTPKGVQTMAQLLPQAFNPQERIFGNDE
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 402 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773701
Setting output file names to "/data/1res/cdd/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1764455769
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8333414215
Seed = 414241026
Swapseed = 1579773701
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -899.695220 -- -24.965149
Chain 2 -- -899.695220 -- -24.965149
Chain 3 -- -899.695272 -- -24.965149
Chain 4 -- -899.695220 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -899.695272 -- -24.965149
Chain 2 -- -899.695272 -- -24.965149
Chain 3 -- -899.695135 -- -24.965149
Chain 4 -- -899.695220 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-899.695] (-899.695) (-899.695) (-899.695) * [-899.695] (-899.695) (-899.695) (-899.695)
500 -- [-567.107] (-559.429) (-562.692) (-562.745) * [-566.280] (-561.826) (-571.034) (-557.735) -- 0:00:00
1000 -- (-575.808) [-562.913] (-566.597) (-564.730) * (-567.487) [-557.899] (-562.562) (-563.928) -- 0:00:00
1500 -- [-560.225] (-569.479) (-568.142) (-562.595) * (-560.794) (-561.671) [-559.272] (-560.305) -- 0:00:00
2000 -- (-560.563) (-569.666) [-561.280] (-560.556) * [-559.513] (-569.379) (-568.013) (-567.001) -- 0:00:00
2500 -- (-566.115) [-561.561] (-567.798) (-567.645) * (-568.028) (-568.299) (-569.551) [-564.061] -- 0:00:00
3000 -- (-565.383) (-566.368) (-567.810) [-562.023] * (-567.663) [-559.932] (-567.481) (-572.962) -- 0:00:00
3500 -- (-565.020) (-563.345) (-573.992) [-564.522] * (-564.166) (-564.441) [-562.315] (-562.009) -- 0:00:00
4000 -- (-566.166) (-569.362) (-564.482) [-563.190] * (-559.379) [-560.799] (-560.400) (-565.246) -- 0:00:00
4500 -- (-569.672) [-560.796] (-564.863) (-568.264) * (-562.976) (-563.799) [-562.934] (-562.901) -- 0:00:00
5000 -- (-568.052) [-566.173] (-568.692) (-572.031) * (-558.458) (-562.046) [-569.936] (-557.739) -- 0:00:00
Average standard deviation of split frequencies: 0.109994
5500 -- (-563.328) (-570.471) [-561.934] (-566.746) * (-566.646) (-563.223) [-565.120] (-571.209) -- 0:00:00
6000 -- (-565.169) [-564.776] (-561.762) (-564.240) * [-560.826] (-569.456) (-572.362) (-568.273) -- 0:00:00
6500 -- (-572.295) [-559.456] (-565.839) (-563.556) * (-571.671) (-570.142) [-564.693] (-565.682) -- 0:00:00
7000 -- [-561.452] (-569.165) (-564.831) (-566.359) * (-557.763) (-576.078) (-558.100) [-568.043] -- 0:00:00
7500 -- (-563.956) (-577.756) (-565.348) [-561.936] * (-573.686) (-564.870) (-561.008) [-564.287] -- 0:00:00
8000 -- (-558.674) [-571.738] (-572.295) (-564.971) * (-566.699) (-570.458) [-562.372] (-564.874) -- 0:00:00
8500 -- [-559.729] (-559.009) (-564.218) (-558.749) * [-565.542] (-565.881) (-566.936) (-562.925) -- 0:00:00
9000 -- [-563.316] (-555.889) (-569.777) (-562.285) * (-573.302) (-561.331) (-564.850) [-559.551] -- 0:00:00
9500 -- (-562.404) [-555.148] (-560.991) (-562.861) * [-561.036] (-560.630) (-560.562) (-561.330) -- 0:01:44
10000 -- (-560.303) (-554.379) (-562.304) [-562.046] * (-565.079) (-565.550) (-558.971) [-559.490] -- 0:01:39
Average standard deviation of split frequencies: 0.077990
10500 -- (-566.047) (-553.848) [-565.907] (-564.201) * (-561.274) [-566.401] (-562.504) (-561.686) -- 0:01:34
11000 -- (-569.903) [-554.937] (-567.278) (-567.668) * [-557.261] (-560.587) (-570.418) (-570.334) -- 0:01:29
11500 -- (-564.739) (-556.089) [-564.375] (-558.686) * (-572.473) (-563.057) [-562.217] (-575.397) -- 0:01:25
12000 -- [-561.267] (-557.780) (-559.629) (-560.087) * (-559.975) (-557.617) (-561.078) [-565.473] -- 0:01:22
12500 -- (-573.697) [-559.364] (-559.336) (-561.798) * [-562.058] (-571.636) (-560.436) (-562.129) -- 0:01:19
13000 -- (-568.747) [-557.820] (-564.144) (-560.806) * (-565.252) (-568.086) (-562.707) [-563.094] -- 0:01:15
13500 -- (-566.162) (-554.139) (-566.038) [-559.460] * [-556.667] (-562.130) (-567.088) (-563.342) -- 0:01:13
14000 -- (-572.871) (-556.087) (-565.223) [-559.721] * (-570.597) (-566.489) [-559.600] (-558.466) -- 0:01:10
14500 -- (-558.658) (-554.298) (-567.883) [-568.857] * [-568.333] (-572.318) (-564.167) (-565.122) -- 0:01:07
15000 -- [-553.031] (-553.156) (-570.624) (-563.820) * (-565.270) (-568.249) [-565.665] (-570.879) -- 0:01:05
Average standard deviation of split frequencies: 0.072020
15500 -- (-554.228) [-554.966] (-563.917) (-568.245) * (-559.759) (-566.692) [-568.829] (-573.833) -- 0:01:03
16000 -- [-556.277] (-553.395) (-563.827) (-559.763) * [-568.623] (-580.347) (-569.259) (-566.441) -- 0:01:01
16500 -- (-553.801) (-555.073) [-563.727] (-565.089) * (-560.452) [-562.147] (-566.146) (-569.912) -- 0:00:59
17000 -- (-556.928) (-554.416) [-561.781] (-562.707) * (-566.733) (-562.877) (-566.475) [-561.379] -- 0:00:57
17500 -- (-555.393) [-556.274] (-564.605) (-562.571) * (-566.596) (-560.890) [-568.064] (-560.942) -- 0:00:56
18000 -- [-553.983] (-556.559) (-567.494) (-562.090) * (-565.032) [-572.519] (-562.343) (-569.195) -- 0:00:54
18500 -- (-555.938) [-556.078] (-560.662) (-557.632) * [-569.434] (-567.796) (-563.910) (-564.281) -- 0:00:53
19000 -- (-555.147) [-554.263] (-562.601) (-563.828) * (-563.383) (-580.266) (-567.958) [-565.012] -- 0:00:51
19500 -- [-554.753] (-553.993) (-565.912) (-564.136) * [-564.549] (-574.321) (-579.548) (-560.099) -- 0:00:50
20000 -- [-554.087] (-553.667) (-563.724) (-565.007) * (-565.016) [-569.254] (-570.374) (-564.860) -- 0:00:49
Average standard deviation of split frequencies: 0.065578
20500 -- (-554.572) (-555.581) [-565.154] (-565.388) * [-562.192] (-561.155) (-558.604) (-561.961) -- 0:00:47
21000 -- (-556.380) (-553.467) (-565.219) [-558.038] * (-565.415) (-557.207) (-554.820) [-564.221] -- 0:00:46
21500 -- (-557.096) [-557.592] (-567.031) (-566.040) * [-563.674] (-554.822) (-557.394) (-565.234) -- 0:00:45
22000 -- (-554.724) [-558.224] (-566.915) (-561.093) * (-568.456) (-554.725) (-554.113) [-562.770] -- 0:00:44
22500 -- (-555.436) (-556.514) [-559.070] (-566.059) * (-555.030) (-555.011) (-555.747) [-561.511] -- 0:00:43
23000 -- (-557.923) (-555.442) (-564.001) [-563.492] * (-554.497) [-555.681] (-553.247) (-572.385) -- 0:00:42
23500 -- (-553.086) (-554.461) (-567.843) [-560.338] * (-554.047) [-554.235] (-554.171) (-561.816) -- 0:00:41
24000 -- (-554.327) [-554.763] (-580.247) (-565.687) * [-554.157] (-554.609) (-559.254) (-571.833) -- 0:00:40
24500 -- (-554.321) (-554.468) (-576.851) [-559.017] * (-556.006) (-553.310) (-557.605) [-568.872] -- 0:00:39
25000 -- (-553.013) [-555.278] (-574.976) (-559.760) * [-555.072] (-554.063) (-554.391) (-564.134) -- 0:01:18
Average standard deviation of split frequencies: 0.053486
25500 -- (-555.204) (-553.860) (-565.261) [-567.813] * (-556.119) (-556.288) [-555.807] (-576.565) -- 0:01:16
26000 -- (-553.029) (-557.915) [-563.713] (-563.265) * (-556.444) (-556.098) (-556.250) [-558.125] -- 0:01:14
26500 -- (-555.404) [-556.577] (-560.217) (-569.316) * (-558.868) [-558.701] (-553.375) (-562.773) -- 0:01:13
27000 -- [-554.458] (-554.656) (-568.304) (-562.308) * (-556.508) (-553.799) (-557.951) [-567.322] -- 0:01:12
27500 -- (-555.473) (-552.952) [-566.965] (-568.914) * (-554.514) [-556.350] (-555.021) (-563.421) -- 0:01:10
28000 -- [-555.606] (-553.651) (-567.602) (-569.807) * (-554.041) (-554.949) [-554.050] (-566.722) -- 0:01:09
28500 -- (-554.959) (-553.023) [-553.244] (-571.579) * (-556.265) (-556.738) (-556.501) [-560.757] -- 0:01:08
29000 -- (-553.672) (-556.157) (-554.387) [-560.169] * (-553.511) [-555.627] (-555.112) (-567.984) -- 0:01:06
29500 -- [-554.988] (-556.041) (-552.987) (-562.509) * [-552.939] (-554.109) (-554.538) (-566.888) -- 0:01:05
30000 -- (-556.990) [-555.593] (-554.333) (-561.426) * (-553.792) (-554.555) [-558.694] (-562.978) -- 0:01:04
Average standard deviation of split frequencies: 0.059869
30500 -- (-552.885) (-556.140) [-556.453] (-560.008) * (-556.509) (-554.244) [-554.429] (-567.222) -- 0:01:03
31000 -- (-554.209) (-555.690) [-552.975] (-557.281) * (-553.478) (-555.169) (-553.535) [-562.016] -- 0:01:02
31500 -- (-554.908) [-553.922] (-556.324) (-556.883) * (-554.929) (-560.146) (-553.678) [-565.077] -- 0:01:01
32000 -- (-553.904) (-553.296) (-558.212) [-559.381] * (-553.725) [-555.674] (-554.199) (-562.630) -- 0:01:00
32500 -- (-555.635) [-556.155] (-554.122) (-559.203) * (-554.843) (-553.386) (-561.990) [-562.509] -- 0:00:59
33000 -- (-559.475) (-555.336) [-553.725] (-558.856) * [-554.697] (-556.195) (-557.700) (-572.766) -- 0:00:58
33500 -- (-563.028) [-556.365] (-555.100) (-556.304) * (-555.258) (-556.112) [-554.228] (-565.809) -- 0:00:57
34000 -- (-560.708) [-554.485] (-553.986) (-554.582) * (-552.789) [-558.949] (-554.362) (-558.819) -- 0:00:56
34500 -- (-557.398) (-554.109) [-556.188] (-554.161) * [-553.014] (-555.361) (-555.777) (-557.608) -- 0:00:55
35000 -- (-554.735) (-556.734) [-554.458] (-555.658) * (-553.904) [-554.617] (-553.867) (-555.885) -- 0:00:55
Average standard deviation of split frequencies: 0.052378
35500 -- [-554.703] (-555.627) (-555.435) (-556.773) * (-556.257) (-553.867) (-553.698) [-557.485] -- 0:00:54
36000 -- (-553.030) (-556.018) (-553.242) [-554.900] * (-555.741) (-553.579) [-554.986] (-556.149) -- 0:00:53
36500 -- [-557.986] (-555.006) (-554.058) (-553.314) * [-556.315] (-554.424) (-553.227) (-554.461) -- 0:00:52
37000 -- (-554.376) (-553.106) [-555.089] (-555.371) * (-557.091) [-556.456] (-554.855) (-554.328) -- 0:00:52
37500 -- [-554.910] (-553.783) (-553.202) (-554.471) * (-556.528) (-554.234) (-557.205) [-555.098] -- 0:00:51
38000 -- [-556.483] (-555.306) (-553.361) (-553.532) * (-556.145) (-553.744) (-555.530) [-555.073] -- 0:00:50
38500 -- [-557.801] (-552.919) (-556.170) (-554.731) * (-554.266) [-554.022] (-556.227) (-558.521) -- 0:00:49
39000 -- (-555.342) (-553.051) [-557.658] (-554.497) * [-554.327] (-558.061) (-556.725) (-557.733) -- 0:00:49
39500 -- (-555.768) (-554.386) [-554.536] (-558.931) * (-555.298) (-560.176) (-558.372) [-553.746] -- 0:00:48
40000 -- (-555.554) (-553.529) [-557.869] (-561.962) * [-554.407] (-554.602) (-560.646) (-553.002) -- 0:00:48
Average standard deviation of split frequencies: 0.043927
40500 -- (-553.630) (-553.635) (-553.690) [-554.231] * (-556.675) (-553.662) (-558.790) [-553.978] -- 0:00:47
41000 -- (-555.008) (-554.997) [-557.042] (-558.316) * (-556.403) (-555.835) [-559.161] (-554.965) -- 0:00:46
41500 -- (-556.723) (-554.123) (-553.114) [-554.506] * (-553.518) (-554.646) [-555.124] (-557.859) -- 0:00:46
42000 -- [-554.660] (-555.647) (-554.563) (-554.491) * [-555.388] (-554.777) (-554.968) (-554.903) -- 0:01:08
42500 -- (-554.594) (-555.420) [-552.964] (-554.412) * [-557.386] (-555.369) (-554.117) (-553.433) -- 0:01:07
43000 -- (-556.765) [-553.515] (-555.125) (-558.154) * (-560.844) (-555.238) [-554.421] (-553.659) -- 0:01:06
43500 -- (-555.776) [-554.641] (-554.056) (-555.795) * (-559.239) (-555.423) (-554.630) [-553.018] -- 0:01:05
44000 -- [-555.054] (-556.458) (-553.942) (-553.852) * [-557.590] (-555.893) (-557.400) (-554.130) -- 0:01:05
44500 -- (-555.433) (-559.214) (-554.985) [-554.119] * (-562.238) (-555.843) [-553.941] (-554.775) -- 0:01:04
45000 -- (-554.107) (-556.700) [-555.571] (-557.274) * (-555.137) (-553.098) [-554.168] (-554.649) -- 0:01:03
Average standard deviation of split frequencies: 0.035645
45500 -- (-554.295) (-559.185) [-553.089] (-560.256) * (-555.360) [-554.416] (-555.124) (-559.267) -- 0:01:02
46000 -- (-553.154) [-557.116] (-554.346) (-557.481) * (-553.268) [-555.319] (-554.520) (-561.016) -- 0:01:02
46500 -- [-554.432] (-559.029) (-553.285) (-558.620) * (-560.534) [-554.500] (-554.813) (-555.242) -- 0:01:01
47000 -- (-553.913) (-554.666) [-553.318] (-554.029) * (-553.212) [-553.414] (-554.660) (-555.793) -- 0:01:00
47500 -- (-553.760) (-555.300) (-554.571) [-552.977] * (-553.271) (-557.178) (-556.140) [-554.073] -- 0:01:00
48000 -- (-555.229) (-556.212) (-554.374) [-554.442] * [-554.014] (-555.416) (-554.630) (-555.319) -- 0:00:59
48500 -- (-553.761) [-555.769] (-554.760) (-557.813) * [-554.112] (-556.883) (-553.672) (-556.277) -- 0:00:58
49000 -- (-557.716) [-553.845] (-556.024) (-557.379) * (-553.809) (-556.214) [-553.921] (-559.092) -- 0:00:58
49500 -- (-553.059) (-556.379) (-553.587) [-553.662] * (-554.391) (-554.085) [-554.844] (-553.524) -- 0:00:57
50000 -- (-555.470) (-555.835) (-555.208) [-554.449] * [-553.143] (-553.344) (-555.169) (-554.722) -- 0:00:57
Average standard deviation of split frequencies: 0.033833
50500 -- (-558.887) [-555.868] (-554.014) (-553.908) * (-553.438) (-556.488) [-557.506] (-554.434) -- 0:00:56
51000 -- (-558.854) [-553.963] (-553.000) (-555.472) * (-555.004) (-555.563) (-553.888) [-553.090] -- 0:00:55
51500 -- (-560.788) (-554.782) (-554.827) [-555.326] * (-556.197) [-554.458] (-554.842) (-553.842) -- 0:00:55
52000 -- (-556.927) (-557.405) [-553.580] (-557.218) * [-554.908] (-554.134) (-557.242) (-554.139) -- 0:00:54
52500 -- (-557.528) (-556.591) (-553.563) [-553.332] * [-562.491] (-556.461) (-554.626) (-554.153) -- 0:00:54
53000 -- (-554.482) (-553.874) (-554.095) [-554.369] * (-559.277) [-554.364] (-555.081) (-553.265) -- 0:00:53
53500 -- (-555.889) [-555.769] (-556.139) (-554.359) * (-555.321) [-555.120] (-555.050) (-554.680) -- 0:00:53
54000 -- (-559.900) (-556.388) (-556.430) [-554.706] * (-560.476) (-554.555) [-555.142] (-554.401) -- 0:00:52
54500 -- [-557.061] (-553.338) (-557.387) (-555.121) * (-560.072) (-556.608) (-555.175) [-557.723] -- 0:00:52
55000 -- (-556.721) (-554.637) (-555.496) [-553.524] * (-553.573) (-553.371) [-554.614] (-554.210) -- 0:00:51
Average standard deviation of split frequencies: 0.039564
55500 -- [-554.934] (-553.197) (-554.825) (-554.444) * (-555.802) [-552.949] (-553.125) (-554.402) -- 0:00:51
56000 -- (-560.405) (-556.566) (-556.069) [-558.382] * (-554.616) [-554.643] (-554.310) (-555.611) -- 0:00:50
56500 -- (-557.697) [-559.568] (-554.324) (-557.019) * [-554.816] (-554.008) (-553.128) (-555.281) -- 0:00:50
57000 -- (-555.212) (-554.359) (-559.132) [-553.351] * [-553.265] (-553.231) (-554.329) (-557.299) -- 0:00:49
57500 -- [-555.381] (-555.944) (-554.104) (-554.032) * (-553.603) (-555.177) (-555.333) [-556.622] -- 0:00:49
58000 -- (-552.870) (-555.075) [-553.976] (-558.983) * (-554.012) [-553.912] (-554.107) (-553.994) -- 0:00:48
58500 -- (-553.519) (-556.383) [-553.113] (-553.736) * [-553.641] (-553.240) (-553.599) (-557.664) -- 0:00:48
59000 -- (-552.870) (-556.589) [-555.899] (-552.977) * (-560.786) [-556.297] (-556.076) (-557.286) -- 0:00:47
59500 -- (-554.620) (-555.234) [-553.838] (-557.178) * [-553.682] (-552.833) (-554.250) (-553.023) -- 0:01:03
60000 -- (-555.911) [-556.305] (-553.339) (-554.668) * [-554.002] (-555.021) (-558.408) (-554.327) -- 0:01:02
Average standard deviation of split frequencies: 0.040406
60500 -- (-559.093) (-553.796) (-554.647) [-556.079] * [-555.814] (-555.000) (-557.227) (-554.949) -- 0:01:02
61000 -- (-555.917) [-554.618] (-559.510) (-556.278) * (-558.767) (-554.981) [-555.140] (-553.679) -- 0:01:01
61500 -- (-554.686) (-554.165) [-553.194] (-554.397) * (-553.326) [-554.349] (-555.211) (-553.714) -- 0:01:01
62000 -- [-556.231] (-553.725) (-554.514) (-554.709) * (-554.975) (-553.010) [-558.941] (-553.709) -- 0:01:00
62500 -- (-554.327) [-553.701] (-553.408) (-555.019) * (-556.655) (-556.429) [-554.242] (-553.737) -- 0:01:00
63000 -- (-555.964) (-555.568) [-554.392] (-554.891) * (-553.739) (-553.610) [-553.482] (-553.132) -- 0:00:59
63500 -- (-555.123) [-556.173] (-553.241) (-554.952) * (-554.666) [-554.612] (-553.371) (-556.987) -- 0:00:58
64000 -- (-554.685) [-554.475] (-552.857) (-553.774) * (-553.454) (-554.098) (-554.236) [-554.437] -- 0:00:58
64500 -- [-553.592] (-554.963) (-553.635) (-554.107) * (-553.322) (-557.222) (-554.577) [-555.823] -- 0:00:58
65000 -- [-553.306] (-553.420) (-558.203) (-555.090) * (-554.901) (-555.769) (-558.241) [-554.670] -- 0:00:57
Average standard deviation of split frequencies: 0.043476
65500 -- (-557.132) (-554.897) (-553.675) [-554.282] * (-556.155) (-557.939) [-555.069] (-557.575) -- 0:00:57
66000 -- (-554.538) [-555.409] (-555.654) (-555.179) * (-554.975) [-554.183] (-554.070) (-557.956) -- 0:00:56
66500 -- (-554.344) (-554.702) (-554.274) [-554.212] * [-554.119] (-557.451) (-557.180) (-557.964) -- 0:00:56
67000 -- [-552.745] (-558.178) (-553.382) (-560.214) * (-554.099) [-553.171] (-559.084) (-555.461) -- 0:00:55
67500 -- [-556.684] (-557.622) (-554.953) (-556.039) * (-556.301) (-555.180) (-556.926) [-555.561] -- 0:00:55
68000 -- (-556.493) [-555.668] (-555.294) (-556.452) * (-553.614) (-554.887) (-554.937) [-552.763] -- 0:00:54
68500 -- (-558.575) [-553.648] (-555.746) (-558.121) * [-554.982] (-558.650) (-553.962) (-553.430) -- 0:00:54
69000 -- (-562.493) (-555.561) [-555.052] (-554.067) * (-554.687) (-554.961) [-556.035] (-553.902) -- 0:00:53
69500 -- (-557.380) (-556.258) (-555.084) [-553.043] * (-559.871) [-553.530] (-554.039) (-553.849) -- 0:00:53
70000 -- (-555.204) (-557.742) (-555.717) [-554.379] * (-557.094) [-553.037] (-552.954) (-559.882) -- 0:00:53
Average standard deviation of split frequencies: 0.039155
70500 -- (-553.292) (-564.390) [-553.327] (-556.592) * (-552.756) (-555.575) (-553.129) [-554.461] -- 0:00:52
71000 -- (-553.196) (-554.818) (-552.761) [-554.886] * (-553.138) (-555.628) (-552.820) [-553.975] -- 0:00:52
71500 -- (-553.775) (-554.933) [-556.427] (-554.198) * (-554.656) (-553.970) (-555.012) [-554.219] -- 0:00:51
72000 -- (-555.062) (-555.255) (-554.084) [-555.531] * (-554.485) [-555.095] (-555.629) (-557.624) -- 0:00:51
72500 -- (-556.634) (-556.001) (-556.620) [-554.724] * (-556.284) [-556.012] (-561.655) (-559.465) -- 0:00:51
73000 -- (-557.549) (-555.381) (-555.634) [-553.870] * (-555.287) (-555.110) [-556.920] (-559.580) -- 0:00:50
73500 -- (-553.275) [-555.054] (-555.786) (-555.106) * (-553.352) (-554.208) [-556.272] (-559.437) -- 0:00:50
74000 -- [-557.316] (-557.473) (-554.909) (-555.587) * (-553.332) (-553.655) (-553.478) [-554.514] -- 0:00:50
74500 -- (-556.914) [-553.334] (-558.812) (-555.365) * [-553.281] (-555.749) (-554.827) (-555.455) -- 0:00:49
75000 -- (-553.118) (-554.400) [-558.116] (-554.298) * [-553.428] (-556.825) (-553.357) (-554.722) -- 0:00:49
Average standard deviation of split frequencies: 0.037216
75500 -- (-554.465) (-560.385) (-556.847) [-554.128] * (-554.188) (-555.266) (-558.107) [-554.938] -- 0:00:48
76000 -- (-553.446) (-553.431) [-554.646] (-554.861) * [-555.415] (-554.161) (-556.522) (-556.789) -- 0:01:00
76500 -- [-559.122] (-554.214) (-554.832) (-556.156) * (-561.372) (-557.186) [-556.434] (-555.760) -- 0:01:00
77000 -- (-553.458) (-558.105) [-555.514] (-555.633) * (-555.135) (-557.087) [-556.199] (-553.604) -- 0:00:59
77500 -- [-552.976] (-555.285) (-556.013) (-554.699) * (-553.511) (-553.143) [-553.956] (-553.565) -- 0:00:59
78000 -- (-552.884) (-557.676) [-555.185] (-554.540) * (-556.702) (-555.377) [-553.940] (-554.558) -- 0:00:59
78500 -- (-554.797) (-558.924) (-556.505) [-554.088] * (-555.501) [-555.069] (-555.850) (-554.270) -- 0:00:58
79000 -- (-554.215) (-558.816) (-554.353) [-553.411] * (-552.808) (-553.697) [-555.980] (-554.113) -- 0:00:58
79500 -- (-554.593) (-554.251) (-554.228) [-554.444] * [-556.295] (-554.814) (-555.284) (-554.683) -- 0:00:57
80000 -- [-556.525] (-554.546) (-556.132) (-554.959) * [-554.308] (-555.649) (-553.340) (-554.930) -- 0:00:57
Average standard deviation of split frequencies: 0.035355
80500 -- [-557.485] (-557.577) (-555.964) (-554.451) * (-554.446) [-554.194] (-553.816) (-555.076) -- 0:00:57
81000 -- (-556.581) (-555.259) (-554.529) [-554.452] * (-560.633) (-553.274) [-553.412] (-558.553) -- 0:00:56
81500 -- (-554.705) (-554.246) [-557.535] (-555.877) * (-554.844) (-553.189) (-554.577) [-554.041] -- 0:00:56
82000 -- [-553.644] (-554.955) (-555.991) (-554.289) * [-557.227] (-555.092) (-554.667) (-556.025) -- 0:00:55
82500 -- (-556.690) (-554.186) [-555.310] (-557.218) * (-557.103) (-560.278) [-554.780] (-554.180) -- 0:00:55
83000 -- (-555.509) (-553.088) (-553.912) [-555.045] * [-553.959] (-556.344) (-554.402) (-554.350) -- 0:00:55
83500 -- (-554.740) [-553.381] (-553.169) (-557.262) * (-558.183) (-554.015) [-556.097] (-554.769) -- 0:00:54
84000 -- (-554.575) (-557.606) [-553.513] (-558.998) * (-558.569) [-554.103] (-554.840) (-556.965) -- 0:00:54
84500 -- [-556.753] (-554.162) (-554.356) (-553.518) * (-555.764) (-554.535) [-555.813] (-556.245) -- 0:00:54
85000 -- [-553.153] (-556.663) (-553.908) (-553.823) * (-553.091) (-555.225) [-555.053] (-555.010) -- 0:00:53
Average standard deviation of split frequencies: 0.031792
85500 -- (-557.964) (-557.226) (-555.872) [-555.603] * [-556.516] (-553.937) (-556.119) (-553.438) -- 0:00:53
86000 -- [-553.131] (-556.247) (-557.499) (-554.957) * (-554.492) (-556.777) [-559.271] (-554.531) -- 0:00:53
86500 -- (-554.099) (-556.069) (-553.380) [-555.339] * (-552.898) (-555.540) [-556.834] (-553.638) -- 0:00:52
87000 -- [-555.289] (-557.078) (-557.511) (-553.725) * (-556.352) (-556.971) (-555.423) [-554.319] -- 0:00:52
87500 -- (-555.508) (-555.338) [-554.774] (-555.363) * (-554.144) [-554.200] (-555.234) (-555.824) -- 0:00:52
88000 -- (-553.395) [-553.357] (-555.480) (-555.595) * (-553.227) (-553.575) [-553.970] (-558.214) -- 0:00:51
88500 -- [-555.591] (-554.011) (-556.927) (-557.139) * (-555.827) [-556.633] (-558.169) (-557.898) -- 0:00:51
89000 -- (-555.106) [-554.553] (-556.848) (-555.251) * (-554.703) [-554.824] (-556.884) (-556.120) -- 0:00:51
89500 -- (-554.907) (-553.275) [-553.796] (-562.412) * (-561.308) (-555.388) [-554.554] (-556.466) -- 0:00:50
90000 -- [-554.108] (-554.625) (-554.589) (-567.280) * (-555.745) (-555.987) [-553.608] (-556.149) -- 0:00:50
Average standard deviation of split frequencies: 0.025006
90500 -- (-552.761) (-555.459) (-556.198) [-559.965] * (-560.647) (-555.182) (-554.945) [-558.519] -- 0:00:50
91000 -- [-553.644] (-555.106) (-554.066) (-557.030) * (-555.895) (-556.463) [-558.051] (-554.918) -- 0:00:49
91500 -- (-555.296) [-554.147] (-553.651) (-554.319) * (-553.872) (-554.180) [-559.117] (-555.712) -- 0:00:49
92000 -- (-556.479) (-554.645) [-554.235] (-553.459) * (-555.841) (-557.545) (-558.415) [-554.108] -- 0:00:49
92500 -- (-557.942) [-553.268] (-553.014) (-558.123) * [-556.065] (-565.193) (-556.903) (-555.986) -- 0:00:49
93000 -- (-554.275) (-553.995) (-555.026) [-555.434] * (-558.158) (-554.641) (-556.898) [-562.393] -- 0:00:58
93500 -- (-556.291) (-555.661) [-554.021] (-555.566) * (-554.656) (-553.377) [-556.602] (-555.188) -- 0:00:58
94000 -- (-554.827) (-554.344) [-555.060] (-553.649) * [-554.927] (-556.484) (-557.130) (-556.738) -- 0:00:57
94500 -- [-554.005] (-554.021) (-558.937) (-552.935) * (-555.565) (-554.578) [-554.294] (-554.623) -- 0:00:57
95000 -- (-554.351) (-555.714) (-559.881) [-553.992] * (-557.532) (-553.289) [-555.225] (-556.017) -- 0:00:57
Average standard deviation of split frequencies: 0.024061
95500 -- (-555.485) (-555.200) (-554.327) [-553.475] * (-554.248) (-555.275) [-559.023] (-559.275) -- 0:00:56
96000 -- [-553.207] (-554.406) (-554.558) (-555.053) * [-553.373] (-553.081) (-560.877) (-557.961) -- 0:00:56
96500 -- (-553.109) (-555.869) (-554.041) [-556.504] * [-555.752] (-553.925) (-556.846) (-555.289) -- 0:00:56
97000 -- (-555.940) (-556.995) [-556.043] (-556.406) * (-553.273) (-556.598) (-557.572) [-557.114] -- 0:00:55
97500 -- (-555.508) (-556.826) [-553.272] (-553.863) * [-553.565] (-556.262) (-554.911) (-557.427) -- 0:00:55
98000 -- (-555.027) (-553.795) [-553.836] (-555.514) * (-553.233) (-553.981) [-553.920] (-553.381) -- 0:00:55
98500 -- (-553.231) (-552.920) [-555.164] (-553.709) * (-554.253) (-554.273) [-554.043] (-554.905) -- 0:00:54
99000 -- (-552.987) (-554.975) [-557.939] (-555.267) * [-555.512] (-553.199) (-555.318) (-555.548) -- 0:00:54
99500 -- (-556.186) (-557.516) (-555.724) [-555.772] * (-555.343) (-557.253) (-560.181) [-556.390] -- 0:00:54
100000 -- (-552.669) (-554.961) [-554.491] (-558.274) * (-553.163) (-557.409) [-556.052] (-559.108) -- 0:00:54
Average standard deviation of split frequencies: 0.024154
100500 -- [-552.734] (-555.102) (-554.054) (-556.350) * (-554.269) (-554.148) [-554.048] (-557.519) -- 0:00:53
101000 -- (-556.529) [-556.720] (-557.234) (-557.999) * (-555.115) (-553.698) [-553.415] (-554.807) -- 0:00:53
101500 -- (-554.599) (-556.189) [-555.805] (-557.556) * [-556.650] (-554.436) (-553.062) (-554.326) -- 0:00:53
102000 -- (-559.030) (-553.274) [-556.756] (-555.472) * (-557.886) (-555.256) (-555.248) [-558.267] -- 0:00:52
102500 -- (-555.296) (-555.221) (-555.499) [-557.806] * (-555.788) [-558.078] (-556.588) (-553.398) -- 0:00:52
103000 -- (-558.050) (-554.781) (-571.229) [-554.302] * (-553.774) (-555.754) (-556.557) [-553.657] -- 0:00:52
103500 -- [-554.804] (-555.433) (-557.646) (-553.399) * (-553.349) (-559.494) (-554.996) [-555.459] -- 0:00:51
104000 -- (-556.269) (-557.086) [-558.251] (-554.337) * (-556.487) (-557.661) [-554.218] (-553.902) -- 0:00:51
104500 -- (-554.784) (-552.984) [-554.792] (-554.073) * [-554.232] (-554.979) (-555.687) (-553.394) -- 0:00:51
105000 -- (-554.623) (-552.987) [-554.751] (-555.049) * [-555.988] (-553.415) (-563.112) (-555.214) -- 0:00:51
Average standard deviation of split frequencies: 0.021768
105500 -- (-554.463) [-552.965] (-556.551) (-553.591) * [-554.460] (-555.463) (-556.755) (-554.397) -- 0:00:50
106000 -- (-557.687) [-555.087] (-556.022) (-553.484) * [-554.016] (-555.370) (-555.600) (-556.457) -- 0:00:50
106500 -- (-553.928) (-553.250) [-554.715] (-553.155) * (-553.702) (-556.812) [-558.253] (-554.027) -- 0:00:50
107000 -- (-554.410) [-554.532] (-554.106) (-554.004) * [-553.607] (-556.255) (-558.501) (-554.160) -- 0:00:50
107500 -- (-554.004) [-554.782] (-553.052) (-555.805) * (-553.727) (-555.359) [-553.259] (-555.271) -- 0:00:49
108000 -- [-556.854] (-559.713) (-556.420) (-562.774) * (-554.471) [-553.419] (-555.465) (-553.313) -- 0:00:49
108500 -- (-558.517) (-562.081) (-557.352) [-553.593] * (-555.834) (-553.714) [-554.678] (-554.360) -- 0:00:49
109000 -- (-554.890) (-558.255) (-553.331) [-554.699] * (-556.883) (-554.452) (-555.120) [-553.840] -- 0:00:49
109500 -- (-555.970) (-553.386) [-554.927] (-555.665) * (-555.998) [-554.593] (-556.605) (-553.283) -- 0:00:48
110000 -- (-553.531) [-554.958] (-554.673) (-553.506) * (-554.213) [-555.513] (-557.887) (-553.428) -- 0:00:56
Average standard deviation of split frequencies: 0.020825
110500 -- (-555.287) (-555.972) (-559.433) [-553.741] * [-554.367] (-557.591) (-554.219) (-555.980) -- 0:00:56
111000 -- (-553.474) (-557.910) [-553.304] (-554.285) * (-556.725) (-555.138) [-553.633] (-558.607) -- 0:00:56
111500 -- (-554.548) [-554.590] (-557.127) (-553.339) * (-553.969) (-554.875) (-553.539) [-554.820] -- 0:00:55
112000 -- (-554.919) [-556.661] (-555.626) (-556.144) * (-553.184) [-559.138] (-557.307) (-553.796) -- 0:00:55
112500 -- (-558.450) (-554.217) (-553.211) [-553.663] * (-555.913) (-558.793) [-557.143] (-557.498) -- 0:00:55
113000 -- (-555.049) [-562.273] (-554.615) (-555.626) * (-556.517) (-553.783) (-554.589) [-555.920] -- 0:00:54
113500 -- (-556.243) (-555.959) (-558.200) [-554.491] * [-553.344] (-555.731) (-553.408) (-557.156) -- 0:00:54
114000 -- (-555.714) (-559.582) [-556.239] (-556.170) * (-556.889) (-554.180) [-558.391] (-556.154) -- 0:00:54
114500 -- (-557.173) [-559.513] (-555.676) (-554.121) * (-555.352) [-555.288] (-553.887) (-557.043) -- 0:00:54
115000 -- (-556.068) (-565.006) [-556.700] (-560.409) * (-556.352) (-555.655) (-553.444) [-554.607] -- 0:00:53
Average standard deviation of split frequencies: 0.021222
115500 -- (-555.018) (-557.346) (-553.851) [-554.728] * [-556.783] (-554.692) (-554.007) (-555.370) -- 0:00:53
116000 -- [-554.060] (-555.458) (-555.200) (-553.930) * (-555.526) [-557.799] (-553.392) (-555.720) -- 0:00:53
116500 -- [-557.220] (-555.350) (-555.255) (-557.236) * (-555.319) (-557.971) (-556.140) [-553.369] -- 0:00:53
117000 -- [-556.626] (-553.823) (-556.732) (-559.698) * (-554.913) (-554.051) (-554.611) [-554.563] -- 0:00:52
117500 -- (-556.238) [-556.971] (-561.081) (-556.001) * (-553.348) (-553.136) [-558.666] (-553.416) -- 0:00:52
118000 -- [-555.480] (-556.901) (-556.945) (-553.871) * (-556.843) [-553.193] (-555.072) (-554.919) -- 0:00:52
118500 -- [-552.906] (-555.116) (-554.058) (-554.029) * [-554.450] (-554.714) (-556.215) (-553.786) -- 0:00:52
119000 -- [-556.500] (-554.793) (-557.488) (-554.541) * [-553.846] (-554.781) (-554.138) (-555.352) -- 0:00:51
119500 -- (-555.069) (-554.986) [-553.770] (-553.410) * (-554.488) (-553.369) [-558.550] (-553.890) -- 0:00:51
120000 -- (-553.161) (-559.879) [-554.624] (-553.605) * (-554.577) [-552.630] (-555.409) (-558.327) -- 0:00:51
Average standard deviation of split frequencies: 0.019993
120500 -- (-553.501) (-554.054) (-554.333) [-553.409] * (-554.888) [-553.051] (-556.355) (-557.775) -- 0:00:51
121000 -- (-553.262) (-555.793) (-553.656) [-553.114] * (-554.025) (-554.062) [-554.025] (-552.924) -- 0:00:50
121500 -- (-556.375) (-556.659) [-554.765] (-555.988) * (-552.812) (-554.390) (-554.226) [-556.254] -- 0:00:50
122000 -- (-556.018) (-555.313) (-557.446) [-555.557] * [-553.272] (-554.954) (-553.494) (-556.453) -- 0:00:50
122500 -- [-554.709] (-554.646) (-555.301) (-556.398) * (-554.436) (-554.204) [-556.438] (-553.691) -- 0:00:50
123000 -- (-554.398) [-553.634] (-555.009) (-554.381) * (-554.071) (-553.391) [-556.292] (-555.021) -- 0:00:49
123500 -- (-559.164) (-553.837) (-554.651) [-552.733] * (-554.983) (-556.634) (-556.579) [-554.361] -- 0:00:49
124000 -- (-556.130) (-553.824) (-556.782) [-553.188] * (-557.073) (-555.472) (-555.355) [-553.187] -- 0:00:49
124500 -- [-554.642] (-554.707) (-556.377) (-552.749) * (-553.678) (-555.810) [-557.732] (-556.619) -- 0:00:49
125000 -- (-554.120) [-555.884] (-554.033) (-556.634) * (-553.765) (-555.405) [-555.321] (-557.535) -- 0:00:49
Average standard deviation of split frequencies: 0.019330
125500 -- (-557.509) (-553.944) (-553.414) [-555.584] * [-560.567] (-555.823) (-556.667) (-554.709) -- 0:00:48
126000 -- (-555.251) [-553.913] (-554.649) (-554.360) * (-562.271) (-556.973) [-554.070] (-554.797) -- 0:00:48
126500 -- (-557.873) (-554.837) [-555.307] (-555.844) * (-555.796) [-553.915] (-554.005) (-553.834) -- 0:00:48
127000 -- (-556.212) (-554.788) [-555.549] (-556.303) * (-553.987) (-557.561) (-555.636) [-558.939] -- 0:00:54
127500 -- (-552.763) [-553.661] (-558.641) (-560.414) * (-553.716) (-554.375) [-557.874] (-557.725) -- 0:00:54
128000 -- (-554.976) (-554.637) [-554.553] (-555.812) * [-558.245] (-554.674) (-556.450) (-554.259) -- 0:00:54
128500 -- [-553.875] (-553.486) (-555.472) (-555.438) * (-554.571) (-553.641) (-554.948) [-553.620] -- 0:00:54
129000 -- (-555.482) (-554.179) (-554.574) [-554.670] * (-553.746) [-553.122] (-554.977) (-555.899) -- 0:00:54
129500 -- (-554.507) (-558.229) [-555.112] (-553.718) * (-555.821) [-553.117] (-554.076) (-553.379) -- 0:00:53
130000 -- (-554.799) (-556.387) [-554.325] (-557.172) * [-554.746] (-555.184) (-553.650) (-556.761) -- 0:00:53
Average standard deviation of split frequencies: 0.016899
130500 -- [-554.427] (-554.459) (-554.832) (-555.133) * (-555.632) (-553.726) [-554.256] (-554.814) -- 0:00:53
131000 -- (-553.331) (-556.592) (-555.097) [-555.339] * (-554.111) [-553.092] (-554.155) (-554.132) -- 0:00:53
131500 -- (-553.331) [-554.871] (-557.100) (-555.866) * (-553.175) [-553.260] (-555.553) (-554.112) -- 0:00:52
132000 -- (-559.163) [-555.955] (-556.141) (-559.371) * (-553.490) [-555.598] (-555.940) (-556.364) -- 0:00:52
132500 -- [-556.244] (-554.461) (-555.133) (-556.324) * [-553.499] (-555.410) (-557.489) (-556.718) -- 0:00:52
133000 -- (-555.222) (-553.364) (-554.470) [-558.257] * (-556.546) [-552.857] (-554.590) (-553.500) -- 0:00:52
133500 -- (-553.170) [-554.981] (-555.492) (-559.267) * (-561.015) [-553.779] (-555.255) (-559.772) -- 0:00:51
134000 -- (-555.307) [-556.633] (-556.308) (-558.541) * (-555.360) (-555.662) (-553.037) [-554.342] -- 0:00:51
134500 -- [-552.799] (-555.428) (-557.142) (-554.699) * (-556.326) (-555.149) (-555.060) [-553.330] -- 0:00:51
135000 -- (-556.933) [-559.370] (-556.851) (-555.493) * (-555.037) (-554.072) (-557.385) [-554.959] -- 0:00:51
Average standard deviation of split frequencies: 0.017716
135500 -- (-553.102) (-555.924) (-555.089) [-554.660] * (-553.764) [-555.951] (-555.411) (-554.192) -- 0:00:51
136000 -- (-552.807) (-557.379) (-554.873) [-553.666] * (-555.538) [-553.055] (-553.452) (-555.242) -- 0:00:50
136500 -- [-554.889] (-558.430) (-555.931) (-555.021) * [-553.919] (-553.532) (-556.300) (-557.804) -- 0:00:50
137000 -- (-559.305) [-554.702] (-555.104) (-554.121) * [-555.681] (-556.403) (-555.229) (-555.418) -- 0:00:50
137500 -- (-557.234) [-556.388] (-556.264) (-554.171) * (-555.086) (-556.134) [-556.787] (-555.176) -- 0:00:50
138000 -- (-554.921) [-559.093] (-555.517) (-553.235) * [-555.276] (-554.235) (-554.583) (-558.463) -- 0:00:49
138500 -- [-553.855] (-556.591) (-557.600) (-556.479) * [-556.650] (-553.196) (-555.256) (-555.519) -- 0:00:49
139000 -- (-556.841) (-552.915) (-553.381) [-554.236] * (-556.683) (-556.977) [-553.994] (-557.297) -- 0:00:49
139500 -- (-554.560) (-556.153) (-555.370) [-557.500] * (-553.730) [-554.347] (-556.442) (-554.798) -- 0:00:49
140000 -- (-555.237) (-553.440) [-554.132] (-556.161) * (-556.616) (-556.229) [-557.209] (-555.370) -- 0:00:49
Average standard deviation of split frequencies: 0.017991
140500 -- (-555.293) (-553.565) (-557.028) [-556.189] * (-555.465) [-554.966] (-554.379) (-553.761) -- 0:00:48
141000 -- (-553.049) (-562.018) [-555.137] (-560.397) * [-555.303] (-555.548) (-554.803) (-557.447) -- 0:00:48
141500 -- (-553.037) [-553.292] (-555.632) (-557.378) * (-554.125) (-554.533) [-554.152] (-556.882) -- 0:00:48
142000 -- (-553.038) [-552.919] (-554.300) (-555.260) * (-554.117) [-553.735] (-553.176) (-553.229) -- 0:00:48
142500 -- [-552.899] (-553.855) (-553.401) (-553.305) * (-558.004) [-553.274] (-554.344) (-555.792) -- 0:00:48
143000 -- (-554.634) [-553.920] (-553.641) (-553.975) * [-553.231] (-552.795) (-552.816) (-554.027) -- 0:00:53
143500 -- (-559.602) [-554.707] (-553.703) (-553.599) * (-556.413) (-554.464) [-554.328] (-556.595) -- 0:00:53
144000 -- (-552.672) [-554.508] (-553.817) (-554.836) * (-556.252) [-554.716] (-554.420) (-553.587) -- 0:00:53
144500 -- (-559.127) (-555.605) [-557.881] (-554.197) * [-553.259] (-556.564) (-556.687) (-554.201) -- 0:00:53
145000 -- (-552.995) (-552.828) (-556.525) [-554.568] * (-553.238) (-555.847) [-556.230] (-554.097) -- 0:00:53
Average standard deviation of split frequencies: 0.016484
145500 -- (-553.786) (-553.237) [-555.515] (-555.795) * (-555.140) [-553.557] (-554.364) (-554.292) -- 0:00:52
146000 -- (-554.859) [-555.518] (-553.173) (-556.404) * (-554.794) [-554.221] (-554.098) (-557.118) -- 0:00:52
146500 -- (-554.103) (-555.420) (-553.379) [-553.917] * (-559.307) [-554.230] (-554.163) (-553.610) -- 0:00:52
147000 -- (-554.619) (-555.386) [-553.369] (-555.291) * (-556.870) (-554.209) (-557.309) [-553.854] -- 0:00:52
147500 -- [-554.152] (-557.192) (-558.447) (-558.947) * [-555.010] (-556.675) (-554.401) (-559.220) -- 0:00:52
148000 -- (-554.028) (-555.868) [-554.879] (-555.056) * (-556.733) [-556.740] (-554.834) (-554.205) -- 0:00:51
148500 -- (-553.569) [-552.996] (-558.840) (-554.558) * (-555.946) (-553.955) (-555.130) [-553.836] -- 0:00:51
149000 -- (-554.954) (-557.403) [-553.389] (-553.012) * (-558.411) [-554.317] (-556.113) (-554.481) -- 0:00:51
149500 -- (-553.473) (-555.650) [-554.768] (-554.435) * [-553.619] (-553.730) (-556.047) (-557.006) -- 0:00:51
150000 -- (-554.653) [-554.162] (-553.021) (-555.012) * [-557.797] (-552.826) (-555.455) (-554.964) -- 0:00:51
Average standard deviation of split frequencies: 0.018279
150500 -- (-555.526) (-553.274) [-554.202] (-555.767) * (-557.137) (-553.630) [-554.331] (-555.492) -- 0:00:50
151000 -- (-556.189) (-556.080) [-555.319] (-555.397) * [-555.910] (-553.772) (-555.082) (-557.128) -- 0:00:50
151500 -- (-554.773) (-558.320) (-558.028) [-554.609] * [-553.459] (-555.986) (-556.141) (-553.464) -- 0:00:50
152000 -- (-556.985) [-555.607] (-554.001) (-556.451) * (-554.955) [-553.442] (-555.348) (-560.568) -- 0:00:50
152500 -- (-555.136) [-554.363] (-553.752) (-558.451) * [-558.522] (-555.723) (-554.555) (-559.420) -- 0:00:50
153000 -- [-554.953] (-554.350) (-558.240) (-554.929) * (-557.667) (-553.932) [-554.075] (-554.038) -- 0:00:49
153500 -- [-555.678] (-555.071) (-560.709) (-555.088) * [-553.526] (-555.718) (-554.778) (-556.800) -- 0:00:49
154000 -- (-557.349) [-555.991] (-556.759) (-555.733) * (-554.021) [-557.549] (-553.159) (-555.184) -- 0:00:49
154500 -- (-556.195) (-558.873) (-556.954) [-553.802] * (-554.720) [-553.685] (-553.191) (-555.614) -- 0:00:49
155000 -- (-554.173) [-555.121] (-556.366) (-559.336) * (-554.800) [-553.906] (-554.278) (-554.676) -- 0:00:49
Average standard deviation of split frequencies: 0.017795
155500 -- (-554.937) [-554.832] (-553.397) (-553.955) * (-556.277) (-556.105) [-553.796] (-554.746) -- 0:00:48
156000 -- (-554.481) (-553.344) (-553.741) [-554.885] * (-556.850) (-555.681) (-554.668) [-554.372] -- 0:00:48
156500 -- (-556.229) [-554.865] (-553.598) (-559.178) * (-554.466) [-554.165] (-556.543) (-554.195) -- 0:00:48
157000 -- (-554.543) [-554.300] (-553.341) (-557.909) * [-553.001] (-555.773) (-554.255) (-559.697) -- 0:00:48
157500 -- [-552.953] (-554.290) (-557.796) (-557.757) * (-557.394) (-555.296) (-556.287) [-557.857] -- 0:00:48
158000 -- [-553.113] (-557.628) (-554.039) (-556.579) * (-553.852) [-552.996] (-556.089) (-556.059) -- 0:00:47
158500 -- (-554.693) (-554.727) (-554.421) [-555.070] * (-554.644) (-553.708) [-554.350] (-556.632) -- 0:00:47
159000 -- (-558.772) (-554.697) [-557.996] (-554.605) * [-553.971] (-553.834) (-555.980) (-554.003) -- 0:00:47
159500 -- (-554.448) [-558.075] (-553.988) (-556.495) * (-554.191) [-554.692] (-558.305) (-556.005) -- 0:00:47
160000 -- (-555.023) (-552.816) [-553.874] (-555.767) * [-553.316] (-554.629) (-552.958) (-556.965) -- 0:00:52
Average standard deviation of split frequencies: 0.017141
160500 -- (-553.853) (-554.713) [-553.409] (-559.406) * (-553.315) [-553.860] (-553.935) (-555.853) -- 0:00:52
161000 -- (-553.083) [-556.058] (-554.210) (-561.168) * [-556.763] (-553.353) (-557.649) (-552.543) -- 0:00:52
161500 -- (-554.146) (-560.702) (-555.860) [-558.160] * [-553.030] (-554.604) (-558.179) (-558.493) -- 0:00:51
162000 -- (-557.459) [-562.595] (-556.250) (-554.200) * (-554.222) [-555.536] (-556.767) (-557.033) -- 0:00:51
162500 -- (-555.163) (-556.319) [-557.008] (-554.396) * (-554.021) (-556.982) [-555.087] (-563.217) -- 0:00:51
163000 -- [-555.143] (-555.847) (-552.863) (-553.212) * [-554.874] (-556.461) (-553.534) (-559.345) -- 0:00:51
163500 -- (-558.061) (-553.778) [-553.598] (-554.945) * (-555.115) [-555.813] (-553.648) (-554.476) -- 0:00:51
164000 -- (-554.341) (-555.152) [-555.575] (-553.129) * (-557.220) (-553.236) [-554.141] (-555.903) -- 0:00:50
164500 -- (-556.248) (-557.913) (-554.934) [-555.685] * [-554.389] (-553.484) (-555.326) (-553.755) -- 0:00:50
165000 -- (-555.608) (-557.447) [-556.579] (-556.321) * [-554.722] (-553.845) (-553.612) (-557.857) -- 0:00:50
Average standard deviation of split frequencies: 0.016897
165500 -- [-553.762] (-555.355) (-554.501) (-554.562) * (-554.562) (-555.559) [-555.908] (-554.158) -- 0:00:50
166000 -- (-553.905) [-553.320] (-556.113) (-554.597) * (-560.119) (-554.603) (-554.395) [-558.009] -- 0:00:50
166500 -- [-555.112] (-553.920) (-559.433) (-553.996) * (-554.105) (-553.044) [-558.372] (-555.476) -- 0:00:50
167000 -- (-552.925) [-552.922] (-556.494) (-554.470) * (-556.620) (-554.487) (-554.915) [-553.997] -- 0:00:49
167500 -- [-554.159] (-554.048) (-555.292) (-553.912) * (-556.476) [-558.212] (-555.492) (-558.743) -- 0:00:49
168000 -- (-557.421) (-557.516) [-552.626] (-555.530) * [-555.688] (-556.555) (-556.805) (-554.755) -- 0:00:49
168500 -- (-554.210) (-560.350) (-555.781) [-556.977] * (-553.949) [-553.797] (-554.007) (-554.210) -- 0:00:49
169000 -- (-553.240) (-554.700) [-554.520] (-555.522) * (-553.330) [-554.080] (-557.385) (-557.596) -- 0:00:49
169500 -- (-555.199) (-554.074) (-553.552) [-557.606] * (-555.663) [-554.080] (-554.795) (-554.031) -- 0:00:48
170000 -- (-558.484) (-554.342) [-554.512] (-552.734) * (-560.372) (-553.971) [-554.037] (-554.560) -- 0:00:48
Average standard deviation of split frequencies: 0.018172
170500 -- (-556.505) (-554.601) [-553.831] (-554.004) * (-553.744) (-554.095) (-556.696) [-556.657] -- 0:00:48
171000 -- (-554.661) (-555.270) (-555.412) [-557.277] * (-553.811) [-555.935] (-555.712) (-554.106) -- 0:00:48
171500 -- (-558.071) (-554.378) (-558.132) [-558.749] * (-555.637) (-555.868) (-555.944) [-553.805] -- 0:00:48
172000 -- [-553.895] (-558.544) (-555.149) (-555.823) * (-560.788) [-554.094] (-555.306) (-554.353) -- 0:00:48
172500 -- (-554.524) [-553.505] (-556.831) (-555.415) * [-554.685] (-555.231) (-555.571) (-554.944) -- 0:00:47
173000 -- [-557.900] (-553.233) (-553.103) (-553.019) * (-553.809) (-555.032) [-554.054] (-557.060) -- 0:00:47
173500 -- (-553.255) (-554.044) (-560.457) [-556.561] * (-554.068) (-556.296) [-553.587] (-555.124) -- 0:00:47
174000 -- (-554.795) (-554.811) [-557.704] (-557.675) * [-553.407] (-554.979) (-552.721) (-556.995) -- 0:00:47
174500 -- (-556.033) [-553.816] (-555.545) (-558.897) * (-555.970) (-553.547) (-558.421) [-553.424] -- 0:00:47
175000 -- (-554.740) (-554.142) (-553.466) [-557.127] * (-555.867) (-553.454) [-555.083] (-553.698) -- 0:00:47
Average standard deviation of split frequencies: 0.015922
175500 -- [-553.950] (-554.786) (-555.022) (-553.337) * (-556.111) (-554.767) (-555.086) [-555.198] -- 0:00:46
176000 -- (-558.523) (-560.844) (-553.190) [-555.895] * (-554.419) (-553.236) (-554.465) [-554.850] -- 0:00:46
176500 -- [-553.662] (-554.513) (-553.664) (-556.525) * (-559.040) [-553.975] (-553.591) (-555.240) -- 0:00:46
177000 -- [-553.787] (-559.126) (-553.420) (-557.648) * (-554.776) [-556.100] (-555.291) (-554.588) -- 0:00:51
177500 -- (-555.526) (-554.010) (-554.471) [-555.426] * [-554.708] (-555.329) (-556.453) (-553.185) -- 0:00:50
178000 -- (-558.431) (-557.691) (-553.578) [-559.192] * [-557.131] (-556.337) (-556.454) (-554.937) -- 0:00:50
178500 -- [-556.981] (-556.840) (-554.190) (-558.403) * [-553.430] (-557.566) (-558.404) (-558.715) -- 0:00:50
179000 -- (-556.058) (-557.182) [-553.720] (-564.830) * (-554.735) [-553.682] (-556.621) (-556.229) -- 0:00:50
179500 -- (-554.931) [-557.310] (-554.285) (-561.931) * (-555.803) [-554.112] (-553.473) (-554.960) -- 0:00:50
180000 -- (-555.764) [-554.102] (-561.347) (-558.562) * (-555.561) (-554.302) [-553.184] (-555.067) -- 0:00:50
Average standard deviation of split frequencies: 0.015656
180500 -- (-559.880) (-555.697) [-555.030] (-557.320) * [-555.341] (-554.990) (-554.007) (-556.296) -- 0:00:49
181000 -- [-553.859] (-554.996) (-555.181) (-555.104) * [-552.993] (-554.692) (-554.307) (-555.453) -- 0:00:49
181500 -- (-554.699) [-553.920] (-556.524) (-558.582) * (-553.976) (-556.204) [-554.518] (-554.566) -- 0:00:49
182000 -- (-554.130) [-554.485] (-556.443) (-556.834) * [-554.749] (-559.153) (-561.069) (-553.863) -- 0:00:49
182500 -- (-554.380) (-553.509) [-553.825] (-559.275) * (-555.289) (-559.352) (-553.628) [-554.437] -- 0:00:49
183000 -- [-557.349] (-553.465) (-555.518) (-553.841) * (-556.231) (-556.322) (-553.215) [-554.337] -- 0:00:49
183500 -- (-554.943) [-555.660] (-556.356) (-553.571) * [-555.511] (-553.454) (-555.687) (-553.519) -- 0:00:48
184000 -- (-553.974) (-556.654) [-554.609] (-559.124) * [-553.745] (-556.377) (-553.640) (-553.970) -- 0:00:48
184500 -- (-553.983) [-553.276] (-554.243) (-556.640) * [-553.780] (-554.995) (-553.270) (-558.308) -- 0:00:48
185000 -- (-556.076) [-552.823] (-554.677) (-556.511) * (-557.372) (-558.150) (-557.068) [-560.852] -- 0:00:48
Average standard deviation of split frequencies: 0.015874
185500 -- (-554.127) [-553.276] (-554.678) (-554.609) * [-554.410] (-555.522) (-558.449) (-557.563) -- 0:00:48
186000 -- [-554.645] (-554.039) (-556.226) (-556.257) * [-556.325] (-553.929) (-555.308) (-557.210) -- 0:00:48
186500 -- [-559.370] (-556.999) (-558.171) (-553.330) * (-555.934) (-560.731) (-557.560) [-554.098] -- 0:00:47
187000 -- (-558.496) (-556.745) (-555.836) [-553.217] * (-553.246) (-556.290) [-554.269] (-552.574) -- 0:00:47
187500 -- [-557.835] (-553.547) (-561.117) (-554.402) * [-554.631] (-558.374) (-555.779) (-554.067) -- 0:00:47
188000 -- (-555.998) [-554.370] (-554.126) (-553.954) * [-555.596] (-553.797) (-555.793) (-554.874) -- 0:00:47
188500 -- [-557.846] (-553.912) (-555.308) (-561.788) * (-556.763) [-554.198] (-555.458) (-553.715) -- 0:00:47
189000 -- (-555.321) (-556.261) (-555.154) [-556.689] * (-555.837) (-553.654) [-553.565] (-555.236) -- 0:00:47
189500 -- [-554.426] (-556.019) (-553.096) (-554.631) * (-555.338) (-554.204) (-554.320) [-554.541] -- 0:00:47
190000 -- [-553.974] (-552.918) (-554.604) (-556.061) * (-555.972) (-553.018) (-553.961) [-554.058] -- 0:00:46
Average standard deviation of split frequencies: 0.016318
190500 -- [-558.048] (-555.192) (-555.236) (-555.482) * (-556.375) (-554.832) [-555.375] (-555.636) -- 0:00:46
191000 -- [-557.317] (-553.000) (-555.273) (-553.530) * (-557.295) (-555.142) [-556.606] (-555.990) -- 0:00:46
191500 -- (-559.472) (-555.278) (-554.887) [-555.340] * (-556.230) (-554.898) [-555.591] (-554.531) -- 0:00:46
192000 -- (-561.514) (-553.582) (-554.022) [-553.466] * (-553.184) [-555.202] (-553.934) (-552.674) -- 0:00:46
192500 -- [-561.599] (-554.156) (-553.830) (-557.584) * (-555.881) (-555.642) [-555.308] (-553.290) -- 0:00:46
193000 -- (-558.736) (-553.898) [-554.371] (-554.430) * (-554.543) (-554.221) (-557.417) [-555.719] -- 0:00:45
193500 -- (-554.728) (-554.387) (-554.739) [-553.702] * (-553.908) (-552.768) [-554.471] (-557.453) -- 0:00:45
194000 -- (-554.070) (-555.666) [-554.450] (-553.489) * (-554.584) (-553.064) [-553.432] (-554.734) -- 0:00:45
194500 -- (-555.173) (-557.440) [-553.922] (-552.686) * (-553.448) [-553.885] (-556.488) (-554.375) -- 0:00:49
195000 -- [-554.919] (-555.585) (-554.252) (-555.851) * (-557.965) (-555.405) (-556.203) [-554.013] -- 0:00:49
Average standard deviation of split frequencies: 0.018481
195500 -- (-552.745) (-554.444) (-554.052) [-553.601] * [-554.902] (-554.274) (-556.434) (-552.998) -- 0:00:49
196000 -- (-556.995) (-558.681) [-552.834] (-552.648) * [-553.573] (-553.957) (-556.134) (-553.451) -- 0:00:49
196500 -- [-555.180] (-556.146) (-558.506) (-553.847) * (-556.946) [-555.365] (-555.899) (-554.909) -- 0:00:49
197000 -- (-553.457) (-555.456) [-555.893] (-555.422) * (-554.387) (-553.546) [-557.409] (-553.848) -- 0:00:48
197500 -- (-555.459) (-554.202) [-556.350] (-554.931) * (-561.111) (-554.010) [-556.921] (-553.145) -- 0:00:48
198000 -- [-555.285] (-552.897) (-558.162) (-556.172) * (-554.382) [-554.165] (-557.650) (-554.356) -- 0:00:48
198500 -- (-553.295) (-554.032) [-555.839] (-555.921) * (-557.481) (-555.466) (-554.308) [-555.546] -- 0:00:48
199000 -- (-552.680) [-552.700] (-558.831) (-556.125) * [-555.315] (-554.917) (-554.636) (-557.743) -- 0:00:48
199500 -- [-553.313] (-553.224) (-558.748) (-554.505) * (-556.524) [-553.893] (-556.093) (-555.524) -- 0:00:48
200000 -- (-557.381) [-556.513] (-561.511) (-554.909) * [-552.868] (-553.772) (-558.974) (-555.626) -- 0:00:48
Average standard deviation of split frequencies: 0.020648
200500 -- [-556.585] (-554.506) (-560.245) (-554.686) * (-553.848) (-554.597) [-554.279] (-556.382) -- 0:00:47
201000 -- (-555.133) (-553.537) [-553.670] (-554.211) * (-554.317) [-553.240] (-556.863) (-557.385) -- 0:00:47
201500 -- (-557.179) (-554.911) (-554.984) [-553.049] * (-554.373) [-554.886] (-554.176) (-557.996) -- 0:00:47
202000 -- (-556.162) [-552.724] (-555.680) (-553.962) * (-556.232) [-555.474] (-554.745) (-553.904) -- 0:00:47
202500 -- (-561.268) (-555.766) [-554.645] (-554.202) * [-556.152] (-554.466) (-555.694) (-556.482) -- 0:00:47
203000 -- (-558.105) (-554.956) [-553.724] (-554.858) * (-556.140) (-553.900) [-553.462] (-555.813) -- 0:00:47
203500 -- [-554.481] (-554.508) (-554.345) (-557.516) * (-553.003) (-553.753) (-554.996) [-553.721] -- 0:00:46
204000 -- (-556.046) (-557.385) [-557.555] (-558.497) * (-552.780) (-554.491) (-553.968) [-554.650] -- 0:00:46
204500 -- (-553.811) [-554.350] (-556.805) (-557.673) * (-553.231) (-554.993) [-554.315] (-559.002) -- 0:00:46
205000 -- (-555.137) (-554.852) (-554.672) [-553.680] * [-555.381] (-554.825) (-556.069) (-552.670) -- 0:00:46
Average standard deviation of split frequencies: 0.020595
205500 -- (-554.377) [-554.060] (-553.598) (-554.526) * (-560.150) (-555.806) [-554.458] (-557.047) -- 0:00:46
206000 -- (-562.607) (-557.339) (-557.024) [-555.587] * (-554.248) (-555.158) (-556.017) [-554.607] -- 0:00:46
206500 -- [-563.630] (-556.314) (-555.302) (-558.410) * (-554.920) [-557.488] (-556.760) (-555.050) -- 0:00:46
207000 -- (-556.997) [-554.688] (-553.493) (-557.819) * (-553.230) (-558.118) (-556.185) [-555.974] -- 0:00:45
207500 -- (-556.608) [-554.999] (-553.954) (-556.995) * (-554.844) [-554.594] (-553.332) (-555.630) -- 0:00:45
208000 -- [-554.649] (-556.187) (-556.488) (-556.008) * [-554.791] (-559.144) (-554.436) (-556.428) -- 0:00:45
208500 -- [-554.568] (-557.601) (-554.063) (-561.368) * (-554.765) [-554.518] (-555.366) (-555.891) -- 0:00:45
209000 -- (-557.998) (-555.610) [-555.214] (-560.181) * (-554.403) [-555.330] (-553.987) (-553.183) -- 0:00:45
209500 -- [-556.573] (-554.121) (-557.124) (-555.962) * (-554.429) [-555.114] (-560.113) (-556.994) -- 0:00:45
210000 -- (-555.102) (-554.705) [-554.748] (-557.874) * [-554.399] (-553.719) (-555.177) (-560.708) -- 0:00:45
Average standard deviation of split frequencies: 0.020251
210500 -- [-556.705] (-553.473) (-556.694) (-556.134) * (-556.734) (-554.957) (-552.794) [-554.005] -- 0:00:45
211000 -- (-555.131) (-556.373) (-556.346) [-554.839] * [-554.591] (-561.563) (-554.401) (-553.712) -- 0:00:44
211500 -- [-554.776] (-557.122) (-558.868) (-555.499) * [-554.643] (-556.114) (-553.332) (-553.867) -- 0:00:48
212000 -- (-554.045) (-555.611) [-554.345] (-553.989) * (-557.038) (-553.740) (-558.674) [-555.312] -- 0:00:48
212500 -- (-554.622) (-553.414) [-555.671] (-555.186) * (-558.445) (-554.049) [-555.052] (-555.193) -- 0:00:48
213000 -- (-553.817) (-553.505) (-554.966) [-552.676] * (-554.717) [-554.527] (-553.629) (-555.317) -- 0:00:48
213500 -- (-554.535) (-552.926) [-558.315] (-553.824) * [-554.400] (-557.314) (-554.175) (-554.378) -- 0:00:47
214000 -- (-554.067) (-554.286) [-555.424] (-553.594) * (-555.247) (-556.486) (-554.961) [-557.867] -- 0:00:47
214500 -- [-553.323] (-555.922) (-560.069) (-555.259) * (-558.453) [-556.913] (-554.153) (-556.810) -- 0:00:47
215000 -- (-554.082) (-555.193) (-559.425) [-553.492] * [-554.294] (-555.212) (-555.748) (-556.459) -- 0:00:47
Average standard deviation of split frequencies: 0.020297
215500 -- [-555.890] (-556.221) (-555.212) (-553.684) * (-554.483) (-554.246) (-555.738) [-554.259] -- 0:00:47
216000 -- [-554.571] (-556.348) (-555.146) (-554.546) * (-555.712) (-554.640) [-552.916] (-557.770) -- 0:00:47
216500 -- (-557.258) [-555.862] (-558.099) (-559.509) * (-555.084) (-555.255) (-554.720) [-555.577] -- 0:00:47
217000 -- [-553.674] (-558.886) (-557.554) (-558.077) * (-553.761) (-553.749) (-554.225) [-557.697] -- 0:00:46
217500 -- (-554.586) [-556.905] (-553.148) (-555.501) * [-555.726] (-552.935) (-555.140) (-554.748) -- 0:00:46
218000 -- (-556.345) (-554.030) [-555.840] (-556.323) * (-553.739) (-553.833) [-553.104] (-560.149) -- 0:00:46
218500 -- (-554.157) (-555.000) (-553.754) [-556.551] * (-555.031) (-554.356) [-553.914] (-557.554) -- 0:00:46
219000 -- (-552.810) (-556.217) (-554.593) [-553.799] * [-558.619] (-553.786) (-555.461) (-554.495) -- 0:00:46
219500 -- (-553.872) [-554.131] (-556.383) (-552.991) * (-554.502) (-555.387) [-555.377] (-553.935) -- 0:00:46
220000 -- (-555.044) (-553.154) [-553.217] (-557.382) * [-557.438] (-555.286) (-554.598) (-556.362) -- 0:00:46
Average standard deviation of split frequencies: 0.020238
220500 -- (-555.127) (-553.748) (-557.864) [-553.073] * (-554.153) (-554.494) (-553.732) [-557.016] -- 0:00:45
221000 -- (-554.591) (-553.610) (-556.789) [-554.322] * (-560.026) [-557.233] (-552.805) (-554.772) -- 0:00:45
221500 -- (-552.706) [-554.276] (-554.013) (-554.823) * (-554.041) (-558.659) [-552.915] (-557.097) -- 0:00:45
222000 -- (-553.106) (-556.751) [-552.892] (-555.474) * [-555.479] (-555.994) (-552.816) (-555.872) -- 0:00:45
222500 -- (-556.591) (-558.710) [-557.845] (-557.356) * (-558.335) (-554.749) (-553.442) [-553.128] -- 0:00:45
223000 -- (-553.855) [-556.639] (-554.683) (-557.726) * (-553.950) (-555.999) (-555.272) [-553.407] -- 0:00:45
223500 -- [-559.576] (-555.355) (-556.156) (-554.623) * (-555.110) (-553.725) [-555.833] (-554.073) -- 0:00:45
224000 -- (-559.824) (-555.649) (-557.176) [-554.438] * (-555.083) (-554.010) (-555.903) [-553.932] -- 0:00:45
224500 -- (-554.892) [-555.790] (-555.779) (-555.849) * (-555.593) [-554.940] (-553.862) (-553.443) -- 0:00:44
225000 -- (-559.740) (-554.521) (-556.139) [-553.133] * (-555.665) (-555.764) [-557.293] (-554.745) -- 0:00:44
Average standard deviation of split frequencies: 0.019607
225500 -- [-555.673] (-559.219) (-557.144) (-554.391) * (-556.052) (-555.226) [-556.696] (-552.831) -- 0:00:44
226000 -- (-556.664) (-556.264) (-553.621) [-558.834] * (-557.362) (-557.683) [-554.466] (-555.949) -- 0:00:44
226500 -- (-553.500) [-553.526] (-553.882) (-556.095) * (-556.206) [-559.946] (-555.253) (-553.311) -- 0:00:44
227000 -- (-556.047) (-556.129) (-553.768) [-553.733] * (-556.709) (-555.661) [-554.606] (-553.748) -- 0:00:44
227500 -- (-554.369) (-553.130) [-557.726] (-555.745) * (-552.650) [-555.836] (-555.127) (-556.651) -- 0:00:44
228000 -- [-553.716] (-553.477) (-555.552) (-556.130) * (-554.810) (-553.833) [-559.479] (-555.100) -- 0:00:44
228500 -- (-556.746) (-557.095) [-556.503] (-557.109) * (-554.581) [-557.470] (-553.613) (-552.896) -- 0:00:47
229000 -- (-557.912) (-554.542) [-553.485] (-557.846) * (-554.204) [-555.562] (-556.263) (-552.970) -- 0:00:47
229500 -- [-553.112] (-554.520) (-554.500) (-554.820) * [-553.236] (-554.490) (-556.170) (-554.294) -- 0:00:47
230000 -- (-554.726) (-555.271) (-555.853) [-553.776] * (-555.624) (-555.640) [-553.946] (-555.568) -- 0:00:46
Average standard deviation of split frequencies: 0.019108
230500 -- (-560.021) (-556.791) [-553.774] (-556.996) * [-553.762] (-558.043) (-556.395) (-554.831) -- 0:00:46
231000 -- (-556.795) (-553.050) [-555.618] (-556.405) * (-554.936) [-555.274] (-555.956) (-554.601) -- 0:00:46
231500 -- (-557.926) (-555.212) [-556.550] (-554.378) * [-554.461] (-555.547) (-554.235) (-555.387) -- 0:00:46
232000 -- (-554.068) (-553.567) [-556.772] (-554.166) * [-555.387] (-559.763) (-555.089) (-554.087) -- 0:00:46
232500 -- (-553.917) (-555.108) (-556.329) [-554.651] * (-558.853) [-553.823] (-557.982) (-554.429) -- 0:00:46
233000 -- (-553.078) (-555.768) (-556.986) [-554.159] * (-556.369) (-553.857) (-555.445) [-554.996] -- 0:00:46
233500 -- [-554.007] (-555.455) (-556.017) (-553.643) * (-553.379) [-558.447] (-555.070) (-554.061) -- 0:00:45
234000 -- (-559.411) [-554.861] (-558.522) (-555.408) * (-557.971) (-563.517) (-555.962) [-555.136] -- 0:00:45
234500 -- (-552.919) [-555.256] (-553.765) (-554.993) * (-554.089) (-555.423) (-554.375) [-556.955] -- 0:00:45
235000 -- [-554.198] (-554.393) (-556.396) (-554.253) * (-555.325) (-554.754) [-556.470] (-553.102) -- 0:00:45
Average standard deviation of split frequencies: 0.019975
235500 -- [-553.012] (-554.893) (-556.289) (-557.652) * (-562.937) [-558.139] (-558.130) (-553.437) -- 0:00:45
236000 -- (-555.281) (-558.474) [-554.012] (-555.906) * (-559.788) (-558.262) [-555.303] (-558.255) -- 0:00:45
236500 -- (-553.429) (-554.091) [-554.279] (-556.661) * [-556.203] (-555.345) (-553.725) (-555.363) -- 0:00:45
237000 -- (-555.769) [-555.227] (-554.578) (-553.444) * (-553.636) (-555.023) [-554.162] (-555.810) -- 0:00:45
237500 -- (-553.582) (-562.400) [-552.943] (-554.847) * (-553.708) [-554.763] (-566.499) (-555.005) -- 0:00:44
238000 -- (-557.258) [-554.127] (-553.981) (-555.752) * [-553.390] (-556.988) (-559.905) (-557.528) -- 0:00:44
238500 -- (-554.840) (-555.900) (-553.750) [-554.038] * (-554.918) (-554.520) [-556.118] (-557.573) -- 0:00:44
239000 -- (-561.901) [-555.667] (-553.969) (-555.590) * (-555.162) [-553.724] (-558.946) (-555.063) -- 0:00:44
239500 -- [-553.847] (-554.092) (-554.889) (-558.245) * (-554.581) (-558.439) [-555.114] (-557.934) -- 0:00:44
240000 -- (-556.100) (-555.169) (-558.064) [-556.121] * (-554.583) (-553.341) (-554.613) [-556.175] -- 0:00:44
Average standard deviation of split frequencies: 0.020721
240500 -- (-553.227) (-554.481) [-558.544] (-557.285) * (-554.857) (-555.781) [-557.308] (-563.719) -- 0:00:44
241000 -- (-553.542) (-555.193) (-555.146) [-555.775] * (-558.043) (-556.702) [-557.612] (-558.011) -- 0:00:44
241500 -- (-555.843) (-557.274) [-555.980] (-555.564) * (-555.015) (-554.474) (-556.414) [-554.065] -- 0:00:43
242000 -- (-553.490) (-554.533) [-554.599] (-554.266) * (-552.728) (-557.563) (-554.077) [-564.500] -- 0:00:43
242500 -- [-553.125] (-558.881) (-553.361) (-556.459) * (-553.379) [-554.653] (-554.307) (-556.030) -- 0:00:43
243000 -- (-562.084) [-553.335] (-555.615) (-557.987) * (-555.455) (-556.703) [-553.739] (-558.130) -- 0:00:43
243500 -- (-555.471) (-553.992) [-552.949] (-554.481) * [-554.586] (-558.922) (-555.243) (-552.826) -- 0:00:43
244000 -- (-554.199) (-554.314) (-555.414) [-553.785] * (-553.480) (-554.291) (-554.740) [-552.673] -- 0:00:43
244500 -- (-553.603) (-554.028) (-552.987) [-554.083] * (-558.994) [-553.687] (-555.616) (-553.589) -- 0:00:43
245000 -- (-557.721) [-554.942] (-553.053) (-555.616) * [-553.436] (-553.240) (-555.235) (-554.184) -- 0:00:43
Average standard deviation of split frequencies: 0.019929
245500 -- [-557.521] (-555.654) (-555.796) (-555.420) * (-553.899) (-554.074) [-554.732] (-553.691) -- 0:00:46
246000 -- (-557.858) (-555.855) [-557.472] (-554.391) * (-557.854) (-553.319) (-558.057) [-555.324] -- 0:00:45
246500 -- (-554.111) (-554.024) [-554.883] (-555.783) * (-555.712) (-553.609) [-555.155] (-554.667) -- 0:00:45
247000 -- [-556.530] (-559.520) (-556.462) (-558.415) * (-555.476) [-554.817] (-553.623) (-555.836) -- 0:00:45
247500 -- (-553.454) [-555.767] (-556.079) (-555.999) * (-554.698) [-553.293] (-554.006) (-558.035) -- 0:00:45
248000 -- [-554.257] (-554.894) (-555.927) (-554.647) * (-558.967) (-556.562) [-555.450] (-558.791) -- 0:00:45
248500 -- (-557.805) (-554.895) [-552.823] (-554.261) * (-553.941) (-554.890) [-553.676] (-557.295) -- 0:00:45
249000 -- (-557.533) (-553.273) [-558.130] (-555.636) * (-553.686) (-554.024) [-554.076] (-559.509) -- 0:00:45
249500 -- (-554.392) (-553.584) (-558.871) [-553.503] * (-553.621) [-553.445] (-558.992) (-553.791) -- 0:00:45
250000 -- (-553.427) [-556.790] (-553.477) (-553.138) * [-553.619] (-553.834) (-554.005) (-559.527) -- 0:00:45
Average standard deviation of split frequencies: 0.018608
250500 -- (-554.009) (-554.979) [-553.103] (-553.663) * (-554.812) (-554.677) (-557.026) [-554.286] -- 0:00:44
251000 -- (-554.175) (-559.155) (-554.547) [-554.900] * (-555.821) [-554.855] (-557.510) (-553.833) -- 0:00:44
251500 -- [-555.305] (-557.464) (-561.483) (-554.383) * (-555.359) (-553.859) (-554.053) [-558.473] -- 0:00:44
252000 -- (-554.701) (-560.822) (-556.312) [-553.203] * [-555.386] (-555.765) (-553.252) (-554.827) -- 0:00:44
252500 -- (-552.801) (-553.943) [-555.362] (-555.735) * (-555.418) [-555.585] (-553.498) (-554.832) -- 0:00:44
253000 -- (-557.066) [-554.009] (-559.436) (-561.343) * (-556.085) [-554.622] (-552.911) (-554.513) -- 0:00:44
253500 -- [-553.647] (-554.111) (-556.310) (-556.374) * (-553.834) (-554.835) (-554.941) [-556.072] -- 0:00:44
254000 -- (-555.490) (-552.953) (-554.543) [-553.608] * (-554.550) (-554.503) (-559.775) [-559.098] -- 0:00:44
254500 -- (-555.944) [-553.915] (-558.445) (-554.667) * (-554.062) [-555.212] (-556.112) (-556.342) -- 0:00:43
255000 -- (-559.237) (-559.971) [-553.759] (-553.597) * (-558.118) (-554.729) [-557.700] (-553.803) -- 0:00:43
Average standard deviation of split frequencies: 0.018926
255500 -- (-558.548) (-553.474) [-555.163] (-554.682) * (-557.484) [-553.740] (-557.920) (-558.149) -- 0:00:43
256000 -- (-553.390) [-553.741] (-554.631) (-554.423) * [-555.665] (-555.869) (-555.229) (-554.217) -- 0:00:43
256500 -- (-559.224) (-554.566) [-557.050] (-554.605) * [-556.786] (-552.771) (-556.260) (-554.575) -- 0:00:43
257000 -- [-557.233] (-554.293) (-558.253) (-555.576) * (-556.588) (-553.310) [-555.586] (-555.513) -- 0:00:43
257500 -- (-556.054) [-555.141] (-554.145) (-555.176) * (-556.684) (-552.835) [-553.324] (-557.073) -- 0:00:43
258000 -- (-555.609) (-554.186) [-553.415] (-555.507) * (-554.989) (-556.809) (-557.284) [-553.311] -- 0:00:43
258500 -- (-557.170) [-556.983] (-554.669) (-554.712) * (-553.536) [-554.800] (-556.215) (-553.339) -- 0:00:43
259000 -- (-560.610) (-557.327) (-555.639) [-556.833] * [-554.956] (-558.027) (-552.841) (-556.343) -- 0:00:42
259500 -- [-558.212] (-558.972) (-555.704) (-554.524) * [-555.570] (-555.847) (-553.488) (-561.692) -- 0:00:42
260000 -- (-562.324) (-560.894) [-556.247] (-554.814) * [-555.757] (-553.554) (-553.372) (-555.558) -- 0:00:42
Average standard deviation of split frequencies: 0.018687
260500 -- (-555.339) (-556.776) (-558.288) [-558.402] * (-554.848) [-555.346] (-552.689) (-557.136) -- 0:00:42
261000 -- (-553.316) (-555.069) [-557.766] (-559.234) * [-553.967] (-555.196) (-552.791) (-560.531) -- 0:00:42
261500 -- (-556.720) [-554.397] (-554.450) (-556.586) * (-554.470) [-555.163] (-555.811) (-553.935) -- 0:00:42
262000 -- (-554.249) (-553.724) (-553.422) [-557.062] * (-556.348) (-554.166) [-555.280] (-556.374) -- 0:00:42
262500 -- (-553.228) (-553.777) [-554.187] (-554.815) * [-554.294] (-554.568) (-557.342) (-555.772) -- 0:00:44
263000 -- [-553.977] (-555.489) (-556.696) (-554.719) * [-554.743] (-554.330) (-555.231) (-557.083) -- 0:00:44
263500 -- (-554.387) [-555.086] (-555.782) (-553.986) * (-555.742) [-553.925] (-557.998) (-555.547) -- 0:00:44
264000 -- (-553.823) (-555.815) [-553.457] (-555.247) * (-555.586) (-553.686) (-555.101) [-554.227] -- 0:00:44
264500 -- (-556.867) [-552.853] (-558.027) (-555.235) * [-553.731] (-554.154) (-558.243) (-556.927) -- 0:00:44
265000 -- (-556.079) [-555.932] (-555.424) (-554.640) * (-556.010) (-554.116) (-554.214) [-555.286] -- 0:00:44
Average standard deviation of split frequencies: 0.018375
265500 -- (-555.597) (-556.690) [-554.862] (-555.109) * [-553.397] (-553.198) (-558.636) (-557.389) -- 0:00:44
266000 -- [-553.245] (-555.021) (-554.029) (-555.081) * (-553.446) (-553.005) [-554.238] (-555.350) -- 0:00:44
266500 -- (-560.582) (-553.985) [-555.170] (-556.568) * [-555.152] (-552.746) (-555.593) (-554.269) -- 0:00:44
267000 -- (-554.176) [-553.729] (-553.708) (-555.008) * (-554.882) [-554.887] (-554.588) (-553.134) -- 0:00:43
267500 -- (-557.477) (-555.482) (-554.392) [-554.679] * (-553.903) [-556.498] (-553.691) (-554.109) -- 0:00:43
268000 -- (-557.164) [-553.995] (-557.707) (-553.519) * (-555.400) (-556.921) (-556.095) [-556.932] -- 0:00:43
268500 -- (-557.100) (-556.187) (-556.952) [-554.561] * (-553.643) (-556.067) [-554.549] (-555.944) -- 0:00:43
269000 -- (-555.449) (-554.020) (-554.689) [-556.076] * [-553.637] (-556.543) (-555.360) (-555.095) -- 0:00:43
269500 -- (-555.818) (-553.835) [-554.922] (-555.158) * (-553.925) (-553.393) (-554.499) [-556.528] -- 0:00:43
270000 -- (-553.048) (-555.048) (-554.493) [-556.583] * (-553.566) (-553.243) (-554.474) [-554.283] -- 0:00:43
Average standard deviation of split frequencies: 0.016739
270500 -- (-556.586) [-553.509] (-558.008) (-553.681) * (-554.894) (-554.680) [-554.946] (-554.822) -- 0:00:43
271000 -- (-553.071) (-558.396) (-555.783) [-555.833] * (-553.540) (-554.097) (-553.943) [-558.151] -- 0:00:43
271500 -- [-553.359] (-559.076) (-557.192) (-555.402) * [-553.542] (-556.127) (-553.831) (-557.132) -- 0:00:42
272000 -- (-555.910) (-554.213) (-555.169) [-554.661] * (-553.743) (-554.335) [-555.682] (-554.229) -- 0:00:42
272500 -- (-558.678) [-554.741] (-557.858) (-553.567) * (-554.858) [-559.567] (-554.073) (-555.933) -- 0:00:42
273000 -- (-554.379) [-555.888] (-555.805) (-555.450) * (-556.401) (-555.749) (-553.629) [-553.845] -- 0:00:42
273500 -- (-559.149) (-556.185) [-554.171] (-558.757) * (-555.929) (-556.816) (-554.071) [-554.454] -- 0:00:42
274000 -- [-553.761] (-553.670) (-554.084) (-558.882) * [-556.356] (-554.379) (-557.445) (-552.928) -- 0:00:42
274500 -- (-554.702) (-555.112) [-554.378] (-560.974) * [-556.816] (-554.375) (-558.208) (-554.396) -- 0:00:42
275000 -- (-554.685) (-556.228) [-553.640] (-554.876) * (-558.201) [-553.300] (-557.093) (-558.976) -- 0:00:42
Average standard deviation of split frequencies: 0.015874
275500 -- (-559.660) (-554.701) [-554.996] (-553.522) * (-555.349) [-557.293] (-554.213) (-560.553) -- 0:00:42
276000 -- [-553.382] (-553.661) (-554.750) (-555.954) * [-555.394] (-552.921) (-554.917) (-559.044) -- 0:00:41
276500 -- (-555.866) (-553.145) (-554.111) [-554.542] * (-557.318) (-553.438) (-561.619) [-556.708] -- 0:00:41
277000 -- (-554.903) [-556.705] (-553.633) (-554.909) * (-554.774) (-553.285) [-556.487] (-555.284) -- 0:00:41
277500 -- [-555.174] (-554.745) (-554.915) (-558.380) * [-554.630] (-554.220) (-555.235) (-554.578) -- 0:00:41
278000 -- [-554.332] (-555.086) (-556.813) (-555.425) * (-558.887) (-553.251) [-552.796] (-556.823) -- 0:00:41
278500 -- (-557.233) (-554.004) (-555.529) [-559.135] * (-560.915) [-554.856] (-555.970) (-554.465) -- 0:00:41
279000 -- [-553.347] (-554.499) (-555.169) (-555.579) * (-556.548) (-558.348) [-555.175] (-559.657) -- 0:00:41
279500 -- (-555.362) [-553.940] (-554.589) (-553.329) * (-554.798) (-555.818) [-555.571] (-559.095) -- 0:00:43
280000 -- (-554.715) (-553.736) (-558.051) [-555.214] * [-555.758] (-553.633) (-553.139) (-555.928) -- 0:00:43
Average standard deviation of split frequencies: 0.015396
280500 -- (-553.458) (-553.057) [-553.584] (-560.980) * (-554.468) (-553.585) (-552.912) [-560.479] -- 0:00:43
281000 -- (-555.182) (-558.577) (-553.737) [-556.562] * (-553.245) [-554.187] (-556.141) (-558.425) -- 0:00:43
281500 -- (-555.468) [-553.920] (-554.874) (-554.544) * (-554.978) (-555.133) (-556.372) [-556.337] -- 0:00:43
282000 -- (-557.959) (-556.497) [-556.251] (-553.277) * (-554.855) (-554.090) [-555.918] (-555.580) -- 0:00:43
282500 -- (-558.263) [-557.610] (-555.484) (-554.418) * (-555.666) (-553.944) [-555.021] (-557.228) -- 0:00:43
283000 -- (-555.475) [-553.242] (-556.882) (-556.229) * [-554.010] (-555.128) (-555.038) (-560.304) -- 0:00:43
283500 -- [-555.404] (-554.792) (-554.813) (-554.166) * (-553.657) (-555.460) [-553.529] (-555.955) -- 0:00:42
284000 -- (-559.348) (-555.396) (-556.497) [-553.221] * [-554.809] (-556.673) (-554.349) (-557.349) -- 0:00:42
284500 -- (-557.420) [-556.048] (-553.180) (-555.833) * (-555.558) (-556.198) [-554.167] (-553.529) -- 0:00:42
285000 -- (-560.374) [-561.670] (-553.941) (-553.781) * (-556.653) (-557.120) [-553.758] (-561.401) -- 0:00:42
Average standard deviation of split frequencies: 0.014285
285500 -- [-555.519] (-561.777) (-553.535) (-554.587) * (-555.481) (-555.489) [-555.068] (-553.391) -- 0:00:42
286000 -- (-558.978) (-555.152) [-556.667] (-556.069) * (-553.633) [-554.843] (-554.048) (-555.850) -- 0:00:42
286500 -- (-553.044) [-556.409] (-555.450) (-557.906) * (-556.589) (-553.416) (-554.857) [-556.151] -- 0:00:42
287000 -- (-554.156) [-556.786] (-554.765) (-556.781) * [-555.115] (-553.297) (-556.081) (-556.264) -- 0:00:42
287500 -- (-554.086) (-555.012) [-555.303] (-553.849) * (-556.369) (-554.619) (-556.089) [-554.770] -- 0:00:42
288000 -- (-556.182) [-554.045] (-552.671) (-553.026) * (-554.552) (-554.291) [-555.137] (-555.191) -- 0:00:42
288500 -- (-557.782) (-557.646) (-553.552) [-553.349] * [-553.386] (-552.906) (-555.215) (-555.479) -- 0:00:41
289000 -- (-557.718) (-553.646) (-552.938) [-554.056] * [-555.848] (-552.910) (-553.703) (-553.573) -- 0:00:41
289500 -- (-561.778) (-553.662) [-556.016] (-555.787) * (-555.499) (-553.057) (-553.484) [-555.087] -- 0:00:41
290000 -- (-554.492) (-558.333) [-554.195] (-555.461) * [-554.120] (-555.469) (-554.778) (-554.656) -- 0:00:41
Average standard deviation of split frequencies: 0.015741
290500 -- [-555.449] (-554.880) (-556.473) (-554.244) * [-556.227] (-558.828) (-553.174) (-554.508) -- 0:00:41
291000 -- [-553.830] (-557.723) (-557.507) (-557.476) * [-561.445] (-557.148) (-554.632) (-556.121) -- 0:00:41
291500 -- (-552.941) (-555.038) [-556.079] (-554.395) * [-557.015] (-556.826) (-553.684) (-556.464) -- 0:00:41
292000 -- (-555.264) (-553.897) (-554.241) [-556.175] * (-554.099) (-555.846) (-555.076) [-555.309] -- 0:00:41
292500 -- (-555.312) (-554.872) [-553.281] (-552.856) * (-554.220) (-553.129) (-555.391) [-555.080] -- 0:00:41
293000 -- (-561.852) (-556.591) [-554.037] (-557.008) * [-556.599] (-555.397) (-556.146) (-553.950) -- 0:00:41
293500 -- (-556.059) [-553.093] (-557.362) (-553.873) * (-555.191) [-556.553] (-554.167) (-555.827) -- 0:00:40
294000 -- (-557.627) [-553.632] (-556.299) (-553.462) * (-553.413) (-553.812) (-555.297) [-554.777] -- 0:00:40
294500 -- (-557.261) [-553.904] (-554.683) (-556.970) * (-555.758) (-555.745) [-557.117] (-555.548) -- 0:00:40
295000 -- [-559.246] (-553.518) (-555.201) (-559.267) * (-559.835) (-558.663) (-553.762) [-555.939] -- 0:00:40
Average standard deviation of split frequencies: 0.015645
295500 -- (-561.991) (-552.617) [-557.579] (-555.410) * (-558.274) [-557.619] (-553.440) (-555.005) -- 0:00:40
296000 -- (-555.273) (-561.347) (-556.671) [-553.492] * (-556.691) (-560.265) [-553.334] (-554.995) -- 0:00:42
296500 -- (-554.757) (-554.663) (-556.890) [-554.406] * (-556.055) (-557.454) [-553.298] (-555.532) -- 0:00:42
297000 -- (-554.081) [-555.748] (-553.916) (-552.882) * (-558.445) (-553.299) (-555.322) [-554.531] -- 0:00:42
297500 -- (-558.455) (-553.828) (-554.219) [-553.418] * (-558.630) (-552.832) [-555.909] (-556.284) -- 0:00:42
298000 -- (-556.475) (-561.592) [-557.147] (-556.103) * (-554.109) [-553.129] (-562.870) (-557.013) -- 0:00:42
298500 -- (-552.791) [-558.464] (-558.038) (-555.118) * (-554.390) (-553.701) [-557.426] (-553.017) -- 0:00:42
299000 -- (-553.940) (-553.555) (-553.201) [-555.135] * (-556.160) (-555.486) (-555.661) [-554.014] -- 0:00:42
299500 -- (-556.293) (-554.970) (-553.980) [-554.827] * (-558.482) [-556.049] (-557.158) (-553.846) -- 0:00:42
300000 -- (-557.077) [-555.281] (-554.138) (-555.333) * (-558.500) (-554.533) [-554.126] (-554.319) -- 0:00:42
Average standard deviation of split frequencies: 0.016785
300500 -- (-563.780) [-554.838] (-553.014) (-560.422) * (-556.077) [-556.092] (-556.116) (-553.917) -- 0:00:41
301000 -- (-561.008) (-557.791) [-554.719] (-553.828) * (-556.414) (-553.811) [-557.709] (-553.458) -- 0:00:41
301500 -- (-558.468) (-554.658) [-555.850] (-554.428) * [-554.524] (-555.477) (-554.621) (-555.518) -- 0:00:41
302000 -- (-558.540) (-554.237) [-554.814] (-554.220) * (-553.168) [-554.322] (-554.330) (-554.083) -- 0:00:41
302500 -- (-556.884) (-557.821) (-558.469) [-554.294] * [-555.503] (-556.226) (-556.746) (-554.495) -- 0:00:41
303000 -- (-555.815) (-554.439) (-556.522) [-553.244] * (-559.493) (-554.963) [-553.805] (-554.178) -- 0:00:41
303500 -- (-553.358) [-553.859] (-556.832) (-554.119) * [-554.573] (-555.304) (-555.854) (-555.520) -- 0:00:41
304000 -- [-554.529] (-555.827) (-554.802) (-554.300) * [-557.671] (-554.351) (-554.625) (-556.052) -- 0:00:41
304500 -- (-555.188) (-556.861) (-556.762) [-554.468] * [-555.127] (-556.738) (-555.291) (-557.970) -- 0:00:41
305000 -- [-553.424] (-553.755) (-554.845) (-561.932) * (-553.979) [-556.271] (-559.607) (-555.252) -- 0:00:41
Average standard deviation of split frequencies: 0.016312
305500 -- (-557.030) (-555.337) (-555.054) [-558.387] * (-555.630) (-556.014) [-557.885] (-555.683) -- 0:00:40
306000 -- (-555.462) (-555.144) (-554.861) [-553.650] * (-558.604) [-555.204] (-553.466) (-554.548) -- 0:00:40
306500 -- (-560.210) [-553.620] (-554.950) (-554.521) * [-556.181] (-553.544) (-554.228) (-554.894) -- 0:00:40
307000 -- (-556.641) (-554.562) (-557.262) [-555.799] * (-558.810) (-554.019) (-555.596) [-557.940] -- 0:00:40
307500 -- [-555.060] (-553.079) (-556.194) (-555.859) * (-553.243) (-553.264) [-555.632] (-552.963) -- 0:00:40
308000 -- (-554.730) (-554.364) [-553.064] (-553.953) * [-555.438] (-555.082) (-558.201) (-556.147) -- 0:00:40
308500 -- (-554.395) (-554.502) [-553.831] (-553.700) * (-556.710) [-556.222] (-556.295) (-556.732) -- 0:00:40
309000 -- (-557.325) [-554.442] (-553.342) (-555.374) * [-554.750] (-553.482) (-558.122) (-554.835) -- 0:00:40
309500 -- [-556.373] (-554.551) (-552.807) (-552.791) * (-556.191) (-554.706) (-554.313) [-554.778] -- 0:00:40
310000 -- (-558.513) (-555.066) [-553.026] (-554.131) * [-553.150] (-556.880) (-556.625) (-552.960) -- 0:00:40
Average standard deviation of split frequencies: 0.015620
310500 -- (-556.018) (-560.442) [-552.896] (-553.375) * (-555.443) (-559.480) [-553.638] (-554.674) -- 0:00:39
311000 -- (-557.057) [-555.345] (-553.924) (-554.322) * (-553.299) (-555.592) [-557.579] (-555.381) -- 0:00:39
311500 -- [-554.041] (-554.330) (-560.050) (-556.104) * (-554.069) (-555.502) (-557.659) [-554.767] -- 0:00:39
312000 -- [-554.260] (-555.155) (-555.479) (-556.887) * [-556.665] (-553.039) (-553.308) (-554.617) -- 0:00:39
312500 -- (-558.303) (-554.041) [-554.431] (-554.235) * (-554.548) [-557.062] (-553.990) (-558.997) -- 0:00:39
313000 -- (-556.410) (-557.393) (-553.302) [-553.922] * (-554.061) [-554.487] (-554.600) (-557.103) -- 0:00:41
313500 -- (-558.415) (-553.885) (-554.246) [-554.364] * (-557.000) (-556.193) [-556.649] (-553.822) -- 0:00:41
314000 -- (-557.078) (-554.842) (-554.063) [-553.961] * (-553.275) (-554.715) [-553.874] (-553.925) -- 0:00:41
314500 -- [-556.586] (-556.380) (-553.447) (-555.143) * (-554.401) [-554.953] (-557.329) (-554.571) -- 0:00:41
315000 -- (-552.894) (-555.793) (-554.739) [-555.117] * (-554.168) [-554.513] (-554.555) (-554.626) -- 0:00:41
Average standard deviation of split frequencies: 0.015757
315500 -- (-554.649) [-557.136] (-556.573) (-558.311) * (-554.875) (-554.098) [-553.901] (-555.348) -- 0:00:41
316000 -- [-554.326] (-555.847) (-554.662) (-558.706) * (-554.799) [-554.102] (-555.299) (-560.242) -- 0:00:41
316500 -- [-553.104] (-555.817) (-556.475) (-553.846) * (-556.206) (-553.940) [-557.095] (-556.475) -- 0:00:41
317000 -- [-556.788] (-554.232) (-555.266) (-558.335) * (-554.799) [-557.148] (-554.769) (-556.744) -- 0:00:40
317500 -- [-556.174] (-559.649) (-555.167) (-557.135) * (-556.123) (-553.241) [-553.839] (-555.372) -- 0:00:40
318000 -- (-554.501) [-554.151] (-554.189) (-555.650) * (-554.885) (-554.929) (-553.573) [-553.619] -- 0:00:40
318500 -- (-553.473) (-556.515) (-559.205) [-553.255] * (-559.032) (-556.344) [-554.391] (-553.606) -- 0:00:40
319000 -- (-553.421) (-558.205) [-558.193] (-555.701) * (-557.634) (-554.321) [-554.693] (-559.021) -- 0:00:40
319500 -- (-557.715) (-553.767) (-555.269) [-553.691] * (-556.067) (-553.995) [-553.705] (-555.857) -- 0:00:40
320000 -- [-554.967] (-554.827) (-556.728) (-555.211) * [-556.108] (-553.311) (-555.189) (-555.509) -- 0:00:40
Average standard deviation of split frequencies: 0.016690
320500 -- [-553.608] (-554.569) (-556.347) (-556.395) * [-553.604] (-553.341) (-562.333) (-554.626) -- 0:00:40
321000 -- (-556.851) [-557.445] (-553.396) (-556.473) * (-553.963) (-554.462) [-562.405] (-555.576) -- 0:00:40
321500 -- (-556.242) (-556.322) (-554.292) [-557.824] * [-555.625] (-556.554) (-556.238) (-553.229) -- 0:00:40
322000 -- (-553.301) (-555.374) [-556.760] (-559.933) * (-562.442) (-555.288) [-554.133] (-552.896) -- 0:00:40
322500 -- (-553.775) (-554.952) (-555.331) [-555.081] * (-556.924) (-556.805) [-558.496] (-562.258) -- 0:00:39
323000 -- (-552.779) (-557.680) [-567.349] (-557.670) * [-553.050] (-557.233) (-556.228) (-555.578) -- 0:00:39
323500 -- (-553.343) [-552.888] (-556.052) (-556.601) * (-553.839) (-553.708) [-556.583] (-554.799) -- 0:00:39
324000 -- [-554.867] (-557.136) (-557.880) (-554.828) * (-556.101) (-554.118) (-554.892) [-557.547] -- 0:00:39
324500 -- [-554.845] (-557.151) (-555.608) (-559.941) * (-553.853) (-554.617) (-554.270) [-555.841] -- 0:00:39
325000 -- (-556.674) (-556.973) (-554.594) [-561.990] * (-557.889) [-553.772] (-556.211) (-556.385) -- 0:00:39
Average standard deviation of split frequencies: 0.015145
325500 -- (-553.751) (-553.966) (-554.462) [-559.635] * (-554.098) (-553.924) [-554.180] (-559.228) -- 0:00:39
326000 -- (-556.233) (-555.813) [-557.752] (-562.545) * (-554.190) (-557.606) [-555.372] (-554.688) -- 0:00:39
326500 -- (-553.817) [-556.001] (-554.352) (-553.547) * (-553.494) [-559.412] (-553.595) (-556.512) -- 0:00:39
327000 -- (-554.422) (-554.714) [-555.692] (-554.570) * (-553.758) [-555.112] (-554.005) (-554.449) -- 0:00:39
327500 -- [-555.585] (-555.719) (-556.095) (-555.189) * (-553.839) (-553.699) [-554.637] (-554.401) -- 0:00:39
328000 -- (-553.883) (-556.410) [-553.582] (-554.068) * (-554.781) [-555.262] (-555.019) (-554.595) -- 0:00:38
328500 -- (-558.344) (-557.145) (-553.943) [-552.713] * (-554.781) (-555.371) [-555.067] (-556.301) -- 0:00:38
329000 -- [-555.224] (-556.348) (-554.952) (-554.422) * (-555.092) (-555.003) (-553.585) [-554.320] -- 0:00:38
329500 -- (-556.329) (-554.327) (-554.854) [-553.178] * (-558.520) (-555.001) [-555.117] (-556.982) -- 0:00:38
330000 -- (-555.723) (-554.531) [-553.558] (-554.820) * (-556.256) (-552.882) [-553.783] (-552.746) -- 0:00:38
Average standard deviation of split frequencies: 0.015682
330500 -- (-554.701) (-555.867) [-557.307] (-553.885) * (-556.719) (-554.373) (-558.181) [-553.877] -- 0:00:40
331000 -- (-553.696) [-554.124] (-554.280) (-554.593) * (-557.295) [-557.780] (-554.465) (-553.982) -- 0:00:40
331500 -- (-559.804) (-553.591) (-554.390) [-556.252] * (-554.410) (-555.223) (-554.757) [-554.022] -- 0:00:40
332000 -- (-555.895) [-555.262] (-554.991) (-555.127) * (-555.869) [-555.784] (-553.310) (-557.628) -- 0:00:40
332500 -- (-555.728) (-554.938) [-552.933] (-557.117) * (-553.401) [-554.098] (-555.305) (-554.421) -- 0:00:40
333000 -- (-555.636) (-555.017) (-552.873) [-555.443] * (-561.337) (-554.266) [-553.282] (-554.885) -- 0:00:40
333500 -- (-553.755) (-554.027) [-552.826] (-553.630) * (-559.834) (-557.932) (-553.208) [-553.536] -- 0:00:39
334000 -- (-560.168) (-556.716) (-553.962) [-554.850] * (-559.246) (-557.086) (-560.398) [-553.054] -- 0:00:39
334500 -- [-557.363] (-554.140) (-555.954) (-557.439) * (-554.975) [-557.651] (-556.410) (-562.416) -- 0:00:39
335000 -- (-556.153) (-554.267) [-556.104] (-559.311) * (-555.085) [-553.891] (-554.139) (-555.660) -- 0:00:39
Average standard deviation of split frequencies: 0.015680
335500 -- (-554.920) [-554.430] (-557.750) (-557.629) * (-556.413) (-558.457) (-556.347) [-554.629] -- 0:00:39
336000 -- (-558.447) (-553.591) (-559.874) [-555.374] * (-553.855) (-554.931) [-554.175] (-553.764) -- 0:00:39
336500 -- [-552.917] (-553.943) (-555.932) (-555.355) * (-557.699) (-555.523) [-553.237] (-554.896) -- 0:00:39
337000 -- (-555.833) (-556.076) (-552.875) [-554.005] * [-553.598] (-553.755) (-554.161) (-555.694) -- 0:00:39
337500 -- [-556.201] (-557.494) (-553.936) (-554.594) * (-554.931) [-552.921] (-558.207) (-554.228) -- 0:00:39
338000 -- [-554.214] (-558.427) (-554.488) (-554.320) * (-555.594) (-552.942) (-553.286) [-553.839] -- 0:00:39
338500 -- (-556.487) (-556.390) [-556.803] (-553.260) * (-556.837) (-554.423) [-556.082] (-554.956) -- 0:00:39
339000 -- (-553.660) (-554.669) (-556.235) [-554.455] * [-554.282] (-553.181) (-556.936) (-556.128) -- 0:00:38
339500 -- (-553.716) (-553.493) (-556.481) [-554.232] * [-557.379] (-555.991) (-555.059) (-553.550) -- 0:00:38
340000 -- (-555.026) [-555.275] (-554.800) (-557.830) * (-555.404) [-555.080] (-553.043) (-553.486) -- 0:00:38
Average standard deviation of split frequencies: 0.015384
340500 -- (-554.413) [-556.656] (-553.402) (-556.372) * (-557.056) [-555.295] (-556.125) (-564.138) -- 0:00:38
341000 -- (-557.112) (-557.162) [-555.035] (-555.671) * [-554.164] (-555.638) (-555.669) (-555.627) -- 0:00:38
341500 -- (-557.552) (-555.722) (-553.859) [-556.323] * (-556.901) (-553.913) (-554.720) [-558.607] -- 0:00:38
342000 -- (-553.655) (-555.881) (-558.308) [-555.076] * (-556.708) (-556.706) (-554.779) [-554.668] -- 0:00:38
342500 -- (-554.715) (-554.294) [-558.397] (-558.712) * (-555.366) [-556.703] (-554.818) (-559.987) -- 0:00:38
343000 -- (-556.028) (-554.466) [-553.327] (-554.998) * (-553.173) [-556.632] (-554.170) (-556.113) -- 0:00:38
343500 -- (-555.148) (-555.814) [-554.491] (-556.280) * [-553.015] (-554.871) (-556.599) (-553.737) -- 0:00:38
344000 -- [-555.667] (-559.333) (-555.839) (-553.780) * (-558.237) (-553.828) [-554.228] (-555.343) -- 0:00:38
344500 -- (-557.414) (-553.944) [-553.171] (-555.529) * [-562.501] (-554.131) (-554.811) (-556.469) -- 0:00:38
345000 -- (-557.097) (-555.502) (-554.030) [-553.124] * (-554.672) (-555.465) [-554.245] (-557.779) -- 0:00:37
Average standard deviation of split frequencies: 0.015468
345500 -- [-555.322] (-553.659) (-553.869) (-554.489) * (-555.234) (-557.657) (-554.642) [-554.269] -- 0:00:37
346000 -- (-554.950) (-554.174) (-561.236) [-553.959] * (-559.880) (-554.752) [-556.666] (-553.378) -- 0:00:37
346500 -- (-556.184) (-553.473) [-556.058] (-556.904) * (-555.982) [-552.911] (-556.439) (-554.396) -- 0:00:37
347000 -- (-553.386) (-552.926) (-553.467) [-554.488] * (-554.821) (-552.832) [-555.004] (-556.136) -- 0:00:39
347500 -- (-558.608) (-554.929) (-554.024) [-556.211] * (-554.427) (-554.390) (-554.130) [-555.015] -- 0:00:39
348000 -- (-554.337) (-553.088) (-556.673) [-553.147] * [-554.488] (-554.682) (-557.316) (-552.822) -- 0:00:39
348500 -- (-556.975) (-554.781) [-553.504] (-554.230) * [-556.206] (-557.598) (-558.624) (-553.726) -- 0:00:39
349000 -- (-555.627) [-553.750] (-554.835) (-554.485) * [-555.339] (-555.688) (-559.024) (-557.791) -- 0:00:39
349500 -- (-557.998) (-556.231) [-554.370] (-552.995) * (-553.483) (-556.484) (-554.289) [-554.618] -- 0:00:39
350000 -- [-555.059] (-560.266) (-560.527) (-554.637) * (-556.878) (-554.758) (-553.976) [-556.908] -- 0:00:39
Average standard deviation of split frequencies: 0.015104
350500 -- (-554.178) (-557.021) [-553.982] (-554.968) * (-556.981) [-554.671] (-554.265) (-558.535) -- 0:00:38
351000 -- [-556.911] (-558.119) (-553.247) (-555.495) * (-554.765) (-555.353) (-553.970) [-557.148] -- 0:00:38
351500 -- (-553.881) (-558.487) [-553.689] (-554.719) * (-553.589) (-555.916) [-557.695] (-554.182) -- 0:00:38
352000 -- (-553.908) [-555.740] (-555.286) (-553.191) * (-553.350) (-555.108) [-554.705] (-555.742) -- 0:00:38
352500 -- (-552.651) [-552.712] (-554.182) (-553.952) * [-554.453] (-554.087) (-554.580) (-555.468) -- 0:00:38
353000 -- (-555.596) [-554.304] (-553.909) (-554.879) * (-555.760) [-556.136] (-553.929) (-556.809) -- 0:00:38
353500 -- (-555.086) (-560.013) (-553.868) [-555.464] * [-555.820] (-554.620) (-554.353) (-556.628) -- 0:00:38
354000 -- (-557.124) [-554.242] (-553.734) (-553.455) * [-558.136] (-555.842) (-553.153) (-558.778) -- 0:00:38
354500 -- (-555.039) (-556.160) [-556.282] (-554.844) * (-554.444) (-555.227) [-553.792] (-557.136) -- 0:00:38
355000 -- [-555.330] (-554.654) (-556.681) (-555.193) * [-555.586] (-554.986) (-556.981) (-553.573) -- 0:00:38
Average standard deviation of split frequencies: 0.013943
355500 -- [-553.996] (-554.140) (-555.738) (-553.926) * (-556.893) (-555.269) [-555.199] (-553.926) -- 0:00:38
356000 -- (-556.439) [-556.908] (-554.992) (-558.382) * (-559.785) (-554.908) [-553.852] (-555.517) -- 0:00:37
356500 -- (-557.031) [-554.557] (-557.332) (-553.259) * (-558.956) [-561.519] (-554.586) (-554.566) -- 0:00:37
357000 -- (-556.826) (-554.076) [-553.508] (-556.158) * (-561.819) (-554.388) (-554.249) [-555.969] -- 0:00:37
357500 -- (-553.845) [-553.909] (-557.316) (-552.831) * (-553.925) [-553.423] (-555.327) (-555.178) -- 0:00:37
358000 -- (-555.534) (-556.245) (-558.493) [-553.710] * [-558.057] (-556.972) (-560.033) (-555.433) -- 0:00:37
358500 -- (-556.412) (-553.894) (-557.105) [-554.415] * [-556.777] (-555.371) (-555.537) (-559.449) -- 0:00:37
359000 -- [-554.462] (-555.414) (-554.306) (-553.909) * [-553.903] (-558.025) (-554.054) (-556.505) -- 0:00:37
359500 -- (-556.871) (-554.956) [-555.798] (-555.729) * [-556.996] (-565.728) (-557.123) (-555.081) -- 0:00:37
360000 -- [-553.819] (-555.084) (-556.384) (-557.643) * (-554.742) (-562.330) (-554.349) [-556.441] -- 0:00:37
Average standard deviation of split frequencies: 0.014704
360500 -- (-553.535) [-555.638] (-553.933) (-554.182) * (-554.728) (-554.331) [-555.787] (-557.566) -- 0:00:37
361000 -- (-554.451) (-555.825) (-553.153) [-554.718] * (-554.193) (-554.135) (-556.030) [-557.731] -- 0:00:37
361500 -- (-554.321) (-556.978) (-553.489) [-554.864] * (-554.749) (-553.787) (-553.400) [-554.798] -- 0:00:37
362000 -- (-556.473) (-559.008) [-555.262] (-554.974) * (-554.107) [-554.841] (-552.669) (-559.639) -- 0:00:37
362500 -- (-559.806) (-557.307) (-555.235) [-556.168] * [-553.659] (-557.292) (-557.919) (-554.444) -- 0:00:36
363000 -- (-555.680) (-556.497) (-555.635) [-553.704] * (-556.489) (-555.913) [-553.871] (-553.633) -- 0:00:36
363500 -- (-555.969) [-554.292] (-554.786) (-556.965) * (-555.956) (-552.998) (-557.229) [-554.171] -- 0:00:36
364000 -- (-557.249) (-553.455) [-554.262] (-552.832) * (-555.722) (-555.507) [-554.031] (-554.830) -- 0:00:38
364500 -- (-555.495) (-556.228) [-553.866] (-554.514) * (-561.983) [-553.734] (-554.745) (-553.582) -- 0:00:38
365000 -- (-553.228) (-556.910) [-555.060] (-557.366) * (-556.178) (-554.927) (-556.119) [-555.250] -- 0:00:38
Average standard deviation of split frequencies: 0.014892
365500 -- (-556.356) (-554.857) [-556.078] (-554.163) * (-558.309) [-555.161] (-556.948) (-554.653) -- 0:00:38
366000 -- (-553.098) [-555.927] (-556.175) (-555.261) * [-554.105] (-553.216) (-558.667) (-553.371) -- 0:00:38
366500 -- (-554.862) [-553.321] (-556.480) (-558.542) * (-553.759) (-553.086) (-555.944) [-555.063] -- 0:00:38
367000 -- (-554.098) (-555.582) [-557.900] (-554.493) * [-561.111] (-557.682) (-554.678) (-562.325) -- 0:00:37
367500 -- (-555.024) (-553.953) (-553.541) [-556.717] * [-554.302] (-555.739) (-557.598) (-554.190) -- 0:00:37
368000 -- (-554.321) [-554.180] (-557.413) (-553.485) * (-555.567) [-555.349] (-553.495) (-555.351) -- 0:00:37
368500 -- [-554.017] (-554.320) (-556.908) (-554.475) * [-555.736] (-557.414) (-553.711) (-555.713) -- 0:00:37
369000 -- [-556.890] (-556.271) (-555.108) (-553.827) * (-553.948) (-555.616) [-553.143] (-554.758) -- 0:00:37
369500 -- (-557.494) (-554.814) [-553.664] (-553.365) * (-554.340) (-555.439) [-554.689] (-557.640) -- 0:00:37
370000 -- [-556.842] (-555.160) (-555.677) (-554.060) * [-557.786] (-555.620) (-557.359) (-554.348) -- 0:00:37
Average standard deviation of split frequencies: 0.014513
370500 -- (-553.303) (-555.690) [-556.321] (-553.751) * (-554.009) [-554.168] (-556.034) (-555.240) -- 0:00:37
371000 -- (-553.094) [-554.069] (-560.042) (-555.376) * [-553.551] (-556.093) (-553.744) (-554.254) -- 0:00:37
371500 -- (-554.952) [-558.812] (-556.562) (-553.275) * [-554.222] (-554.387) (-555.016) (-555.145) -- 0:00:37
372000 -- [-555.136] (-555.298) (-555.296) (-554.872) * [-553.729] (-556.076) (-557.946) (-555.286) -- 0:00:37
372500 -- (-553.970) [-556.351] (-557.477) (-557.548) * [-552.786] (-554.431) (-553.791) (-556.679) -- 0:00:37
373000 -- (-553.260) [-554.189] (-553.801) (-555.252) * [-554.886] (-553.623) (-557.914) (-554.463) -- 0:00:36
373500 -- [-553.513] (-553.977) (-554.468) (-556.146) * (-554.139) (-556.289) [-555.080] (-554.321) -- 0:00:36
374000 -- (-557.182) (-555.949) (-555.930) [-556.444] * (-554.862) [-553.192] (-555.462) (-554.856) -- 0:00:36
374500 -- (-556.335) (-553.345) [-553.334] (-556.621) * (-556.298) (-554.206) [-554.942] (-557.109) -- 0:00:36
375000 -- (-558.083) (-554.237) (-557.440) [-555.461] * (-554.877) (-560.397) (-554.122) [-554.592] -- 0:00:36
Average standard deviation of split frequencies: 0.015561
375500 -- (-556.091) (-554.462) [-555.769] (-553.016) * [-559.826] (-556.074) (-558.734) (-554.954) -- 0:00:36
376000 -- (-555.450) (-556.057) (-558.511) [-553.400] * (-557.833) (-558.424) [-561.366] (-554.326) -- 0:00:36
376500 -- [-554.978] (-555.805) (-560.336) (-553.884) * (-555.346) (-558.158) [-560.038] (-553.847) -- 0:00:36
377000 -- (-554.025) (-553.560) (-557.576) [-553.957] * (-553.455) (-560.625) [-553.220] (-554.301) -- 0:00:36
377500 -- (-554.502) [-555.931] (-557.239) (-554.544) * [-553.514] (-555.887) (-553.760) (-554.357) -- 0:00:36
378000 -- [-556.056] (-553.346) (-559.959) (-554.363) * (-555.745) (-554.846) (-558.435) [-556.974] -- 0:00:36
378500 -- (-558.877) [-553.943] (-555.104) (-554.162) * (-553.744) [-553.825] (-553.705) (-556.503) -- 0:00:36
379000 -- [-556.697] (-558.870) (-559.396) (-553.862) * (-557.314) (-555.713) (-554.734) [-557.440] -- 0:00:36
379500 -- (-555.139) (-554.402) (-560.189) [-553.934] * [-554.124] (-555.688) (-553.663) (-553.761) -- 0:00:35
380000 -- [-553.628] (-553.555) (-556.548) (-554.588) * (-554.551) [-553.762] (-555.365) (-557.506) -- 0:00:35
Average standard deviation of split frequencies: 0.015516
380500 -- (-554.346) (-553.838) [-554.533] (-554.055) * (-555.248) [-553.063] (-556.517) (-553.654) -- 0:00:35
381000 -- (-557.365) (-556.684) (-554.831) [-555.471] * (-559.748) [-553.012] (-554.640) (-556.047) -- 0:00:37
381500 -- (-557.538) [-553.417] (-554.365) (-558.402) * (-556.943) [-554.922] (-556.407) (-556.073) -- 0:00:37
382000 -- (-555.236) (-552.862) [-556.966] (-556.634) * (-552.684) [-555.092] (-558.985) (-558.318) -- 0:00:37
382500 -- (-555.989) (-553.490) (-559.372) [-554.078] * (-554.407) [-555.957] (-553.488) (-555.967) -- 0:00:37
383000 -- (-555.048) [-552.792] (-556.781) (-554.310) * (-554.535) (-554.680) [-554.143] (-555.111) -- 0:00:37
383500 -- (-555.038) (-552.731) [-557.034] (-553.383) * (-560.057) (-554.228) [-554.005] (-553.521) -- 0:00:36
384000 -- (-555.808) [-552.985] (-556.524) (-555.708) * (-553.358) [-558.294] (-553.475) (-553.634) -- 0:00:36
384500 -- (-554.840) [-552.582] (-555.636) (-556.909) * (-555.507) (-555.675) (-554.330) [-557.529] -- 0:00:36
385000 -- (-556.924) (-553.227) [-553.616] (-553.893) * (-555.088) (-553.245) (-555.128) [-556.184] -- 0:00:36
Average standard deviation of split frequencies: 0.016020
385500 -- (-556.793) (-554.585) (-555.531) [-554.440] * (-554.664) (-554.661) (-555.661) [-554.340] -- 0:00:36
386000 -- (-555.075) (-556.615) (-555.376) [-554.258] * [-553.538] (-553.422) (-555.615) (-554.991) -- 0:00:36
386500 -- (-553.202) [-554.096] (-554.992) (-556.335) * (-554.315) (-556.762) [-553.677] (-553.854) -- 0:00:36
387000 -- [-556.143] (-558.475) (-553.326) (-556.288) * (-557.394) [-554.062] (-560.951) (-554.140) -- 0:00:36
387500 -- (-556.394) (-558.525) [-555.632] (-555.207) * [-553.905] (-557.476) (-572.017) (-556.499) -- 0:00:36
388000 -- [-553.242] (-554.010) (-556.823) (-555.548) * (-555.731) (-553.556) (-553.857) [-555.392] -- 0:00:36
388500 -- (-554.576) (-556.503) (-558.542) [-557.123] * (-558.102) (-557.313) [-553.107] (-555.239) -- 0:00:36
389000 -- [-555.681] (-553.112) (-556.855) (-559.217) * [-556.145] (-553.459) (-557.699) (-554.243) -- 0:00:36
389500 -- (-553.784) [-553.347] (-560.407) (-554.923) * (-554.781) [-553.938] (-555.164) (-555.197) -- 0:00:36
390000 -- [-555.850] (-553.696) (-554.142) (-552.778) * (-555.376) (-553.910) [-558.017] (-555.624) -- 0:00:35
Average standard deviation of split frequencies: 0.016692
390500 -- (-555.772) (-556.256) [-556.293] (-553.317) * (-554.439) (-553.931) (-553.985) [-553.524] -- 0:00:35
391000 -- (-554.824) (-554.247) [-555.779] (-553.160) * (-553.639) (-555.159) [-556.200] (-553.212) -- 0:00:35
391500 -- (-556.530) (-554.699) [-556.920] (-553.812) * [-554.769] (-556.747) (-553.884) (-554.537) -- 0:00:35
392000 -- [-554.333] (-555.438) (-555.320) (-556.803) * (-554.253) (-556.491) (-554.112) [-553.831] -- 0:00:35
392500 -- (-554.394) [-554.170] (-556.520) (-554.438) * (-554.763) (-553.290) (-555.265) [-553.152] -- 0:00:35
393000 -- (-554.002) [-553.604] (-552.836) (-554.041) * (-555.813) (-555.828) (-555.216) [-554.824] -- 0:00:35
393500 -- (-554.195) (-560.667) (-553.178) [-554.321] * (-553.908) (-553.730) [-556.632] (-555.719) -- 0:00:35
394000 -- [-554.180] (-554.088) (-553.336) (-553.542) * (-556.345) [-553.440] (-556.025) (-554.406) -- 0:00:35
394500 -- (-554.693) (-555.720) (-555.385) [-553.563] * [-554.134] (-555.129) (-558.305) (-553.543) -- 0:00:35
395000 -- (-555.259) (-555.137) [-555.484] (-553.496) * (-553.425) [-555.186] (-554.605) (-554.182) -- 0:00:35
Average standard deviation of split frequencies: 0.016467
395500 -- (-555.436) (-555.033) (-555.012) [-554.425] * (-554.395) (-554.097) [-554.247] (-554.433) -- 0:00:35
396000 -- (-554.517) [-555.398] (-554.308) (-553.560) * (-555.468) (-553.899) (-554.081) [-554.860] -- 0:00:35
396500 -- (-553.579) (-555.461) (-563.160) [-560.421] * [-555.425] (-553.789) (-556.782) (-556.956) -- 0:00:35
397000 -- [-554.305] (-553.556) (-557.296) (-555.927) * (-554.970) [-554.154] (-555.002) (-554.758) -- 0:00:34
397500 -- (-556.428) [-553.555] (-556.518) (-556.102) * [-554.718] (-554.343) (-558.971) (-558.329) -- 0:00:34
398000 -- [-554.721] (-557.618) (-556.273) (-555.522) * (-557.423) [-555.403] (-555.707) (-554.841) -- 0:00:36
398500 -- (-554.994) [-553.665] (-558.188) (-558.371) * (-555.509) [-554.676] (-560.479) (-553.793) -- 0:00:36
399000 -- (-556.310) [-553.253] (-556.554) (-555.850) * (-553.801) (-557.042) (-554.346) [-554.612] -- 0:00:36
399500 -- (-556.978) (-553.602) [-554.953] (-554.657) * (-561.158) (-555.161) [-553.740] (-554.707) -- 0:00:36
400000 -- (-553.480) [-553.966] (-554.732) (-556.450) * [-557.768] (-555.857) (-554.718) (-557.345) -- 0:00:36
Average standard deviation of split frequencies: 0.015491
400500 -- [-558.654] (-554.531) (-554.419) (-555.721) * (-562.208) (-553.515) [-558.299] (-559.273) -- 0:00:35
401000 -- (-556.934) [-554.682] (-553.192) (-553.588) * [-558.392] (-555.952) (-556.065) (-559.737) -- 0:00:35
401500 -- (-554.580) [-553.018] (-555.991) (-558.110) * [-555.907] (-553.198) (-556.541) (-558.039) -- 0:00:35
402000 -- [-553.699] (-557.709) (-553.949) (-558.857) * (-558.240) [-555.238] (-556.136) (-553.946) -- 0:00:35
402500 -- (-554.198) [-556.160] (-557.083) (-555.884) * [-559.155] (-555.695) (-555.028) (-555.470) -- 0:00:35
403000 -- (-557.194) (-554.553) (-553.904) [-554.998] * (-557.761) (-554.590) (-553.762) [-555.165] -- 0:00:35
403500 -- (-554.039) (-556.049) [-553.950] (-556.304) * (-562.763) (-556.550) (-552.791) [-557.846] -- 0:00:35
404000 -- (-556.479) (-558.394) [-553.558] (-555.230) * (-565.127) (-554.999) (-554.663) [-553.679] -- 0:00:35
404500 -- [-553.225] (-554.224) (-554.027) (-557.396) * [-557.356] (-553.936) (-553.456) (-557.915) -- 0:00:35
405000 -- [-552.623] (-554.854) (-553.785) (-555.544) * [-555.009] (-553.869) (-553.731) (-558.247) -- 0:00:35
Average standard deviation of split frequencies: 0.014965
405500 -- (-552.608) (-554.675) [-555.303] (-555.669) * (-558.815) (-555.644) [-557.458] (-557.249) -- 0:00:35
406000 -- (-554.171) (-555.955) [-555.061] (-553.998) * (-554.733) (-556.960) (-555.290) [-555.647] -- 0:00:35
406500 -- (-554.209) (-553.979) (-556.172) [-554.823] * (-555.134) [-555.909] (-555.657) (-556.417) -- 0:00:35
407000 -- (-553.498) (-553.816) [-553.699] (-555.096) * [-557.368] (-554.871) (-558.144) (-557.936) -- 0:00:34
407500 -- (-555.067) (-554.924) [-554.350] (-559.103) * (-558.376) [-554.373] (-561.057) (-554.189) -- 0:00:34
408000 -- (-555.879) (-556.510) (-557.260) [-554.342] * (-552.952) (-554.704) (-557.246) [-555.564] -- 0:00:34
408500 -- [-554.493] (-555.161) (-554.499) (-559.051) * (-554.293) [-554.707] (-558.843) (-553.819) -- 0:00:34
409000 -- (-555.211) (-555.153) [-555.595] (-553.698) * (-554.837) (-556.080) (-554.891) [-555.049] -- 0:00:34
409500 -- [-558.996] (-555.444) (-555.395) (-555.986) * (-558.567) [-555.891] (-555.808) (-555.653) -- 0:00:34
410000 -- (-558.199) (-555.133) (-555.590) [-556.276] * (-554.701) (-553.438) (-553.667) [-556.480] -- 0:00:34
Average standard deviation of split frequencies: 0.014986
410500 -- (-554.034) [-556.685] (-555.388) (-555.755) * (-554.068) (-552.746) [-555.753] (-560.132) -- 0:00:34
411000 -- (-556.853) (-556.767) (-560.172) [-557.827] * (-556.717) [-553.047] (-556.149) (-556.100) -- 0:00:34
411500 -- [-556.293] (-553.687) (-555.312) (-556.640) * (-554.747) (-554.795) (-554.655) [-554.293] -- 0:00:34
412000 -- [-553.163] (-554.707) (-555.442) (-554.442) * (-556.653) [-555.157] (-554.948) (-554.356) -- 0:00:34
412500 -- [-555.225] (-554.250) (-554.123) (-555.437) * (-554.971) (-555.222) (-563.801) [-558.004] -- 0:00:34
413000 -- (-558.158) (-553.851) (-554.250) [-553.599] * (-556.428) (-558.870) (-557.098) [-560.321] -- 0:00:34
413500 -- (-557.527) (-554.842) (-553.504) [-553.666] * (-555.241) [-556.741] (-554.496) (-555.680) -- 0:00:34
414000 -- (-553.921) [-557.517] (-553.029) (-555.755) * [-555.507] (-555.154) (-556.779) (-557.151) -- 0:00:33
414500 -- [-553.214] (-558.052) (-557.060) (-556.659) * (-554.349) (-554.205) [-555.359] (-556.096) -- 0:00:33
415000 -- (-555.056) (-553.436) [-559.354] (-553.727) * (-555.737) (-554.606) [-553.470] (-556.147) -- 0:00:35
Average standard deviation of split frequencies: 0.014598
415500 -- [-554.834] (-553.700) (-559.350) (-553.641) * (-555.632) (-559.708) (-555.112) [-553.713] -- 0:00:35
416000 -- (-556.635) (-555.231) (-556.317) [-554.205] * (-556.955) (-559.518) (-555.371) [-555.099] -- 0:00:35
416500 -- (-556.280) [-554.660] (-562.212) (-553.926) * [-554.222] (-554.158) (-553.008) (-555.577) -- 0:00:35
417000 -- (-556.764) (-554.020) [-555.570] (-553.813) * (-556.227) [-553.634] (-552.848) (-553.114) -- 0:00:34
417500 -- (-553.469) (-553.962) (-557.279) [-555.116] * (-554.926) [-553.499] (-554.117) (-553.597) -- 0:00:34
418000 -- [-557.555] (-556.512) (-553.828) (-554.126) * [-555.811] (-554.610) (-554.211) (-553.949) -- 0:00:34
418500 -- (-554.274) (-554.671) [-553.473] (-553.905) * [-555.617] (-557.983) (-554.472) (-553.370) -- 0:00:34
419000 -- (-556.419) [-554.138] (-554.376) (-554.758) * [-553.731] (-555.933) (-553.246) (-557.074) -- 0:00:34
419500 -- [-557.809] (-553.204) (-553.411) (-553.586) * (-555.616) (-556.006) [-553.770] (-556.896) -- 0:00:34
420000 -- (-556.483) [-553.204] (-555.044) (-554.244) * (-555.670) (-555.305) (-557.063) [-556.126] -- 0:00:34
Average standard deviation of split frequencies: 0.014436
420500 -- (-554.388) (-559.452) [-553.685] (-553.266) * [-554.227] (-558.362) (-556.882) (-556.320) -- 0:00:34
421000 -- (-555.481) (-554.246) [-555.760] (-553.466) * (-554.886) [-558.242] (-555.724) (-555.820) -- 0:00:34
421500 -- (-555.003) [-555.413] (-554.514) (-554.634) * [-554.880] (-553.774) (-555.703) (-553.861) -- 0:00:34
422000 -- (-555.040) (-553.775) [-554.505] (-559.139) * [-552.994] (-562.356) (-557.611) (-553.265) -- 0:00:34
422500 -- [-554.770] (-553.809) (-556.690) (-553.026) * [-555.752] (-553.765) (-554.092) (-553.481) -- 0:00:34
423000 -- (-553.495) [-557.202] (-556.666) (-554.266) * [-556.631] (-555.075) (-554.041) (-556.765) -- 0:00:34
423500 -- (-560.066) (-558.007) [-553.881] (-553.753) * (-556.508) (-555.588) (-558.737) [-556.461] -- 0:00:34
424000 -- (-555.969) [-554.564] (-554.117) (-557.593) * (-554.456) (-559.828) [-554.870] (-555.620) -- 0:00:33
424500 -- [-556.254] (-555.438) (-561.767) (-559.904) * (-553.641) (-560.596) (-559.299) [-553.927] -- 0:00:33
425000 -- [-555.008] (-555.264) (-553.515) (-558.458) * [-556.408] (-556.621) (-557.531) (-552.664) -- 0:00:33
Average standard deviation of split frequencies: 0.013709
425500 -- (-554.616) (-555.906) [-555.439] (-558.621) * (-557.905) [-558.159] (-559.148) (-556.217) -- 0:00:33
426000 -- (-553.690) (-554.301) [-555.616] (-555.703) * (-555.660) (-554.759) (-554.562) [-554.109] -- 0:00:33
426500 -- (-554.483) (-554.503) [-554.213] (-556.916) * (-555.004) [-554.478] (-556.076) (-555.172) -- 0:00:33
427000 -- (-554.661) (-553.932) [-553.307] (-556.060) * [-558.575] (-554.165) (-558.791) (-555.650) -- 0:00:33
427500 -- (-553.472) [-554.685] (-557.349) (-556.029) * (-554.854) (-557.984) (-557.447) [-553.516] -- 0:00:33
428000 -- (-554.138) [-554.283] (-554.296) (-556.657) * (-553.770) (-557.485) (-556.579) [-554.190] -- 0:00:33
428500 -- (-553.581) (-555.030) [-556.046] (-556.788) * (-555.786) (-553.567) (-555.154) [-554.976] -- 0:00:33
429000 -- (-553.862) [-554.488] (-558.503) (-555.188) * (-556.490) (-553.350) (-554.476) [-555.652] -- 0:00:33
429500 -- [-555.464] (-555.375) (-553.530) (-555.781) * (-553.865) [-557.434] (-553.873) (-557.997) -- 0:00:33
430000 -- [-556.541] (-556.149) (-554.645) (-552.633) * (-554.884) (-555.146) [-556.044] (-555.639) -- 0:00:33
Average standard deviation of split frequencies: 0.012892
430500 -- (-553.926) (-555.454) [-554.190] (-552.613) * (-555.254) [-554.944] (-554.239) (-555.877) -- 0:00:33
431000 -- (-557.900) (-559.347) [-554.629] (-558.767) * [-555.813] (-553.574) (-554.325) (-555.505) -- 0:00:33
431500 -- (-557.124) (-556.231) [-556.356] (-553.234) * (-556.475) [-553.851] (-558.024) (-556.397) -- 0:00:32
432000 -- (-559.671) (-554.660) (-554.897) [-553.227] * (-554.605) (-554.121) (-556.397) [-555.553] -- 0:00:34
432500 -- (-552.866) (-554.053) [-556.148] (-554.603) * (-553.799) [-555.983] (-553.931) (-555.226) -- 0:00:34
433000 -- [-553.728] (-553.534) (-555.101) (-552.962) * (-555.052) (-555.639) [-552.960] (-554.628) -- 0:00:34
433500 -- [-554.971] (-556.527) (-553.179) (-553.842) * (-555.979) (-558.886) (-554.680) [-553.815] -- 0:00:33
434000 -- (-553.994) [-556.762] (-557.035) (-559.457) * (-556.147) [-553.805] (-553.886) (-553.966) -- 0:00:33
434500 -- (-553.799) [-554.987] (-554.737) (-556.075) * (-556.294) (-552.857) (-556.633) [-555.760] -- 0:00:33
435000 -- (-556.243) (-554.745) (-555.262) [-552.893] * (-555.000) [-554.194] (-555.852) (-556.021) -- 0:00:33
Average standard deviation of split frequencies: 0.013095
435500 -- (-555.720) (-555.264) [-556.069] (-557.065) * [-554.857] (-555.430) (-554.384) (-560.650) -- 0:00:33
436000 -- (-561.093) (-555.526) [-553.926] (-556.918) * (-555.437) (-555.839) [-554.295] (-556.600) -- 0:00:33
436500 -- (-557.829) [-554.575] (-556.118) (-554.484) * (-556.599) (-556.854) [-553.456] (-554.589) -- 0:00:33
437000 -- (-554.214) [-554.819] (-554.463) (-554.650) * (-563.869) [-553.833] (-553.477) (-554.834) -- 0:00:33
437500 -- [-555.578] (-557.543) (-556.315) (-557.708) * (-553.669) [-556.775] (-553.993) (-556.537) -- 0:00:33
438000 -- (-556.020) (-554.478) (-554.956) [-555.566] * (-558.054) [-554.455] (-555.063) (-557.310) -- 0:00:33
438500 -- [-555.857] (-556.883) (-557.523) (-556.222) * (-555.935) (-554.366) [-554.424] (-557.358) -- 0:00:33
439000 -- [-555.123] (-557.910) (-557.059) (-553.510) * (-554.548) [-554.757] (-554.285) (-557.489) -- 0:00:33
439500 -- [-552.919] (-553.223) (-554.787) (-555.111) * (-554.546) (-553.939) (-554.049) [-557.163] -- 0:00:33
440000 -- (-553.139) (-553.631) (-556.438) [-554.808] * [-555.483] (-553.673) (-555.215) (-554.658) -- 0:00:33
Average standard deviation of split frequencies: 0.012774
440500 -- (-553.844) (-554.586) (-556.637) [-558.083] * [-554.652] (-554.526) (-553.922) (-557.280) -- 0:00:33
441000 -- (-553.481) (-554.798) (-554.269) [-558.032] * [-554.475] (-555.673) (-553.543) (-555.707) -- 0:00:32
441500 -- (-555.359) (-554.738) (-555.647) [-555.250] * (-553.292) [-554.621] (-556.460) (-555.929) -- 0:00:32
442000 -- (-555.046) [-557.195] (-553.094) (-553.631) * (-554.744) (-558.750) (-557.622) [-556.081] -- 0:00:32
442500 -- [-555.256] (-553.559) (-555.637) (-554.419) * [-555.883] (-554.959) (-554.205) (-555.920) -- 0:00:32
443000 -- (-555.997) (-557.042) [-556.186] (-553.476) * (-554.809) [-555.426] (-556.522) (-555.252) -- 0:00:32
443500 -- [-554.760] (-555.799) (-554.462) (-555.020) * [-554.562] (-555.265) (-556.710) (-556.223) -- 0:00:32
444000 -- (-556.935) (-553.847) [-553.026] (-553.196) * [-553.055] (-558.062) (-553.698) (-555.830) -- 0:00:32
444500 -- (-556.603) [-554.260] (-554.331) (-553.325) * [-553.097] (-556.285) (-556.129) (-555.128) -- 0:00:32
445000 -- (-555.307) (-553.703) (-554.307) [-553.038] * (-560.870) [-557.803] (-555.941) (-557.063) -- 0:00:32
Average standard deviation of split frequencies: 0.013329
445500 -- [-555.116] (-553.991) (-554.226) (-556.446) * [-557.438] (-556.967) (-557.372) (-554.704) -- 0:00:32
446000 -- (-554.853) (-553.099) (-555.285) [-555.741] * (-554.350) [-555.341] (-555.681) (-554.067) -- 0:00:32
446500 -- (-557.819) (-553.565) [-555.170] (-553.771) * (-558.207) (-561.706) (-554.543) [-560.099] -- 0:00:32
447000 -- [-557.615] (-553.666) (-556.551) (-555.383) * (-556.728) [-554.388] (-557.423) (-559.834) -- 0:00:32
447500 -- (-555.121) [-554.591] (-555.582) (-552.716) * [-555.029] (-556.678) (-556.420) (-559.676) -- 0:00:32
448000 -- [-556.039] (-553.261) (-558.222) (-559.855) * [-554.360] (-554.269) (-555.437) (-558.090) -- 0:00:32
448500 -- (-558.852) (-554.567) (-555.512) [-554.347] * (-555.546) [-553.933] (-560.980) (-556.052) -- 0:00:31
449000 -- (-556.445) (-555.659) (-554.593) [-555.421] * (-554.144) (-555.047) [-556.151] (-553.623) -- 0:00:33
449500 -- [-553.384] (-553.911) (-554.605) (-553.782) * (-557.166) (-556.633) [-554.473] (-553.076) -- 0:00:33
450000 -- (-555.206) (-554.006) [-555.192] (-558.136) * (-556.354) (-554.314) (-555.455) [-553.076] -- 0:00:33
Average standard deviation of split frequencies: 0.012552
450500 -- [-557.299] (-558.318) (-555.736) (-555.846) * (-557.929) (-557.634) (-554.899) [-553.075] -- 0:00:32
451000 -- [-556.728] (-557.998) (-553.594) (-555.337) * (-554.567) (-556.340) [-555.924] (-555.262) -- 0:00:32
451500 -- [-557.698] (-555.258) (-555.489) (-556.121) * (-555.846) (-560.120) [-557.517] (-553.239) -- 0:00:32
452000 -- (-554.423) (-554.434) [-554.603] (-554.570) * (-554.673) (-554.626) [-554.581] (-554.040) -- 0:00:32
452500 -- (-555.188) (-555.758) [-555.771] (-555.383) * (-554.368) (-552.936) [-554.004] (-554.029) -- 0:00:32
453000 -- [-554.874] (-558.183) (-553.331) (-554.329) * (-556.309) [-553.729] (-554.004) (-556.057) -- 0:00:32
453500 -- (-555.609) (-555.190) [-557.303] (-557.317) * (-556.175) (-555.629) (-556.227) [-554.298] -- 0:00:32
454000 -- (-554.205) (-556.788) (-554.106) [-559.618] * (-559.952) (-553.974) (-555.870) [-554.903] -- 0:00:32
454500 -- (-554.157) (-554.919) [-554.611] (-557.302) * (-560.414) (-553.681) [-554.875] (-554.874) -- 0:00:32
455000 -- (-555.505) (-554.022) [-557.000] (-557.604) * [-554.121] (-554.749) (-553.446) (-558.642) -- 0:00:32
Average standard deviation of split frequencies: 0.011759
455500 -- [-553.395] (-554.173) (-553.853) (-555.404) * (-553.654) (-557.164) (-553.531) [-556.361] -- 0:00:32
456000 -- (-554.033) (-553.754) [-553.773] (-554.198) * (-554.540) (-554.251) (-558.351) [-556.028] -- 0:00:32
456500 -- [-554.381] (-554.060) (-552.954) (-553.386) * [-553.004] (-552.772) (-556.273) (-554.247) -- 0:00:32
457000 -- (-554.768) [-554.060] (-555.953) (-554.213) * (-555.337) [-553.181] (-553.837) (-561.134) -- 0:00:32
457500 -- (-554.795) (-554.870) [-553.618] (-553.569) * [-554.592] (-554.321) (-555.710) (-559.142) -- 0:00:32
458000 -- [-554.567] (-552.954) (-559.008) (-553.657) * (-558.547) (-553.700) [-559.339] (-553.350) -- 0:00:31
458500 -- (-553.459) (-558.626) [-561.018] (-555.572) * (-558.484) (-554.021) [-558.332] (-553.639) -- 0:00:31
459000 -- (-556.683) (-555.063) [-555.881] (-562.287) * (-554.781) (-556.994) [-555.597] (-553.659) -- 0:00:31
459500 -- (-554.073) [-557.390] (-553.629) (-557.982) * (-556.270) (-554.402) (-554.471) [-555.776] -- 0:00:31
460000 -- (-554.827) (-554.541) [-554.448] (-555.001) * [-556.337] (-554.803) (-553.516) (-556.100) -- 0:00:31
Average standard deviation of split frequencies: 0.012024
460500 -- (-557.877) (-554.060) [-553.806] (-558.723) * (-553.213) (-555.292) [-554.089] (-556.421) -- 0:00:31
461000 -- (-555.206) (-556.943) [-555.003] (-553.332) * (-555.043) (-554.507) [-553.646] (-553.655) -- 0:00:31
461500 -- (-554.404) (-559.255) [-556.205] (-556.137) * (-554.772) (-555.179) (-556.155) [-554.928] -- 0:00:31
462000 -- (-553.575) (-555.292) [-555.903] (-559.620) * (-554.516) (-556.343) [-557.444] (-554.704) -- 0:00:31
462500 -- (-553.575) [-554.799] (-553.997) (-555.894) * (-561.176) (-553.556) (-556.423) [-554.665] -- 0:00:31
463000 -- [-556.528] (-554.060) (-555.375) (-557.300) * (-555.488) (-554.319) (-555.300) [-553.713] -- 0:00:31
463500 -- (-555.231) (-555.693) [-553.764] (-554.242) * (-554.653) [-554.567] (-555.501) (-555.584) -- 0:00:31
464000 -- (-557.597) (-557.617) [-553.158] (-553.385) * [-554.037] (-557.391) (-556.650) (-554.376) -- 0:00:31
464500 -- (-558.916) (-555.536) (-555.511) [-554.195] * (-554.202) (-555.413) [-557.395] (-555.494) -- 0:00:31
465000 -- (-557.542) [-555.235] (-553.878) (-554.175) * (-557.249) (-555.166) [-553.789] (-553.392) -- 0:00:31
Average standard deviation of split frequencies: 0.011961
465500 -- (-553.440) (-554.168) [-556.911] (-558.098) * (-556.335) [-556.526] (-553.569) (-552.947) -- 0:00:32
466000 -- (-557.220) (-556.619) (-557.556) [-555.903] * (-555.356) [-554.495] (-553.578) (-554.001) -- 0:00:32
466500 -- [-557.127] (-556.287) (-560.565) (-554.735) * (-554.531) (-554.057) (-558.823) [-558.338] -- 0:00:32
467000 -- (-556.913) (-555.375) (-554.736) [-553.371] * (-554.096) (-553.322) (-556.621) [-554.499] -- 0:00:31
467500 -- [-556.675] (-554.626) (-554.360) (-553.594) * (-556.661) (-555.191) [-554.352] (-554.135) -- 0:00:31
468000 -- (-553.824) [-556.139] (-553.438) (-553.160) * [-554.513] (-553.227) (-554.875) (-558.186) -- 0:00:31
468500 -- (-554.530) (-557.647) (-553.397) [-553.729] * (-556.089) [-556.540] (-554.365) (-556.230) -- 0:00:31
469000 -- (-555.410) (-557.773) (-554.135) [-552.805] * (-555.613) (-553.618) (-557.888) [-554.513] -- 0:00:31
469500 -- (-554.740) (-554.440) (-553.415) [-556.204] * (-555.785) (-553.631) (-553.679) [-553.891] -- 0:00:31
470000 -- (-554.248) (-556.588) [-554.369] (-555.028) * (-556.063) (-559.951) (-555.166) [-553.978] -- 0:00:31
Average standard deviation of split frequencies: 0.012019
470500 -- (-554.700) [-553.715] (-556.001) (-554.746) * (-554.406) [-554.662] (-558.061) (-554.178) -- 0:00:31
471000 -- [-552.933] (-558.412) (-554.421) (-555.280) * (-554.042) (-555.242) (-555.560) [-557.608] -- 0:00:31
471500 -- (-555.769) (-556.551) (-553.230) [-553.682] * (-556.489) [-553.794] (-554.941) (-553.702) -- 0:00:31
472000 -- (-553.825) [-554.153] (-553.993) (-558.108) * (-557.419) (-555.265) [-554.611] (-553.931) -- 0:00:31
472500 -- (-553.813) (-554.635) [-558.484] (-554.922) * (-555.535) (-554.903) (-553.827) [-556.311] -- 0:00:31
473000 -- [-553.830] (-555.734) (-559.950) (-553.002) * (-554.054) [-552.998] (-556.260) (-555.057) -- 0:00:31
473500 -- (-555.192) [-553.918] (-555.866) (-557.024) * [-555.543] (-555.550) (-556.895) (-554.341) -- 0:00:31
474000 -- (-554.787) (-553.413) (-554.308) [-552.979] * (-556.386) (-556.162) (-556.681) [-553.124] -- 0:00:31
474500 -- (-553.623) [-554.530] (-553.274) (-552.978) * (-556.659) (-553.208) [-554.200] (-557.311) -- 0:00:31
475000 -- (-556.791) (-552.909) (-554.435) [-556.007] * (-557.331) [-554.776] (-554.247) (-556.703) -- 0:00:30
Average standard deviation of split frequencies: 0.012256
475500 -- (-554.772) (-553.615) [-553.433] (-557.024) * (-558.026) (-553.741) (-554.810) [-554.148] -- 0:00:30
476000 -- (-552.887) (-556.353) (-554.474) [-554.851] * [-555.096] (-553.775) (-555.053) (-554.397) -- 0:00:30
476500 -- (-554.595) (-553.513) (-553.279) [-555.500] * (-553.923) (-554.939) [-554.253] (-557.083) -- 0:00:30
477000 -- (-554.128) (-554.130) [-555.903] (-553.614) * [-554.351] (-554.138) (-554.314) (-555.962) -- 0:00:30
477500 -- (-552.794) (-552.663) (-553.324) [-554.362] * [-556.905] (-556.060) (-553.196) (-554.250) -- 0:00:30
478000 -- (-553.589) (-556.504) (-553.298) [-554.358] * (-556.759) (-553.772) (-554.397) [-555.588] -- 0:00:30
478500 -- (-557.250) (-558.293) (-557.117) [-557.943] * [-554.805] (-554.230) (-554.201) (-555.276) -- 0:00:30
479000 -- [-555.900] (-554.909) (-555.760) (-559.028) * (-556.308) [-555.960] (-555.467) (-554.643) -- 0:00:30
479500 -- [-555.547] (-557.417) (-553.660) (-553.396) * (-558.204) [-554.205] (-555.260) (-553.876) -- 0:00:30
480000 -- [-554.185] (-555.837) (-553.799) (-555.570) * (-553.531) [-555.170] (-556.369) (-554.440) -- 0:00:30
Average standard deviation of split frequencies: 0.011953
480500 -- [-554.626] (-555.579) (-554.559) (-559.282) * (-556.370) (-557.294) [-559.120] (-555.147) -- 0:00:30
481000 -- [-554.453] (-554.438) (-554.460) (-556.307) * (-554.376) [-555.391] (-558.922) (-554.269) -- 0:00:30
481500 -- (-556.110) [-553.478] (-554.961) (-555.856) * (-560.356) (-557.014) (-557.702) [-553.976] -- 0:00:30
482000 -- [-555.326] (-554.509) (-555.404) (-554.615) * (-567.111) (-555.086) [-554.047] (-553.893) -- 0:00:30
482500 -- [-553.649] (-557.304) (-560.176) (-555.165) * (-561.099) [-555.528] (-554.204) (-555.317) -- 0:00:31
483000 -- [-553.597] (-555.198) (-555.563) (-555.655) * (-557.264) [-556.231] (-553.629) (-553.966) -- 0:00:31
483500 -- (-554.038) (-554.092) [-554.529] (-553.475) * (-557.263) (-555.038) (-563.149) [-554.808] -- 0:00:30
484000 -- (-553.909) (-561.519) [-556.346] (-557.111) * [-556.495] (-555.122) (-558.017) (-556.247) -- 0:00:30
484500 -- (-553.956) (-558.510) [-561.810] (-556.976) * (-554.708) (-556.033) (-554.936) [-557.574] -- 0:00:30
485000 -- [-552.944] (-554.230) (-553.843) (-555.158) * (-554.236) [-553.309] (-553.936) (-555.505) -- 0:00:30
Average standard deviation of split frequencies: 0.012367
485500 -- (-553.501) (-556.428) [-553.877] (-553.121) * (-555.485) [-553.881] (-553.499) (-554.068) -- 0:00:30
486000 -- (-554.575) [-557.615] (-553.670) (-554.199) * [-555.871] (-559.705) (-555.523) (-555.501) -- 0:00:30
486500 -- (-554.797) (-555.562) [-555.536] (-554.690) * [-553.538] (-554.775) (-557.894) (-554.911) -- 0:00:30
487000 -- (-557.182) [-553.082] (-554.308) (-555.860) * (-552.825) (-555.779) [-555.231] (-554.791) -- 0:00:30
487500 -- (-554.683) (-556.878) [-554.156] (-554.823) * (-554.594) (-554.582) [-556.795] (-554.409) -- 0:00:30
488000 -- [-555.242] (-554.577) (-554.787) (-557.957) * [-556.775] (-556.618) (-554.079) (-555.497) -- 0:00:30
488500 -- [-555.121] (-558.369) (-558.398) (-554.931) * [-556.433] (-553.240) (-557.402) (-556.119) -- 0:00:30
489000 -- [-553.735] (-555.571) (-556.336) (-553.790) * (-555.553) (-556.193) (-553.524) [-553.282] -- 0:00:30
489500 -- (-553.447) (-554.704) [-553.632] (-554.761) * (-555.173) [-555.549] (-554.021) (-553.653) -- 0:00:30
490000 -- (-558.652) (-555.290) [-556.060] (-553.738) * [-553.551] (-555.160) (-555.255) (-561.273) -- 0:00:30
Average standard deviation of split frequencies: 0.012310
490500 -- (-560.578) (-555.325) [-557.347] (-553.866) * (-553.341) (-555.574) (-553.898) [-554.630] -- 0:00:30
491000 -- [-554.475] (-558.614) (-553.412) (-554.686) * (-554.148) (-557.649) (-553.180) [-556.765] -- 0:00:30
491500 -- [-554.097] (-557.798) (-555.383) (-554.828) * [-555.095] (-555.259) (-554.426) (-553.817) -- 0:00:30
492000 -- (-553.192) (-557.568) (-555.171) [-554.929] * (-553.972) (-554.455) [-553.713] (-557.001) -- 0:00:29
492500 -- [-556.139] (-555.404) (-556.304) (-555.230) * (-554.746) [-555.338] (-556.325) (-554.194) -- 0:00:29
493000 -- (-555.803) [-557.510] (-554.185) (-555.365) * (-554.675) [-555.222] (-556.510) (-555.840) -- 0:00:29
493500 -- [-553.622] (-552.851) (-556.163) (-553.984) * [-555.124] (-553.625) (-554.899) (-554.436) -- 0:00:29
494000 -- (-553.189) (-553.433) (-556.637) [-556.839] * [-556.090] (-552.911) (-554.647) (-555.263) -- 0:00:29
494500 -- (-554.410) (-555.758) (-553.405) [-556.447] * (-554.420) (-553.810) (-553.097) [-558.226] -- 0:00:29
495000 -- [-553.789] (-559.505) (-554.560) (-556.749) * (-556.576) (-555.202) [-554.230] (-556.248) -- 0:00:29
Average standard deviation of split frequencies: 0.012652
495500 -- (-555.952) [-554.951] (-554.113) (-557.435) * (-557.212) (-560.337) [-552.762] (-555.697) -- 0:00:29
496000 -- (-555.486) [-554.814] (-556.135) (-553.642) * [-555.807] (-554.904) (-553.782) (-556.665) -- 0:00:29
496500 -- [-553.761] (-555.632) (-554.724) (-554.209) * (-553.590) (-559.106) (-552.817) [-557.675] -- 0:00:29
497000 -- [-554.084] (-556.121) (-553.908) (-554.281) * [-553.927] (-557.991) (-553.302) (-554.675) -- 0:00:29
497500 -- [-553.608] (-555.454) (-554.159) (-552.804) * (-555.623) (-555.368) [-553.523] (-555.580) -- 0:00:29
498000 -- (-553.470) (-554.958) (-554.637) [-554.201] * (-553.985) (-555.921) (-558.414) [-554.520] -- 0:00:29
498500 -- (-552.886) (-556.406) (-555.719) [-553.195] * (-553.238) (-555.483) (-556.647) [-553.934] -- 0:00:29
499000 -- [-553.843] (-554.607) (-557.284) (-557.383) * (-553.186) (-555.407) (-559.345) [-555.285] -- 0:00:29
499500 -- (-553.376) [-553.746] (-554.911) (-555.611) * [-556.884] (-554.182) (-554.025) (-556.760) -- 0:00:30
500000 -- (-554.645) (-555.644) (-554.807) [-554.879] * (-553.433) (-553.244) (-558.756) [-556.014] -- 0:00:30
Average standard deviation of split frequencies: 0.012358
500500 -- (-554.426) (-555.264) [-555.410] (-555.095) * (-555.193) (-555.674) (-554.160) [-557.962] -- 0:00:29
501000 -- (-554.818) [-556.372] (-556.999) (-555.998) * (-553.446) (-555.459) (-556.235) [-554.551] -- 0:00:29
501500 -- [-557.538] (-554.254) (-554.152) (-557.375) * [-555.542] (-557.830) (-555.868) (-553.997) -- 0:00:29
502000 -- (-553.884) (-553.982) [-554.120] (-554.352) * [-554.027] (-557.861) (-554.680) (-554.642) -- 0:00:29
502500 -- (-553.742) (-554.518) [-554.110] (-556.536) * (-555.700) [-555.642] (-555.700) (-554.701) -- 0:00:29
503000 -- [-556.306] (-558.425) (-555.617) (-554.628) * [-555.009] (-553.998) (-552.576) (-556.623) -- 0:00:29
503500 -- (-553.140) (-555.969) (-558.037) [-555.062] * (-556.241) [-554.202] (-553.175) (-554.219) -- 0:00:29
504000 -- (-554.254) [-553.761] (-553.538) (-553.024) * (-556.483) [-553.673] (-554.182) (-555.549) -- 0:00:29
504500 -- (-561.244) (-555.304) [-554.327] (-553.121) * (-556.189) (-555.098) [-554.373] (-554.468) -- 0:00:29
505000 -- (-553.483) (-555.130) [-554.320] (-553.989) * (-559.868) [-554.172] (-555.315) (-553.530) -- 0:00:29
Average standard deviation of split frequencies: 0.012473
505500 -- (-554.356) (-553.792) [-554.123] (-554.893) * (-561.103) (-554.085) (-558.628) [-554.784] -- 0:00:29
506000 -- (-556.960) (-556.327) [-555.848] (-553.195) * (-552.885) [-556.608] (-558.057) (-554.427) -- 0:00:29
506500 -- (-553.586) (-554.825) (-553.093) [-554.355] * (-557.766) (-555.426) (-555.896) [-555.690] -- 0:00:29
507000 -- (-554.134) (-556.005) [-552.993] (-555.763) * (-556.419) (-558.013) (-552.994) [-557.351] -- 0:00:29
507500 -- (-553.015) [-555.986] (-553.411) (-554.531) * (-555.559) [-557.762] (-555.025) (-558.161) -- 0:00:29
508000 -- [-554.413] (-553.564) (-554.154) (-553.698) * (-555.996) (-555.089) [-555.991] (-553.670) -- 0:00:29
508500 -- (-557.408) [-553.039] (-554.557) (-556.393) * (-557.922) [-555.603] (-555.963) (-555.565) -- 0:00:28
509000 -- (-556.390) (-553.174) [-555.971] (-557.365) * (-553.420) (-556.458) [-553.609] (-555.241) -- 0:00:28
509500 -- (-554.940) [-556.322] (-555.764) (-554.492) * [-554.115] (-556.039) (-554.331) (-555.388) -- 0:00:28
510000 -- [-554.327] (-557.648) (-556.314) (-560.359) * [-555.565] (-558.754) (-555.144) (-555.534) -- 0:00:28
Average standard deviation of split frequencies: 0.012435
510500 -- (-555.187) [-556.426] (-554.705) (-555.763) * (-552.911) (-554.410) [-553.417] (-555.578) -- 0:00:28
511000 -- [-553.482] (-553.234) (-555.855) (-554.769) * (-553.576) (-556.349) [-555.109] (-555.122) -- 0:00:28
511500 -- [-552.982] (-553.300) (-554.746) (-555.897) * (-553.707) (-554.834) [-554.884] (-554.855) -- 0:00:28
512000 -- (-555.579) (-554.237) [-554.539] (-554.307) * (-553.412) [-555.872] (-557.755) (-552.780) -- 0:00:28
512500 -- (-560.702) (-555.281) [-553.249] (-554.688) * (-552.795) [-554.011] (-553.336) (-554.457) -- 0:00:28
513000 -- (-556.597) [-554.625] (-553.078) (-554.550) * (-557.477) (-553.440) (-556.369) [-554.430] -- 0:00:28
513500 -- (-556.331) [-553.916] (-555.688) (-555.595) * (-554.045) (-555.730) [-555.065] (-556.220) -- 0:00:28
514000 -- [-554.537] (-554.299) (-555.285) (-555.346) * [-553.152] (-557.447) (-558.302) (-555.416) -- 0:00:28
514500 -- (-559.275) [-553.594] (-554.143) (-556.051) * (-559.121) [-556.503] (-554.045) (-554.760) -- 0:00:28
515000 -- (-554.797) [-556.747] (-559.962) (-555.350) * (-554.722) (-555.943) [-555.070] (-553.930) -- 0:00:28
Average standard deviation of split frequencies: 0.012306
515500 -- (-555.507) [-555.121] (-554.784) (-555.400) * (-555.182) (-558.161) [-557.081] (-558.163) -- 0:00:28
516000 -- (-553.473) [-555.428] (-553.825) (-559.223) * (-556.972) [-555.495] (-558.778) (-552.876) -- 0:00:28
516500 -- (-556.094) [-557.891] (-556.800) (-552.939) * (-556.425) [-552.855] (-558.751) (-555.692) -- 0:00:29
517000 -- (-556.332) [-557.950] (-554.771) (-553.609) * (-554.564) [-554.585] (-559.761) (-554.517) -- 0:00:28
517500 -- (-555.009) (-554.502) [-555.855] (-554.752) * (-556.386) (-555.872) (-563.120) [-556.508] -- 0:00:28
518000 -- [-554.514] (-553.664) (-554.808) (-554.604) * (-559.000) [-555.895] (-555.128) (-555.788) -- 0:00:28
518500 -- (-554.185) (-554.258) (-558.582) [-557.287] * (-559.391) (-554.895) (-556.549) [-553.634] -- 0:00:28
519000 -- (-558.287) (-562.388) [-554.605] (-554.340) * (-556.278) (-557.018) (-553.700) [-554.439] -- 0:00:28
519500 -- (-557.966) (-555.734) (-555.023) [-556.449] * (-554.585) (-559.852) (-553.096) [-554.291] -- 0:00:28
520000 -- (-554.269) (-554.518) [-553.734] (-556.523) * (-560.636) [-554.101] (-557.278) (-554.804) -- 0:00:28
Average standard deviation of split frequencies: 0.011504
520500 -- (-554.997) [-554.063] (-553.348) (-554.011) * (-559.902) (-553.690) (-555.983) [-554.495] -- 0:00:28
521000 -- (-556.331) (-553.996) (-552.929) [-554.441] * (-558.545) (-554.384) (-557.003) [-553.534] -- 0:00:28
521500 -- (-557.624) (-553.220) [-556.207] (-554.494) * [-554.125] (-557.389) (-554.179) (-553.152) -- 0:00:28
522000 -- (-554.073) (-553.056) (-553.085) [-555.658] * [-553.925] (-554.231) (-555.337) (-556.782) -- 0:00:28
522500 -- (-554.811) (-553.636) [-553.257] (-561.186) * [-553.741] (-556.046) (-554.094) (-558.231) -- 0:00:28
523000 -- (-555.107) (-555.202) [-554.042] (-553.802) * [-554.774] (-555.343) (-553.745) (-558.192) -- 0:00:28
523500 -- (-553.709) [-554.916] (-556.439) (-556.369) * (-554.254) [-555.526] (-559.224) (-556.024) -- 0:00:28
524000 -- (-553.545) (-554.989) [-557.742] (-555.542) * (-554.354) (-559.793) [-553.497] (-559.950) -- 0:00:28
524500 -- (-554.757) (-556.866) (-554.460) [-557.877] * (-556.713) (-555.125) [-557.767] (-558.115) -- 0:00:28
525000 -- [-555.311] (-559.700) (-553.928) (-556.111) * (-555.962) (-553.858) [-556.227] (-554.846) -- 0:00:28
Average standard deviation of split frequencies: 0.011493
525500 -- (-555.174) (-559.125) [-557.725] (-554.830) * (-552.814) [-553.783] (-558.194) (-556.960) -- 0:00:27
526000 -- (-553.895) [-554.747] (-554.292) (-558.853) * (-554.148) [-555.760] (-554.681) (-557.216) -- 0:00:27
526500 -- (-555.133) (-553.261) (-555.422) [-557.408] * [-553.724] (-556.438) (-555.079) (-555.595) -- 0:00:27
527000 -- [-555.938] (-553.749) (-554.435) (-555.006) * (-556.165) (-552.600) (-555.377) [-555.996] -- 0:00:27
527500 -- (-553.846) (-556.071) (-555.112) [-554.424] * (-555.802) [-555.197] (-554.403) (-555.811) -- 0:00:27
528000 -- (-554.599) (-553.816) [-554.239] (-557.396) * [-553.349] (-554.274) (-554.084) (-553.834) -- 0:00:27
528500 -- [-554.216] (-553.556) (-555.667) (-555.629) * [-553.293] (-553.002) (-558.932) (-554.786) -- 0:00:27
529000 -- (-553.821) [-555.387] (-555.487) (-555.005) * (-554.763) [-556.790] (-556.263) (-557.743) -- 0:00:27
529500 -- [-553.947] (-555.359) (-554.651) (-556.872) * (-555.643) [-555.800] (-555.364) (-556.424) -- 0:00:27
530000 -- (-553.886) (-554.457) (-555.240) [-554.282] * (-555.051) (-556.252) (-555.226) [-555.152] -- 0:00:27
Average standard deviation of split frequencies: 0.011049
530500 -- (-553.317) (-558.050) (-557.164) [-553.386] * (-552.933) [-554.049] (-553.499) (-553.398) -- 0:00:27
531000 -- (-553.550) (-554.500) (-554.787) [-555.156] * (-554.330) (-556.173) [-553.924] (-555.458) -- 0:00:27
531500 -- [-555.029] (-555.664) (-554.271) (-558.698) * (-554.966) (-555.824) [-554.102] (-556.254) -- 0:00:27
532000 -- (-553.491) (-555.262) [-555.387] (-554.309) * (-554.007) (-555.241) (-554.576) [-553.161] -- 0:00:27
532500 -- [-555.899] (-555.358) (-555.814) (-553.070) * (-558.193) (-553.542) (-555.922) [-554.450] -- 0:00:27
533000 -- (-557.590) (-553.806) [-558.538] (-554.058) * (-557.495) (-555.985) [-555.114] (-555.128) -- 0:00:27
533500 -- (-555.942) (-559.119) [-557.188] (-555.881) * (-555.531) [-555.942] (-555.206) (-555.448) -- 0:00:27
534000 -- (-559.596) [-555.478] (-554.017) (-555.024) * (-558.676) (-555.846) [-554.327] (-555.041) -- 0:00:27
534500 -- [-555.027] (-554.953) (-554.599) (-556.792) * [-556.109] (-554.201) (-553.761) (-555.065) -- 0:00:27
535000 -- (-553.922) (-555.101) (-555.598) [-554.234] * (-556.505) (-555.225) [-556.048] (-555.222) -- 0:00:27
Average standard deviation of split frequencies: 0.011485
535500 -- (-554.634) (-560.057) (-556.647) [-553.662] * [-553.965] (-554.613) (-554.976) (-556.344) -- 0:00:27
536000 -- (-553.041) [-553.571] (-557.566) (-554.341) * [-554.834] (-554.156) (-554.349) (-554.849) -- 0:00:27
536500 -- [-554.782] (-553.126) (-557.784) (-556.380) * (-554.388) (-555.600) [-553.458] (-555.542) -- 0:00:27
537000 -- [-553.960] (-555.556) (-560.227) (-553.724) * (-553.955) (-555.542) (-554.662) [-556.095] -- 0:00:27
537500 -- (-556.040) (-557.573) [-554.577] (-553.114) * (-554.822) (-554.443) (-555.102) [-554.852] -- 0:00:27
538000 -- (-555.094) [-553.991] (-557.534) (-554.779) * (-555.973) (-553.410) (-553.614) [-556.142] -- 0:00:27
538500 -- (-554.121) (-557.992) [-555.236] (-555.571) * [-554.209] (-556.319) (-554.632) (-555.519) -- 0:00:27
539000 -- (-554.063) [-555.142] (-553.327) (-553.275) * (-555.905) (-555.551) (-555.011) [-553.854] -- 0:00:27
539500 -- (-554.485) (-555.454) (-558.437) [-554.310] * (-553.782) (-554.466) [-555.510] (-553.438) -- 0:00:27
540000 -- [-554.932] (-559.671) (-555.843) (-560.198) * (-553.914) [-555.078] (-553.558) (-554.523) -- 0:00:27
Average standard deviation of split frequencies: 0.010899
540500 -- (-555.739) (-555.587) (-555.273) [-561.487] * (-555.071) (-557.087) (-554.218) [-555.427] -- 0:00:27
541000 -- [-556.157] (-556.851) (-556.050) (-554.926) * (-553.206) [-554.512] (-555.030) (-557.681) -- 0:00:27
541500 -- (-560.404) [-558.742] (-553.226) (-554.168) * (-556.819) (-554.042) (-556.032) [-554.838] -- 0:00:27
542000 -- (-565.898) [-553.361] (-554.336) (-555.225) * (-556.119) [-555.078] (-554.664) (-555.163) -- 0:00:27
542500 -- (-561.743) (-558.085) (-554.037) [-558.594] * (-554.846) [-554.310] (-555.160) (-555.625) -- 0:00:26
543000 -- (-556.370) (-553.602) [-554.081] (-553.733) * (-554.334) (-554.317) (-555.620) [-554.455] -- 0:00:26
543500 -- [-558.166] (-553.276) (-558.499) (-556.949) * [-554.553] (-554.968) (-557.011) (-557.047) -- 0:00:26
544000 -- (-555.060) [-554.408] (-556.344) (-556.157) * (-553.928) (-554.036) (-555.295) [-554.363] -- 0:00:26
544500 -- [-553.488] (-553.074) (-556.863) (-555.830) * (-559.702) (-553.834) (-555.858) [-554.189] -- 0:00:26
545000 -- [-555.702] (-554.226) (-557.424) (-553.768) * (-558.192) (-555.196) (-553.222) [-557.072] -- 0:00:26
Average standard deviation of split frequencies: 0.010564
545500 -- (-555.532) (-553.710) (-555.589) [-553.966] * (-558.665) [-553.642] (-554.058) (-557.162) -- 0:00:26
546000 -- (-554.219) (-553.189) [-554.591] (-557.273) * (-554.913) [-554.257] (-555.678) (-553.624) -- 0:00:26
546500 -- [-556.513] (-554.615) (-553.635) (-555.339) * (-554.980) (-554.486) [-558.442] (-556.668) -- 0:00:26
547000 -- (-555.216) (-555.385) [-555.260] (-556.710) * (-553.604) [-554.043] (-555.034) (-554.604) -- 0:00:26
547500 -- (-554.486) (-556.348) [-554.734] (-554.079) * (-557.577) [-553.912] (-554.756) (-556.730) -- 0:00:26
548000 -- (-553.895) (-555.017) [-563.945] (-555.931) * (-555.541) (-554.485) (-557.756) [-556.019] -- 0:00:26
548500 -- [-553.515] (-555.842) (-558.447) (-556.643) * (-554.311) [-554.888] (-555.123) (-553.313) -- 0:00:26
549000 -- (-553.918) (-554.109) [-554.592] (-556.548) * (-555.166) (-554.749) (-557.213) [-555.724] -- 0:00:26
549500 -- (-558.712) (-554.019) (-555.881) [-555.579] * (-555.994) (-556.013) [-555.577] (-557.442) -- 0:00:26
550000 -- (-556.684) [-558.003] (-554.521) (-555.880) * (-555.772) (-557.586) [-553.418] (-557.390) -- 0:00:26
Average standard deviation of split frequencies: 0.010433
550500 -- (-557.134) (-563.685) (-554.322) [-553.608] * [-554.200] (-554.338) (-555.820) (-555.300) -- 0:00:26
551000 -- (-556.281) (-555.379) [-554.428] (-556.448) * [-553.072] (-556.098) (-555.123) (-553.726) -- 0:00:26
551500 -- [-555.882] (-553.931) (-559.014) (-556.241) * (-554.390) (-555.471) [-554.536] (-555.553) -- 0:00:26
552000 -- (-555.440) (-553.811) [-554.706] (-557.533) * (-558.721) (-555.915) [-556.557] (-555.477) -- 0:00:26
552500 -- (-554.932) (-556.024) [-554.733] (-555.159) * (-555.936) (-557.872) [-557.461] (-554.220) -- 0:00:26
553000 -- (-554.076) [-556.681] (-554.993) (-555.814) * (-553.640) [-554.332] (-555.905) (-555.974) -- 0:00:26
553500 -- [-554.629] (-556.075) (-554.379) (-556.176) * [-559.424] (-553.273) (-555.918) (-555.676) -- 0:00:26
554000 -- (-556.320) (-554.721) [-555.178] (-555.971) * (-555.819) [-555.234] (-554.757) (-555.963) -- 0:00:26
554500 -- (-555.455) [-553.966] (-557.018) (-555.917) * (-565.171) (-554.550) (-559.246) [-554.674] -- 0:00:26
555000 -- [-555.613] (-554.414) (-552.856) (-555.391) * (-556.981) (-553.773) [-553.565] (-557.852) -- 0:00:26
Average standard deviation of split frequencies: 0.010492
555500 -- (-556.543) (-555.004) [-553.156] (-562.695) * (-554.353) [-555.138] (-553.143) (-554.013) -- 0:00:26
556000 -- (-560.106) [-553.864] (-553.725) (-558.649) * [-555.677] (-554.707) (-553.632) (-554.110) -- 0:00:26
556500 -- (-563.608) (-554.138) [-553.468] (-553.480) * (-554.312) [-553.792] (-553.902) (-555.991) -- 0:00:26
557000 -- (-557.505) [-554.603] (-555.514) (-554.481) * (-559.133) [-554.329] (-553.848) (-557.558) -- 0:00:26
557500 -- [-553.458] (-554.246) (-557.628) (-556.804) * (-555.270) [-554.435] (-560.786) (-555.358) -- 0:00:26
558000 -- (-557.671) [-556.057] (-554.112) (-556.792) * (-553.360) (-554.859) (-557.911) [-555.846] -- 0:00:26
558500 -- (-555.922) (-554.306) (-554.412) [-553.520] * (-552.965) [-554.901] (-552.815) (-557.997) -- 0:00:26
559000 -- (-553.073) [-559.738] (-554.718) (-554.913) * (-553.527) (-553.298) [-554.564] (-557.981) -- 0:00:26
559500 -- (-557.590) (-554.113) (-554.002) [-555.287] * [-553.460] (-556.560) (-553.709) (-555.488) -- 0:00:25
560000 -- [-554.236] (-555.563) (-556.913) (-555.608) * [-553.603] (-554.552) (-556.790) (-554.743) -- 0:00:25
Average standard deviation of split frequencies: 0.010482
560500 -- (-554.416) (-554.775) (-555.351) [-553.481] * (-553.709) [-556.751] (-558.127) (-555.217) -- 0:00:25
561000 -- [-553.385] (-555.969) (-554.180) (-553.560) * (-554.807) (-556.878) (-554.080) [-553.906] -- 0:00:25
561500 -- [-555.889] (-553.076) (-555.054) (-553.456) * (-556.169) [-555.309] (-554.687) (-556.476) -- 0:00:25
562000 -- [-553.520] (-557.462) (-553.467) (-554.009) * (-556.619) (-555.287) (-554.453) [-553.013] -- 0:00:25
562500 -- [-554.429] (-555.236) (-553.534) (-553.233) * (-555.042) (-557.532) [-554.280] (-558.016) -- 0:00:25
563000 -- (-554.183) (-557.228) [-552.951] (-554.931) * (-555.443) (-555.649) [-553.508] (-557.150) -- 0:00:25
563500 -- (-561.112) [-554.035] (-557.181) (-555.168) * (-560.618) (-556.821) [-554.193] (-553.103) -- 0:00:25
564000 -- (-561.423) (-553.252) [-555.425] (-557.029) * [-555.832] (-553.164) (-555.837) (-556.430) -- 0:00:25
564500 -- (-557.569) (-553.304) (-553.167) [-554.621] * (-555.026) [-553.710] (-554.600) (-555.295) -- 0:00:25
565000 -- (-557.146) (-555.798) [-555.356] (-556.637) * (-556.753) [-552.965] (-555.346) (-557.449) -- 0:00:25
Average standard deviation of split frequencies: 0.010716
565500 -- (-553.247) (-558.105) (-554.714) [-554.589] * (-559.752) (-553.148) [-557.593] (-556.275) -- 0:00:25
566000 -- (-556.199) [-556.253] (-554.523) (-554.386) * (-554.849) (-553.157) (-557.204) [-554.452] -- 0:00:25
566500 -- [-555.744] (-553.489) (-554.309) (-553.684) * (-555.956) [-552.780] (-556.581) (-554.361) -- 0:00:25
567000 -- (-554.754) [-555.739] (-554.739) (-554.339) * [-555.297] (-554.277) (-553.476) (-554.750) -- 0:00:25
567500 -- (-555.932) (-555.028) [-554.422] (-559.477) * (-553.717) (-553.403) [-553.928] (-556.078) -- 0:00:25
568000 -- (-554.690) (-558.285) (-562.542) [-557.821] * [-555.183] (-553.944) (-556.604) (-556.046) -- 0:00:25
568500 -- (-553.225) (-554.380) [-552.941] (-557.930) * (-554.985) (-556.111) [-555.676] (-555.620) -- 0:00:25
569000 -- (-556.372) (-553.270) (-555.369) [-555.467] * [-553.362] (-556.551) (-559.833) (-553.863) -- 0:00:25
569500 -- [-556.265] (-559.114) (-557.843) (-555.027) * (-553.705) (-554.656) (-554.909) [-553.665] -- 0:00:25
570000 -- (-553.454) (-554.067) (-554.287) [-553.098] * [-558.203] (-555.194) (-555.465) (-556.996) -- 0:00:25
Average standard deviation of split frequencies: 0.010518
570500 -- (-553.796) (-554.010) (-555.821) [-553.527] * (-556.370) (-555.721) [-555.752] (-552.600) -- 0:00:25
571000 -- [-556.460] (-554.211) (-554.095) (-553.432) * (-556.498) (-558.670) (-557.634) [-554.027] -- 0:00:25
571500 -- (-553.489) (-554.873) [-560.726] (-553.235) * (-557.033) (-555.695) [-554.703] (-553.880) -- 0:00:25
572000 -- (-556.542) (-558.371) [-555.122] (-559.007) * (-555.698) (-553.773) [-554.566] (-557.961) -- 0:00:25
572500 -- (-555.615) (-557.376) [-556.764] (-553.679) * (-554.449) [-554.553] (-555.325) (-552.978) -- 0:00:25
573000 -- (-554.561) [-558.381] (-553.974) (-557.471) * (-552.827) (-555.175) [-553.996] (-556.895) -- 0:00:25
573500 -- [-556.342] (-555.235) (-554.338) (-556.854) * (-553.119) [-553.105] (-555.744) (-556.071) -- 0:00:25
574000 -- (-553.475) [-554.364] (-554.502) (-556.282) * [-554.387] (-554.437) (-554.168) (-554.389) -- 0:00:25
574500 -- (-554.294) (-553.906) (-558.244) [-553.880] * (-553.156) (-558.386) [-554.154] (-557.262) -- 0:00:25
575000 -- (-556.533) (-553.927) [-553.504] (-557.831) * [-554.132] (-555.174) (-556.824) (-555.228) -- 0:00:25
Average standard deviation of split frequencies: 0.010895
575500 -- (-556.995) (-557.126) [-553.866] (-556.247) * (-555.250) (-554.731) [-554.559] (-556.720) -- 0:00:25
576000 -- (-557.679) (-554.025) [-557.621] (-558.231) * (-554.406) (-553.376) (-554.207) [-553.620] -- 0:00:25
576500 -- (-556.281) [-556.028] (-553.910) (-555.252) * (-558.676) [-555.292] (-554.290) (-556.685) -- 0:00:24
577000 -- (-553.391) [-554.651] (-553.611) (-556.512) * (-557.356) [-556.510] (-556.527) (-554.310) -- 0:00:24
577500 -- (-556.688) (-554.213) (-554.810) [-556.005] * [-554.510] (-556.126) (-555.299) (-555.834) -- 0:00:24
578000 -- (-558.425) (-558.638) [-554.514] (-554.822) * (-558.197) (-557.627) [-559.845] (-556.680) -- 0:00:24
578500 -- (-559.524) (-556.020) [-555.892] (-554.683) * (-555.655) (-557.612) [-553.593] (-554.821) -- 0:00:24
579000 -- (-553.523) (-555.166) [-553.617] (-556.113) * (-556.074) (-556.586) (-556.006) [-556.587] -- 0:00:24
579500 -- [-555.962] (-557.228) (-553.601) (-556.656) * (-553.622) (-564.297) [-554.890] (-554.915) -- 0:00:24
580000 -- (-554.285) (-554.564) (-555.579) [-554.193] * (-554.798) [-554.408] (-558.736) (-556.634) -- 0:00:24
Average standard deviation of split frequencies: 0.010757
580500 -- (-554.819) (-553.957) (-557.470) [-554.615] * [-553.958] (-554.309) (-555.911) (-555.886) -- 0:00:24
581000 -- [-555.166] (-553.304) (-558.376) (-553.644) * (-555.347) (-557.493) [-554.228] (-554.274) -- 0:00:24
581500 -- (-557.079) [-553.253] (-556.407) (-563.925) * (-557.642) (-555.861) [-553.814] (-553.815) -- 0:00:24
582000 -- [-560.212] (-553.692) (-556.293) (-556.562) * (-555.187) (-554.816) [-554.026] (-554.203) -- 0:00:24
582500 -- [-554.722] (-556.085) (-554.422) (-554.217) * (-554.192) [-554.256] (-555.598) (-554.596) -- 0:00:24
583000 -- [-555.642] (-554.663) (-554.106) (-555.142) * (-556.988) (-555.462) (-553.877) [-553.091] -- 0:00:24
583500 -- (-555.664) (-555.382) (-553.066) [-554.333] * [-556.635] (-556.571) (-557.782) (-553.615) -- 0:00:24
584000 -- [-554.374] (-554.337) (-555.224) (-554.156) * (-556.378) [-554.076] (-556.029) (-554.653) -- 0:00:24
584500 -- [-554.790] (-553.022) (-555.935) (-556.483) * (-555.999) (-558.587) (-554.020) [-553.503] -- 0:00:24
585000 -- (-555.450) (-553.373) (-554.001) [-555.106] * (-556.081) [-553.739] (-553.638) (-553.460) -- 0:00:24
Average standard deviation of split frequencies: 0.011735
585500 -- (-554.302) (-553.542) (-556.104) [-553.458] * (-555.168) (-553.865) [-554.682] (-557.426) -- 0:00:24
586000 -- [-555.502] (-554.990) (-553.513) (-553.779) * (-555.328) (-553.508) (-554.676) [-555.537] -- 0:00:24
586500 -- [-555.196] (-557.165) (-554.075) (-560.139) * (-556.038) (-555.336) [-553.833] (-553.864) -- 0:00:24
587000 -- (-555.965) (-556.950) (-552.958) [-553.300] * (-555.811) (-554.252) (-555.341) [-553.628] -- 0:00:24
587500 -- [-553.074] (-554.835) (-553.743) (-555.988) * (-553.732) (-553.990) (-552.942) [-553.233] -- 0:00:24
588000 -- (-553.246) (-554.850) [-553.944] (-555.164) * (-554.860) (-555.097) (-553.833) [-554.601] -- 0:00:24
588500 -- (-555.751) (-554.738) [-554.748] (-555.788) * [-559.221] (-557.519) (-554.304) (-555.572) -- 0:00:24
589000 -- (-556.523) [-553.685] (-555.840) (-556.084) * (-561.965) (-562.097) (-555.198) [-553.875] -- 0:00:24
589500 -- [-555.498] (-554.728) (-555.518) (-557.296) * (-555.684) (-555.604) (-555.026) [-553.049] -- 0:00:24
590000 -- (-554.201) [-555.233] (-555.096) (-556.506) * (-554.174) [-556.468] (-553.744) (-556.772) -- 0:00:24
Average standard deviation of split frequencies: 0.011123
590500 -- (-554.289) [-555.586] (-554.379) (-553.884) * (-553.584) (-557.616) [-552.967] (-555.810) -- 0:00:24
591000 -- [-554.101] (-555.176) (-556.879) (-555.044) * (-554.869) [-558.463] (-554.671) (-553.073) -- 0:00:24
591500 -- [-553.041] (-555.132) (-553.512) (-554.203) * [-554.901] (-553.898) (-554.658) (-554.814) -- 0:00:24
592000 -- (-552.817) [-560.483] (-552.866) (-555.592) * (-556.321) (-554.813) [-554.730] (-556.909) -- 0:00:24
592500 -- (-555.250) (-556.194) [-555.367] (-554.767) * [-553.642] (-553.908) (-555.516) (-556.639) -- 0:00:24
593000 -- (-554.225) [-555.699] (-555.129) (-556.069) * [-556.659] (-554.833) (-553.101) (-554.242) -- 0:00:24
593500 -- (-553.557) (-557.312) [-553.193] (-554.447) * (-553.875) (-553.900) [-553.675] (-557.779) -- 0:00:23
594000 -- [-555.676] (-554.746) (-555.930) (-559.907) * [-553.548] (-555.305) (-556.400) (-561.150) -- 0:00:23
594500 -- (-556.152) (-555.901) (-556.795) [-558.152] * [-553.161] (-554.939) (-562.534) (-556.430) -- 0:00:23
595000 -- [-556.774] (-557.676) (-556.121) (-554.389) * (-552.914) (-554.486) [-555.425] (-552.956) -- 0:00:23
Average standard deviation of split frequencies: 0.011172
595500 -- (-554.338) (-553.435) [-556.291] (-553.282) * (-556.084) (-553.780) (-556.156) [-553.453] -- 0:00:23
596000 -- (-554.594) (-554.104) (-555.945) [-554.609] * [-553.420] (-555.697) (-552.996) (-559.862) -- 0:00:23
596500 -- [-556.016] (-555.672) (-554.489) (-552.804) * (-555.509) (-554.479) (-554.280) [-553.186] -- 0:00:23
597000 -- (-554.398) (-554.831) (-553.429) [-555.131] * (-554.513) (-557.665) (-554.709) [-553.011] -- 0:00:23
597500 -- (-555.523) (-553.925) [-554.086] (-555.702) * (-554.144) [-555.070] (-553.934) (-553.525) -- 0:00:23
598000 -- (-552.713) (-557.167) [-557.529] (-555.173) * [-554.096] (-559.193) (-557.460) (-553.209) -- 0:00:23
598500 -- (-552.713) (-564.972) [-553.404] (-554.439) * (-553.622) [-555.644] (-555.025) (-554.870) -- 0:00:23
599000 -- (-553.310) (-559.917) [-554.355] (-553.453) * (-556.117) (-553.815) (-554.579) [-556.181] -- 0:00:23
599500 -- (-559.974) (-557.072) [-557.927] (-553.622) * (-555.683) (-562.926) [-556.424] (-555.692) -- 0:00:23
600000 -- (-554.108) [-554.783] (-554.913) (-556.652) * (-553.964) (-555.453) [-555.900] (-556.700) -- 0:00:23
Average standard deviation of split frequencies: 0.010742
600500 -- (-554.382) (-557.432) (-555.507) [-556.707] * (-552.696) [-556.900] (-556.635) (-554.507) -- 0:00:23
601000 -- [-554.235] (-553.810) (-554.567) (-554.165) * [-558.421] (-555.818) (-557.244) (-554.404) -- 0:00:23
601500 -- (-553.785) (-554.565) [-555.176] (-554.394) * [-553.973] (-553.108) (-555.766) (-555.009) -- 0:00:23
602000 -- (-555.114) (-557.867) [-555.715] (-557.457) * [-555.559] (-553.318) (-555.714) (-554.671) -- 0:00:23
602500 -- (-556.975) [-557.662] (-557.658) (-555.183) * (-553.243) (-555.901) [-553.958] (-555.680) -- 0:00:23
603000 -- (-553.637) (-554.864) (-555.587) [-554.819] * (-554.896) (-555.912) (-553.818) [-553.219] -- 0:00:23
603500 -- [-553.109] (-562.100) (-553.873) (-556.235) * [-554.677] (-556.351) (-555.795) (-554.313) -- 0:00:23
604000 -- (-561.365) [-555.266] (-554.703) (-554.407) * [-553.994] (-556.722) (-554.800) (-555.491) -- 0:00:23
604500 -- (-553.368) [-557.408] (-554.081) (-552.923) * (-554.104) [-557.135] (-555.826) (-558.247) -- 0:00:23
605000 -- [-554.011] (-558.405) (-554.617) (-552.958) * [-553.541] (-554.136) (-559.756) (-553.461) -- 0:00:23
Average standard deviation of split frequencies: 0.010842
605500 -- (-553.176) (-554.751) [-556.076] (-553.690) * [-552.692] (-557.521) (-552.670) (-555.634) -- 0:00:23
606000 -- (-552.873) (-556.058) [-553.714] (-553.114) * (-554.144) (-553.658) (-556.263) [-554.600] -- 0:00:23
606500 -- (-562.902) (-555.151) [-553.805] (-553.331) * (-555.475) [-553.184] (-555.701) (-555.937) -- 0:00:23
607000 -- (-552.891) (-553.869) (-555.137) [-553.308] * [-554.313] (-556.990) (-554.806) (-553.133) -- 0:00:23
607500 -- (-555.250) [-555.233] (-555.767) (-555.004) * (-557.411) (-559.291) [-557.233] (-557.214) -- 0:00:23
608000 -- (-557.615) (-555.048) (-556.607) [-554.564] * (-554.318) (-555.161) [-554.081] (-554.567) -- 0:00:23
608500 -- (-555.758) (-554.033) (-556.771) [-553.370] * (-553.405) [-553.605] (-556.606) (-556.192) -- 0:00:23
609000 -- [-553.052] (-554.946) (-556.042) (-558.691) * (-554.625) [-555.722] (-557.349) (-562.606) -- 0:00:23
609500 -- (-554.735) [-554.723] (-556.179) (-556.006) * (-554.744) (-559.002) (-553.559) [-560.757] -- 0:00:23
610000 -- (-556.460) [-554.352] (-559.654) (-555.380) * [-553.217] (-557.221) (-553.833) (-555.878) -- 0:00:23
Average standard deviation of split frequencies: 0.010711
610500 -- (-552.764) (-554.286) [-557.440] (-554.350) * (-555.973) (-557.616) [-554.239] (-555.948) -- 0:00:22
611000 -- [-555.523] (-557.800) (-555.709) (-553.672) * (-556.777) (-555.903) [-555.126] (-555.933) -- 0:00:22
611500 -- (-554.790) (-555.030) [-556.776] (-554.773) * [-553.773] (-555.553) (-552.945) (-554.647) -- 0:00:22
612000 -- (-554.504) (-554.989) (-555.492) [-554.151] * (-553.875) [-553.807] (-556.191) (-554.274) -- 0:00:22
612500 -- (-553.406) (-558.906) (-553.558) [-553.783] * (-554.130) [-554.462] (-557.542) (-557.673) -- 0:00:22
613000 -- (-554.351) [-555.446] (-554.792) (-556.380) * [-553.493] (-555.868) (-556.799) (-554.318) -- 0:00:22
613500 -- (-554.284) (-553.370) [-553.543] (-553.541) * [-554.396] (-553.753) (-556.380) (-553.195) -- 0:00:22
614000 -- (-556.741) (-553.750) (-554.341) [-555.366] * (-555.001) [-553.910] (-556.357) (-553.682) -- 0:00:22
614500 -- (-553.483) (-554.132) (-554.900) [-554.455] * (-553.497) [-554.718] (-555.255) (-553.583) -- 0:00:22
615000 -- (-553.815) (-553.566) (-554.280) [-558.137] * [-558.583] (-555.021) (-555.584) (-552.836) -- 0:00:22
Average standard deviation of split frequencies: 0.010522
615500 -- (-558.328) (-553.857) (-554.712) [-557.380] * (-554.995) [-553.730] (-553.211) (-555.546) -- 0:00:22
616000 -- [-555.948] (-555.225) (-553.775) (-554.531) * (-554.477) (-556.950) (-554.416) [-553.784] -- 0:00:22
616500 -- (-554.838) (-558.304) [-555.333] (-555.081) * (-560.038) [-555.923] (-556.111) (-553.944) -- 0:00:22
617000 -- (-555.719) (-559.072) [-558.185] (-553.608) * (-553.343) (-554.185) [-554.693] (-556.907) -- 0:00:22
617500 -- (-554.471) (-555.057) (-556.115) [-555.752] * [-555.864] (-554.406) (-556.264) (-554.867) -- 0:00:22
618000 -- (-554.590) (-554.411) [-554.331] (-557.523) * (-555.874) [-555.940] (-553.116) (-554.584) -- 0:00:22
618500 -- (-554.258) (-553.738) (-555.173) [-554.077] * (-554.023) (-553.780) (-560.274) [-553.644] -- 0:00:22
619000 -- [-553.813] (-554.260) (-553.262) (-566.787) * (-552.950) (-555.153) (-558.265) [-553.517] -- 0:00:22
619500 -- (-557.562) (-553.553) [-555.694] (-554.142) * (-559.891) (-554.673) [-554.507] (-556.793) -- 0:00:22
620000 -- (-556.017) (-552.912) [-553.709] (-553.709) * (-558.074) [-553.500] (-554.435) (-555.980) -- 0:00:22
Average standard deviation of split frequencies: 0.010681
620500 -- (-555.255) [-553.514] (-557.096) (-553.761) * [-555.575] (-555.103) (-554.225) (-556.501) -- 0:00:22
621000 -- (-554.393) (-555.967) [-554.493] (-555.574) * (-555.173) (-556.012) [-554.023] (-556.766) -- 0:00:22
621500 -- (-554.544) [-555.309] (-554.602) (-555.314) * (-558.049) (-553.346) [-553.368] (-556.464) -- 0:00:22
622000 -- (-557.309) (-553.197) [-553.875] (-557.377) * [-555.585] (-554.540) (-556.628) (-563.749) -- 0:00:22
622500 -- (-558.526) (-553.153) (-558.544) [-557.770] * (-557.917) [-555.268] (-556.905) (-555.916) -- 0:00:22
623000 -- (-557.583) [-555.652] (-560.036) (-554.894) * [-554.714] (-558.706) (-555.605) (-554.635) -- 0:00:22
623500 -- (-555.042) (-553.221) (-555.352) [-555.835] * (-554.378) (-557.779) (-558.831) [-556.948] -- 0:00:22
624000 -- (-555.146) (-555.695) [-553.945] (-555.549) * [-553.893] (-555.660) (-564.723) (-555.308) -- 0:00:22
624500 -- (-555.001) [-553.439] (-553.439) (-553.892) * (-557.469) (-555.655) [-557.479] (-554.925) -- 0:00:22
625000 -- (-558.620) [-556.516] (-553.000) (-554.617) * (-559.495) (-555.392) (-554.157) [-553.149] -- 0:00:22
Average standard deviation of split frequencies: 0.010941
625500 -- (-556.601) (-556.176) (-554.703) [-554.788] * (-555.426) [-553.247] (-554.254) (-554.114) -- 0:00:22
626000 -- [-556.997] (-558.352) (-554.371) (-555.613) * (-559.722) (-554.273) (-555.235) [-556.678] -- 0:00:22
626500 -- (-554.149) [-554.114] (-555.879) (-554.485) * (-552.974) [-560.783] (-555.983) (-554.100) -- 0:00:22
627000 -- [-554.028] (-556.599) (-558.261) (-552.939) * [-557.057] (-554.919) (-553.547) (-554.463) -- 0:00:22
627500 -- (-555.538) (-561.960) (-554.670) [-553.925] * (-553.720) (-553.900) [-555.711] (-557.389) -- 0:00:21
628000 -- (-555.085) [-555.520] (-557.857) (-552.952) * [-558.967] (-554.189) (-553.201) (-553.904) -- 0:00:21
628500 -- [-554.709] (-554.376) (-556.000) (-554.543) * [-558.697] (-558.179) (-553.999) (-554.217) -- 0:00:21
629000 -- (-553.731) (-558.343) (-555.523) [-553.250] * (-556.220) (-553.230) (-555.897) [-553.844] -- 0:00:21
629500 -- (-555.045) (-555.736) (-554.783) [-553.989] * [-555.212] (-556.891) (-557.257) (-557.301) -- 0:00:21
630000 -- [-554.138] (-553.456) (-554.108) (-553.379) * (-556.518) (-557.463) (-559.109) [-558.577] -- 0:00:21
Average standard deviation of split frequencies: 0.011025
630500 -- [-556.304] (-555.819) (-553.648) (-554.907) * (-557.721) (-554.287) [-556.007] (-554.313) -- 0:00:21
631000 -- (-555.490) [-555.358] (-553.819) (-556.971) * (-554.353) (-554.730) [-557.414] (-554.908) -- 0:00:21
631500 -- [-554.350] (-559.773) (-553.259) (-555.602) * (-553.514) (-558.015) (-555.790) [-555.763] -- 0:00:21
632000 -- (-558.008) [-554.823] (-553.604) (-554.295) * (-554.739) [-553.229] (-555.507) (-558.439) -- 0:00:21
632500 -- (-555.965) (-556.753) (-553.443) [-555.918] * (-557.152) [-554.803] (-553.454) (-555.039) -- 0:00:21
633000 -- (-555.178) (-554.187) (-556.040) [-554.306] * (-558.148) (-555.219) (-555.727) [-554.072] -- 0:00:21
633500 -- (-554.114) (-561.359) (-559.672) [-553.283] * (-555.361) [-555.455] (-555.980) (-554.435) -- 0:00:21
634000 -- [-554.628] (-561.629) (-556.335) (-554.405) * (-555.646) (-555.024) [-553.363] (-554.185) -- 0:00:21
634500 -- (-559.540) (-563.964) [-556.491] (-556.478) * (-557.570) (-554.787) [-555.539] (-553.787) -- 0:00:21
635000 -- (-553.479) [-558.834] (-556.739) (-554.871) * (-555.628) (-553.377) (-554.263) [-556.018] -- 0:00:21
Average standard deviation of split frequencies: 0.011072
635500 -- [-552.760] (-555.514) (-556.976) (-557.351) * (-553.868) [-553.408] (-557.671) (-555.189) -- 0:00:21
636000 -- (-554.389) (-558.816) (-556.215) [-554.491] * (-556.108) [-554.646] (-556.895) (-555.390) -- 0:00:21
636500 -- (-554.635) (-557.404) [-555.110] (-552.914) * (-555.944) (-554.399) (-553.728) [-555.388] -- 0:00:21
637000 -- (-554.935) (-555.401) [-555.201] (-553.996) * (-559.254) (-554.973) [-554.390] (-554.111) -- 0:00:21
637500 -- (-555.065) [-553.937] (-553.644) (-553.221) * [-554.749] (-554.411) (-554.010) (-554.198) -- 0:00:21
638000 -- (-557.322) (-559.762) (-553.308) [-554.986] * (-555.376) [-554.097] (-556.420) (-554.877) -- 0:00:21
638500 -- [-555.276] (-554.533) (-556.143) (-553.796) * [-554.226] (-554.609) (-554.981) (-553.404) -- 0:00:21
639000 -- [-554.180] (-556.152) (-556.276) (-553.954) * (-553.734) [-554.934] (-554.192) (-555.427) -- 0:00:21
639500 -- [-563.238] (-556.265) (-552.857) (-556.147) * (-554.075) (-554.269) [-553.700] (-557.848) -- 0:00:21
640000 -- (-554.730) (-555.819) (-552.695) [-556.747] * [-555.416] (-554.558) (-553.568) (-555.408) -- 0:00:21
Average standard deviation of split frequencies: 0.011221
640500 -- (-555.080) (-555.785) (-553.232) [-554.485] * (-555.033) [-555.536] (-557.706) (-554.149) -- 0:00:21
641000 -- (-554.093) [-554.065] (-555.799) (-556.090) * (-554.093) (-557.840) [-556.163] (-554.023) -- 0:00:21
641500 -- (-555.396) [-553.914] (-555.655) (-554.684) * (-553.291) (-560.330) (-556.902) [-553.041] -- 0:00:21
642000 -- [-557.085] (-558.048) (-558.231) (-556.184) * (-554.029) (-553.154) [-553.886] (-554.243) -- 0:00:21
642500 -- [-555.555] (-555.418) (-554.601) (-554.117) * (-556.227) [-555.348] (-559.248) (-557.091) -- 0:00:21
643000 -- (-553.639) [-553.008] (-555.684) (-556.731) * (-557.266) (-554.684) [-556.185] (-556.236) -- 0:00:21
643500 -- [-557.810] (-553.417) (-554.737) (-554.316) * (-556.444) [-555.500] (-558.993) (-554.254) -- 0:00:21
644000 -- (-557.313) (-553.465) (-554.861) [-554.816] * (-554.046) (-558.107) [-552.770] (-553.298) -- 0:00:21
644500 -- (-556.992) [-554.062] (-556.850) (-555.255) * (-556.641) (-553.054) (-554.656) [-558.405] -- 0:00:20
645000 -- (-554.351) (-555.636) (-554.400) [-552.970] * (-556.889) (-556.163) (-556.158) [-555.831] -- 0:00:20
Average standard deviation of split frequencies: 0.010989
645500 -- [-555.436] (-554.776) (-555.616) (-553.138) * (-558.753) [-552.773] (-558.704) (-554.172) -- 0:00:20
646000 -- (-553.756) (-553.711) [-554.542] (-555.539) * [-557.296] (-553.260) (-554.228) (-554.175) -- 0:00:20
646500 -- (-555.832) [-559.440] (-554.932) (-554.242) * [-554.240] (-562.376) (-553.376) (-553.557) -- 0:00:20
647000 -- (-556.304) [-553.667] (-554.695) (-554.124) * (-558.858) (-560.220) (-557.807) [-555.094] -- 0:00:20
647500 -- (-559.636) (-556.434) (-555.173) [-554.971] * (-552.838) (-560.882) [-555.712] (-554.242) -- 0:00:20
648000 -- (-555.582) [-553.244] (-556.310) (-554.981) * (-553.388) [-557.770] (-554.886) (-555.846) -- 0:00:20
648500 -- (-556.592) (-556.108) [-555.101] (-554.186) * (-555.786) (-557.351) [-552.703] (-554.969) -- 0:00:20
649000 -- [-560.921] (-554.023) (-554.519) (-558.642) * (-554.699) (-554.366) (-555.956) [-556.157] -- 0:00:20
649500 -- (-556.992) (-555.925) (-555.324) [-559.339] * [-554.475] (-553.877) (-556.650) (-554.086) -- 0:00:20
650000 -- (-557.479) [-556.199] (-554.758) (-559.308) * [-556.233] (-553.630) (-553.625) (-557.050) -- 0:00:20
Average standard deviation of split frequencies: 0.010910
650500 -- (-555.873) (-554.572) (-554.415) [-558.957] * [-554.270] (-553.591) (-553.433) (-557.755) -- 0:00:20
651000 -- [-557.004] (-553.186) (-553.791) (-558.618) * (-554.326) (-558.112) [-555.197] (-557.419) -- 0:00:20
651500 -- (-554.142) [-553.393] (-554.023) (-557.082) * (-555.614) [-558.544] (-554.530) (-554.590) -- 0:00:20
652000 -- [-554.978] (-557.449) (-554.175) (-554.443) * (-555.280) [-554.280] (-553.542) (-557.625) -- 0:00:20
652500 -- (-562.630) (-554.674) [-553.268] (-556.413) * (-554.916) (-555.066) (-555.177) [-554.520] -- 0:00:20
653000 -- (-557.265) (-558.500) [-556.161] (-555.950) * (-557.316) (-556.872) [-553.234] (-554.586) -- 0:00:20
653500 -- [-552.782] (-559.863) (-555.030) (-554.168) * (-555.549) (-553.514) [-556.877] (-556.125) -- 0:00:20
654000 -- (-556.858) (-558.293) (-554.165) [-554.477] * (-553.516) (-553.593) (-553.919) [-553.122] -- 0:00:20
654500 -- (-554.081) (-554.195) (-554.375) [-556.742] * (-553.831) (-553.400) [-556.962] (-552.851) -- 0:00:20
655000 -- (-555.333) [-553.630] (-554.070) (-557.042) * [-555.070] (-554.173) (-556.268) (-556.676) -- 0:00:20
Average standard deviation of split frequencies: 0.011408
655500 -- (-554.933) [-553.754] (-555.913) (-553.922) * [-554.649] (-555.252) (-554.080) (-558.142) -- 0:00:20
656000 -- (-555.888) (-553.137) [-553.611] (-553.884) * [-554.246] (-557.153) (-552.836) (-556.061) -- 0:00:20
656500 -- (-555.176) (-555.174) [-553.516] (-554.161) * [-555.855] (-553.596) (-555.502) (-552.793) -- 0:00:20
657000 -- [-561.844] (-555.256) (-557.102) (-553.497) * (-563.001) [-554.096] (-554.424) (-555.264) -- 0:00:20
657500 -- (-554.691) (-558.888) (-554.890) [-554.699] * [-556.294] (-553.526) (-557.118) (-553.190) -- 0:00:20
658000 -- (-554.864) [-554.781] (-553.965) (-553.349) * (-553.443) [-554.776] (-555.178) (-554.647) -- 0:00:20
658500 -- (-554.649) (-557.596) [-554.659] (-553.455) * (-560.334) [-557.060] (-555.478) (-561.593) -- 0:00:20
659000 -- (-554.645) (-555.005) [-554.911] (-557.131) * (-558.559) [-555.941] (-556.603) (-562.937) -- 0:00:20
659500 -- [-556.384] (-555.708) (-553.065) (-555.285) * (-556.288) [-553.807] (-556.388) (-555.968) -- 0:00:20
660000 -- (-556.043) [-555.598] (-556.142) (-553.701) * (-556.620) [-555.918] (-553.545) (-554.604) -- 0:00:20
Average standard deviation of split frequencies: 0.011729
660500 -- (-555.257) [-561.502] (-558.808) (-556.164) * (-553.656) (-562.107) [-554.124] (-557.471) -- 0:00:20
661000 -- [-555.112] (-554.676) (-553.945) (-554.501) * (-556.433) (-553.308) (-554.858) [-555.936] -- 0:00:20
661500 -- (-554.583) (-554.379) (-556.606) [-556.412] * [-553.815] (-553.321) (-554.262) (-558.963) -- 0:00:19
662000 -- (-553.920) [-554.659] (-559.607) (-554.020) * (-555.839) [-553.120] (-553.082) (-554.910) -- 0:00:19
662500 -- (-553.244) [-553.714] (-555.249) (-560.532) * (-554.425) (-555.306) [-556.457] (-558.754) -- 0:00:19
663000 -- (-553.325) (-554.326) (-555.418) [-553.536] * (-554.764) [-557.204] (-556.980) (-559.918) -- 0:00:19
663500 -- (-553.343) (-555.346) [-558.621] (-553.439) * (-554.854) (-556.440) [-555.726] (-552.986) -- 0:00:19
664000 -- (-554.725) [-554.312] (-555.430) (-555.149) * (-555.425) (-558.436) (-553.488) [-553.554] -- 0:00:19
664500 -- [-555.533] (-553.869) (-554.374) (-553.945) * [-553.206] (-557.794) (-555.460) (-558.255) -- 0:00:19
665000 -- [-555.664] (-553.865) (-552.670) (-553.623) * [-554.361] (-559.251) (-555.651) (-555.350) -- 0:00:19
Average standard deviation of split frequencies: 0.011950
665500 -- (-553.131) [-555.424] (-559.040) (-554.091) * (-554.114) [-554.617] (-553.976) (-558.488) -- 0:00:19
666000 -- [-555.321] (-557.055) (-554.464) (-555.574) * (-554.114) (-554.867) [-554.070] (-556.167) -- 0:00:19
666500 -- (-553.773) [-556.687] (-554.125) (-552.922) * [-556.224] (-554.981) (-554.649) (-554.921) -- 0:00:19
667000 -- [-552.926] (-553.758) (-554.032) (-557.272) * [-556.820] (-554.686) (-555.924) (-554.893) -- 0:00:19
667500 -- (-554.008) [-556.588] (-553.989) (-559.105) * (-555.005) [-553.972] (-554.032) (-554.283) -- 0:00:19
668000 -- (-556.459) (-556.234) (-556.142) [-554.584] * [-555.197] (-554.213) (-555.243) (-561.315) -- 0:00:19
668500 -- (-555.739) [-553.872] (-558.358) (-555.315) * (-555.372) [-555.591] (-553.347) (-557.456) -- 0:00:19
669000 -- (-555.671) (-553.184) [-553.264] (-554.683) * [-555.385] (-553.983) (-555.885) (-555.957) -- 0:00:19
669500 -- (-557.037) (-553.779) (-553.556) [-554.035] * (-554.407) [-554.727] (-554.037) (-555.646) -- 0:00:19
670000 -- (-554.319) [-554.474] (-553.669) (-556.836) * (-554.056) (-555.260) [-557.156] (-554.979) -- 0:00:19
Average standard deviation of split frequencies: 0.011949
670500 -- (-554.452) [-555.646] (-558.105) (-555.838) * (-553.898) [-554.583] (-555.378) (-557.433) -- 0:00:19
671000 -- (-554.226) (-557.241) [-554.514] (-560.686) * (-554.797) (-554.326) [-555.139] (-558.394) -- 0:00:19
671500 -- (-553.979) [-554.403] (-554.223) (-554.124) * [-553.419] (-554.076) (-553.581) (-556.930) -- 0:00:19
672000 -- (-554.712) (-556.468) (-555.664) [-555.061] * [-553.247] (-554.137) (-555.432) (-554.728) -- 0:00:19
672500 -- (-554.746) (-558.967) [-555.271] (-555.242) * (-553.694) (-553.952) [-555.354] (-554.148) -- 0:00:19
673000 -- [-556.428] (-554.498) (-554.392) (-554.980) * (-555.536) (-559.693) [-555.343] (-553.126) -- 0:00:19
673500 -- (-553.858) [-554.373] (-554.380) (-553.219) * (-560.418) (-558.428) (-559.208) [-555.344] -- 0:00:19
674000 -- [-553.781] (-557.166) (-555.264) (-553.613) * (-557.645) [-555.724] (-557.495) (-557.426) -- 0:00:19
674500 -- (-557.371) (-560.015) [-555.808] (-554.018) * (-556.548) (-557.312) (-556.997) [-553.390] -- 0:00:19
675000 -- (-554.429) (-557.223) (-554.179) [-556.007] * [-556.517] (-554.572) (-557.642) (-555.911) -- 0:00:19
Average standard deviation of split frequencies: 0.011568
675500 -- (-556.089) (-553.883) [-552.870] (-553.912) * [-553.167] (-553.139) (-556.238) (-558.147) -- 0:00:19
676000 -- (-555.637) (-554.802) [-553.646] (-559.025) * (-556.330) (-556.220) (-554.664) [-554.054] -- 0:00:19
676500 -- (-556.065) [-558.986] (-553.394) (-559.049) * [-553.788] (-554.393) (-557.330) (-553.843) -- 0:00:19
677000 -- (-553.884) [-554.707] (-554.382) (-554.348) * [-553.622] (-554.967) (-556.011) (-554.637) -- 0:00:19
677500 -- (-555.067) [-557.139] (-555.091) (-560.502) * (-555.414) (-555.643) (-556.024) [-558.062] -- 0:00:19
678000 -- (-556.655) (-559.071) (-555.739) [-555.776] * (-554.970) (-555.271) [-558.826] (-558.146) -- 0:00:18
678500 -- (-563.378) [-558.271] (-555.925) (-554.368) * (-554.035) [-554.008] (-556.371) (-557.110) -- 0:00:18
679000 -- (-558.572) (-555.717) [-556.407] (-556.390) * (-555.013) (-556.704) [-554.508] (-553.631) -- 0:00:18
679500 -- (-555.786) (-555.101) [-553.542] (-558.095) * (-553.754) (-553.159) [-556.058] (-554.570) -- 0:00:18
680000 -- [-556.746] (-556.055) (-554.011) (-556.084) * [-553.592] (-564.348) (-556.081) (-554.162) -- 0:00:18
Average standard deviation of split frequencies: 0.011427
680500 -- (-553.896) (-554.972) (-556.523) [-556.643] * [-553.632] (-560.252) (-559.798) (-556.940) -- 0:00:18
681000 -- [-553.564] (-554.451) (-555.957) (-555.108) * (-555.543) (-554.257) (-555.884) [-555.848] -- 0:00:18
681500 -- (-553.591) [-554.477] (-554.031) (-558.722) * (-554.686) (-555.981) (-554.195) [-560.068] -- 0:00:18
682000 -- (-553.054) (-554.374) [-555.255] (-556.530) * [-555.081] (-554.438) (-557.522) (-553.358) -- 0:00:18
682500 -- [-552.760] (-554.266) (-558.483) (-554.093) * (-555.584) [-554.736] (-556.516) (-554.309) -- 0:00:18
683000 -- (-552.847) (-554.654) (-558.794) [-554.266] * [-554.333] (-554.455) (-554.808) (-553.968) -- 0:00:18
683500 -- (-552.886) (-558.190) (-556.731) [-552.678] * (-553.702) [-556.772] (-555.871) (-555.193) -- 0:00:18
684000 -- (-555.637) [-554.020] (-554.492) (-556.500) * (-557.974) [-555.204] (-563.379) (-558.983) -- 0:00:18
684500 -- (-553.664) [-554.040] (-554.151) (-555.867) * [-554.675] (-560.125) (-554.945) (-556.588) -- 0:00:18
685000 -- [-553.120] (-554.619) (-554.272) (-554.001) * [-555.587] (-555.583) (-555.505) (-555.348) -- 0:00:18
Average standard deviation of split frequencies: 0.011965
685500 -- [-553.924] (-555.311) (-555.420) (-554.302) * [-555.313] (-560.150) (-552.942) (-554.063) -- 0:00:18
686000 -- (-553.227) (-555.562) (-556.966) [-553.787] * (-557.553) (-554.122) (-556.081) [-554.813] -- 0:00:18
686500 -- (-553.853) [-556.346] (-554.023) (-556.044) * [-556.563] (-555.166) (-557.630) (-555.048) -- 0:00:18
687000 -- [-553.919] (-554.421) (-553.969) (-553.974) * (-554.041) (-554.334) (-554.047) [-553.469] -- 0:00:18
687500 -- (-553.475) [-553.431] (-556.239) (-554.881) * (-554.990) (-554.644) [-553.105] (-559.420) -- 0:00:18
688000 -- [-553.956] (-553.633) (-553.725) (-556.573) * (-554.044) (-555.243) [-553.855] (-557.432) -- 0:00:18
688500 -- (-554.526) (-554.691) [-555.485] (-558.187) * (-556.545) [-557.865] (-554.034) (-563.404) -- 0:00:18
689000 -- (-554.917) [-553.276] (-558.833) (-557.905) * (-554.124) (-555.370) (-555.368) [-554.983] -- 0:00:18
689500 -- (-554.920) (-553.834) (-556.090) [-558.290] * (-559.294) [-554.185] (-555.269) (-555.452) -- 0:00:18
690000 -- (-555.355) (-554.246) [-556.529] (-558.573) * (-556.381) [-553.414] (-559.380) (-555.457) -- 0:00:18
Average standard deviation of split frequencies: 0.012486
690500 -- (-554.358) (-556.556) [-555.658] (-556.014) * [-554.309] (-554.549) (-555.885) (-554.199) -- 0:00:18
691000 -- (-555.477) [-553.164] (-554.884) (-557.584) * [-555.423] (-554.956) (-556.455) (-554.861) -- 0:00:18
691500 -- (-556.830) [-553.153] (-554.372) (-557.826) * (-555.256) [-555.540] (-553.401) (-557.764) -- 0:00:18
692000 -- (-558.230) (-555.785) [-555.146] (-557.658) * [-558.936] (-554.046) (-558.625) (-558.114) -- 0:00:18
692500 -- (-556.603) (-559.061) [-554.754] (-558.627) * (-555.331) (-554.176) [-557.956] (-555.112) -- 0:00:18
693000 -- (-553.989) (-556.428) [-557.327] (-555.805) * [-554.247] (-554.091) (-552.587) (-553.557) -- 0:00:18
693500 -- (-556.096) [-554.223] (-553.368) (-553.595) * (-554.447) [-553.452] (-553.480) (-554.344) -- 0:00:18
694000 -- (-556.306) [-553.581] (-554.912) (-554.916) * (-553.262) (-554.787) [-556.574] (-554.248) -- 0:00:18
694500 -- (-556.820) (-554.543) (-554.486) [-553.335] * (-552.946) (-554.188) [-562.293] (-555.155) -- 0:00:18
695000 -- [-555.231] (-557.550) (-553.961) (-553.583) * [-554.164] (-554.499) (-555.583) (-554.513) -- 0:00:17
Average standard deviation of split frequencies: 0.012431
695500 -- [-562.513] (-559.370) (-553.796) (-558.807) * [-557.018] (-554.887) (-553.415) (-555.394) -- 0:00:17
696000 -- (-555.020) (-558.364) [-555.048] (-554.626) * (-564.647) (-555.340) (-557.255) [-554.716] -- 0:00:17
696500 -- (-555.889) (-556.117) [-557.449] (-553.536) * (-556.729) [-554.520] (-554.946) (-553.784) -- 0:00:17
697000 -- (-558.571) [-557.512] (-555.730) (-553.737) * (-553.130) [-555.359] (-557.460) (-553.692) -- 0:00:17
697500 -- (-555.558) (-557.289) [-555.268] (-553.427) * (-555.497) [-553.885] (-555.564) (-557.811) -- 0:00:17
698000 -- (-553.995) (-553.865) [-554.134] (-557.268) * [-554.203] (-554.295) (-556.762) (-558.711) -- 0:00:17
698500 -- [-558.320] (-555.057) (-557.736) (-553.691) * (-553.716) (-555.623) (-554.175) [-559.062] -- 0:00:17
699000 -- (-555.045) (-553.267) [-556.693] (-555.107) * [-555.310] (-555.489) (-555.995) (-554.567) -- 0:00:17
699500 -- (-555.295) (-555.273) (-558.097) [-555.856] * (-552.822) (-556.965) (-553.902) [-553.566] -- 0:00:17
700000 -- (-554.477) (-557.930) (-558.194) [-556.784] * (-556.812) (-558.797) (-555.754) [-553.546] -- 0:00:17
Average standard deviation of split frequencies: 0.011648
700500 -- (-553.998) [-558.982] (-556.555) (-552.929) * [-555.670] (-553.753) (-557.688) (-558.056) -- 0:00:17
701000 -- (-555.932) (-553.453) [-557.104] (-554.632) * [-554.671] (-556.585) (-554.754) (-554.510) -- 0:00:17
701500 -- (-555.130) (-554.154) (-555.167) [-555.178] * (-555.747) [-555.062] (-553.750) (-553.879) -- 0:00:17
702000 -- (-555.684) (-554.150) [-554.700] (-553.073) * (-554.832) (-553.307) (-554.610) [-553.493] -- 0:00:17
702500 -- (-554.190) (-553.528) [-554.521] (-554.556) * (-556.057) (-555.252) [-560.325] (-553.316) -- 0:00:17
703000 -- (-555.024) [-554.272] (-555.196) (-555.345) * (-558.639) (-556.235) [-557.160] (-556.693) -- 0:00:17
703500 -- (-555.469) (-554.055) [-554.853] (-555.988) * (-555.469) [-555.130] (-555.115) (-557.265) -- 0:00:17
704000 -- (-556.911) [-554.996] (-555.390) (-557.122) * (-554.955) [-555.456] (-556.742) (-562.528) -- 0:00:17
704500 -- (-554.314) (-553.745) (-560.698) [-555.139] * [-553.278] (-553.908) (-554.986) (-560.343) -- 0:00:17
705000 -- [-552.968] (-555.326) (-558.546) (-557.871) * [-556.025] (-554.764) (-557.070) (-554.118) -- 0:00:17
Average standard deviation of split frequencies: 0.012804
705500 -- (-553.395) (-560.173) (-556.333) [-555.513] * (-556.903) (-555.968) (-557.054) [-552.848] -- 0:00:17
706000 -- (-555.154) [-559.348] (-559.174) (-555.266) * [-556.190] (-556.618) (-555.169) (-552.948) -- 0:00:17
706500 -- (-555.250) (-559.182) (-555.924) [-555.057] * (-556.024) (-554.036) [-555.034] (-553.134) -- 0:00:17
707000 -- (-556.413) [-555.456] (-555.588) (-555.875) * [-556.310] (-558.029) (-555.192) (-553.417) -- 0:00:17
707500 -- (-555.257) (-552.795) (-553.220) [-554.397] * [-555.328] (-557.236) (-553.419) (-556.027) -- 0:00:17
708000 -- (-554.913) [-554.798] (-554.298) (-555.436) * [-553.621] (-556.599) (-554.300) (-555.182) -- 0:00:17
708500 -- [-554.323] (-554.649) (-552.817) (-561.847) * (-553.375) [-555.011] (-554.893) (-553.165) -- 0:00:17
709000 -- (-555.633) [-557.084] (-553.841) (-554.762) * (-557.269) [-553.881] (-554.721) (-558.569) -- 0:00:17
709500 -- (-554.241) (-559.739) (-554.911) [-553.372] * (-556.859) (-552.961) [-554.103] (-554.473) -- 0:00:17
710000 -- [-554.229] (-554.334) (-554.253) (-554.624) * [-553.264] (-554.909) (-558.269) (-556.991) -- 0:00:17
Average standard deviation of split frequencies: 0.012096
710500 -- (-553.947) (-556.996) (-555.002) [-555.063] * (-554.064) [-554.549] (-554.866) (-554.259) -- 0:00:17
711000 -- (-555.859) [-556.323] (-557.636) (-558.451) * (-563.536) [-554.424] (-554.707) (-553.130) -- 0:00:17
711500 -- (-553.892) [-554.397] (-554.029) (-555.429) * [-554.873] (-552.842) (-558.917) (-554.762) -- 0:00:17
712000 -- (-554.897) (-554.104) [-553.476] (-553.627) * [-553.168] (-553.703) (-555.977) (-555.295) -- 0:00:16
712500 -- (-555.348) (-554.374) (-553.358) [-554.778] * (-553.908) (-554.088) [-554.861] (-555.577) -- 0:00:16
713000 -- (-558.740) [-557.105] (-553.879) (-556.085) * (-553.126) [-558.217] (-556.017) (-556.094) -- 0:00:16
713500 -- (-553.940) (-553.159) [-556.918] (-553.849) * (-555.565) (-560.162) (-560.060) [-553.183] -- 0:00:16
714000 -- (-554.097) (-553.843) [-555.356] (-553.116) * (-558.417) (-559.514) (-560.711) [-553.093] -- 0:00:16
714500 -- (-553.081) (-553.275) [-555.464] (-554.253) * [-554.536] (-558.635) (-557.625) (-555.597) -- 0:00:16
715000 -- (-553.556) (-555.380) (-554.950) [-553.640] * (-554.125) [-557.316] (-553.759) (-556.842) -- 0:00:16
Average standard deviation of split frequencies: 0.011686
715500 -- (-553.796) (-554.574) (-554.738) [-555.230] * (-554.606) [-555.617] (-553.010) (-556.827) -- 0:00:16
716000 -- (-553.785) (-556.874) [-556.437] (-554.253) * (-554.903) (-555.922) (-553.066) [-556.203] -- 0:00:16
716500 -- (-554.551) (-556.062) [-556.338] (-553.729) * (-554.804) (-558.125) [-553.710] (-554.662) -- 0:00:16
717000 -- (-557.348) (-558.815) [-560.212] (-553.428) * (-555.810) [-558.745] (-557.442) (-553.492) -- 0:00:16
717500 -- (-559.177) [-554.471] (-557.080) (-560.032) * [-556.392] (-557.934) (-553.415) (-554.458) -- 0:00:16
718000 -- (-562.251) [-553.142] (-555.717) (-559.995) * (-555.295) [-556.651] (-554.181) (-555.180) -- 0:00:16
718500 -- [-554.761] (-553.982) (-554.355) (-555.860) * (-552.748) (-553.381) [-553.913] (-560.353) -- 0:00:16
719000 -- (-554.035) (-553.940) [-556.942] (-556.877) * (-553.794) (-555.298) (-557.537) [-557.019] -- 0:00:16
719500 -- (-558.235) [-555.330] (-554.660) (-561.641) * (-553.417) [-554.801] (-555.216) (-557.163) -- 0:00:16
720000 -- [-553.609] (-555.288) (-557.035) (-554.872) * [-553.931] (-556.102) (-555.262) (-559.335) -- 0:00:16
Average standard deviation of split frequencies: 0.012224
720500 -- (-553.610) (-556.355) (-559.514) [-554.136] * (-553.257) [-555.163] (-557.145) (-553.268) -- 0:00:16
721000 -- (-556.683) (-556.122) (-554.083) [-555.108] * (-553.594) [-558.329] (-554.912) (-553.961) -- 0:00:16
721500 -- (-554.579) (-558.522) (-553.634) [-556.960] * (-555.597) [-553.521] (-555.503) (-555.823) -- 0:00:16
722000 -- (-556.499) (-558.430) (-553.679) [-553.787] * (-554.352) (-558.524) [-554.482] (-553.774) -- 0:00:16
722500 -- [-559.396] (-554.970) (-554.825) (-554.032) * (-554.920) (-554.626) (-554.804) [-553.451] -- 0:00:16
723000 -- (-555.222) (-555.412) (-556.671) [-554.995] * (-555.712) (-557.313) [-553.565] (-555.550) -- 0:00:16
723500 -- (-553.925) (-556.325) [-554.340] (-555.244) * [-553.148] (-558.235) (-554.352) (-552.641) -- 0:00:16
724000 -- (-558.053) [-555.495] (-553.978) (-554.595) * [-554.924] (-559.193) (-553.321) (-556.796) -- 0:00:16
724500 -- (-555.026) (-560.233) [-558.080] (-555.913) * (-554.506) (-559.135) (-553.902) [-555.166] -- 0:00:16
725000 -- (-553.336) (-556.586) (-559.058) [-555.061] * (-554.868) (-556.543) [-553.977] (-554.467) -- 0:00:16
Average standard deviation of split frequencies: 0.012743
725500 -- (-555.353) (-555.339) (-554.941) [-553.925] * (-553.040) (-554.993) (-554.608) [-556.516] -- 0:00:16
726000 -- [-554.752] (-554.062) (-553.564) (-554.449) * (-553.046) (-555.790) (-555.999) [-554.127] -- 0:00:16
726500 -- (-555.445) (-554.300) (-554.136) [-556.155] * [-552.695] (-554.184) (-555.620) (-554.235) -- 0:00:16
727000 -- (-553.355) [-553.746] (-556.199) (-554.090) * (-555.892) [-554.239] (-554.315) (-554.829) -- 0:00:16
727500 -- (-553.740) (-555.864) [-553.879] (-556.811) * [-553.963] (-552.976) (-555.473) (-552.930) -- 0:00:16
728000 -- (-554.924) (-553.992) [-553.878] (-554.075) * (-554.577) [-554.714] (-558.640) (-553.577) -- 0:00:16
728500 -- (-555.617) (-556.426) [-553.930] (-555.025) * (-554.785) [-553.795] (-556.510) (-554.600) -- 0:00:16
729000 -- (-554.127) [-555.042] (-554.721) (-555.634) * [-556.315] (-557.931) (-554.802) (-554.596) -- 0:00:15
729500 -- (-554.662) (-556.236) (-554.793) [-554.056] * [-554.667] (-555.461) (-553.695) (-556.021) -- 0:00:15
730000 -- (-554.417) (-554.838) [-554.948] (-554.564) * (-556.552) (-556.673) [-555.493] (-560.016) -- 0:00:15
Average standard deviation of split frequencies: 0.012621
730500 -- (-557.178) [-553.464] (-554.343) (-554.355) * (-552.873) [-553.332] (-554.020) (-558.493) -- 0:00:15
731000 -- (-557.495) [-553.230] (-553.299) (-554.377) * (-553.630) (-558.325) [-555.742] (-558.395) -- 0:00:15
731500 -- (-556.597) (-553.573) [-554.685] (-554.641) * (-553.963) (-554.366) (-553.602) [-553.890] -- 0:00:15
732000 -- [-559.107] (-553.629) (-557.644) (-555.034) * (-553.262) (-559.895) [-554.580] (-557.235) -- 0:00:15
732500 -- (-558.794) [-554.980] (-560.595) (-555.569) * [-555.177] (-553.766) (-559.630) (-555.817) -- 0:00:15
733000 -- (-553.681) [-554.806] (-555.638) (-554.366) * (-557.295) [-554.364] (-554.135) (-556.468) -- 0:00:15
733500 -- (-556.454) (-554.896) [-554.153] (-554.339) * [-556.813] (-554.427) (-555.385) (-560.600) -- 0:00:15
734000 -- [-556.419] (-553.969) (-554.063) (-554.024) * (-553.771) [-553.661] (-559.227) (-554.034) -- 0:00:15
734500 -- (-558.093) [-553.103] (-555.646) (-556.026) * (-555.917) (-554.706) (-561.852) [-561.650] -- 0:00:15
735000 -- [-558.503] (-554.957) (-555.980) (-554.671) * [-556.774] (-553.405) (-556.152) (-555.321) -- 0:00:15
Average standard deviation of split frequencies: 0.013050
735500 -- (-556.133) (-553.670) [-556.547] (-554.588) * [-553.736] (-553.531) (-553.489) (-555.756) -- 0:00:15
736000 -- (-554.753) (-553.831) [-554.259] (-555.921) * (-559.746) (-553.699) [-553.237] (-554.468) -- 0:00:15
736500 -- (-553.835) (-556.619) (-554.289) [-555.010] * (-555.568) [-556.132] (-553.238) (-557.697) -- 0:00:15
737000 -- (-553.919) [-555.931] (-555.800) (-554.823) * (-554.335) (-555.818) [-553.646] (-553.378) -- 0:00:15
737500 -- (-557.671) (-553.805) [-552.991] (-554.918) * [-557.062] (-554.272) (-553.900) (-554.482) -- 0:00:15
738000 -- (-559.630) [-553.679] (-554.887) (-553.253) * (-556.854) [-553.418] (-556.744) (-554.908) -- 0:00:15
738500 -- (-554.894) (-554.207) (-554.887) [-553.268] * [-554.496] (-557.247) (-556.745) (-553.851) -- 0:00:15
739000 -- (-555.346) [-553.069] (-555.348) (-553.317) * (-556.759) (-553.062) (-555.744) [-554.021] -- 0:00:15
739500 -- (-556.367) [-553.390] (-556.176) (-555.257) * (-558.814) [-555.117] (-553.888) (-558.733) -- 0:00:15
740000 -- (-553.577) (-557.833) [-555.783] (-553.607) * (-555.657) (-554.959) (-553.486) [-554.733] -- 0:00:15
Average standard deviation of split frequencies: 0.012769
740500 -- (-555.675) (-556.806) (-554.397) [-555.009] * (-553.764) (-556.572) (-554.468) [-553.133] -- 0:00:15
741000 -- (-553.178) (-555.614) [-553.543] (-556.419) * (-554.775) (-554.480) [-554.187] (-555.928) -- 0:00:15
741500 -- [-553.145] (-553.610) (-553.673) (-558.382) * (-554.109) [-554.207] (-554.869) (-554.408) -- 0:00:15
742000 -- (-554.650) (-555.837) [-560.111] (-557.075) * (-557.960) [-553.557] (-554.993) (-554.441) -- 0:00:15
742500 -- (-559.385) (-554.037) [-555.711] (-552.790) * (-554.376) (-553.558) [-554.276] (-555.572) -- 0:00:15
743000 -- (-556.770) (-554.332) (-559.328) [-554.451] * (-553.511) (-554.442) [-553.218] (-555.852) -- 0:00:15
743500 -- (-556.822) (-555.093) (-558.968) [-555.005] * (-558.501) [-552.933] (-553.188) (-553.984) -- 0:00:15
744000 -- (-555.415) (-554.361) (-553.722) [-559.889] * (-557.553) (-552.913) [-556.788] (-557.256) -- 0:00:15
744500 -- [-553.979] (-554.131) (-554.271) (-555.734) * (-557.138) [-553.532] (-555.115) (-554.008) -- 0:00:15
745000 -- [-554.281] (-554.375) (-555.921) (-556.469) * (-552.649) [-553.288] (-555.080) (-554.377) -- 0:00:15
Average standard deviation of split frequencies: 0.012717
745500 -- (-568.203) (-554.728) [-553.385] (-557.614) * (-553.702) [-554.573] (-553.253) (-561.352) -- 0:00:15
746000 -- (-557.542) (-554.569) [-556.587] (-556.006) * (-553.722) [-552.843] (-553.712) (-557.656) -- 0:00:14
746500 -- (-560.203) (-557.604) (-554.040) [-555.105] * (-557.027) [-556.147] (-555.722) (-559.255) -- 0:00:14
747000 -- [-553.050] (-557.381) (-555.656) (-554.098) * (-555.931) [-552.840] (-557.598) (-557.399) -- 0:00:14
747500 -- (-554.715) (-555.213) (-554.068) [-554.494] * (-554.051) (-559.316) (-557.332) [-553.280] -- 0:00:14
748000 -- (-554.805) [-554.892] (-552.943) (-554.879) * (-559.158) (-555.587) [-558.458] (-552.556) -- 0:00:14
748500 -- (-556.885) (-556.882) (-557.274) [-555.864] * (-553.951) (-560.584) [-553.420] (-555.778) -- 0:00:14
749000 -- (-556.049) (-553.528) (-555.543) [-555.736] * [-554.968] (-556.274) (-558.792) (-557.253) -- 0:00:14
749500 -- (-554.440) (-556.164) (-553.547) [-556.035] * (-557.306) [-557.238] (-556.246) (-554.429) -- 0:00:14
750000 -- [-556.640] (-553.339) (-553.525) (-557.302) * (-554.251) (-558.843) (-553.772) [-554.497] -- 0:00:14
Average standard deviation of split frequencies: 0.013305
750500 -- [-553.741] (-554.218) (-554.898) (-554.296) * (-554.174) (-557.096) (-556.311) [-554.473] -- 0:00:14
751000 -- [-555.346] (-554.943) (-555.279) (-554.328) * (-555.327) [-553.868] (-557.740) (-553.944) -- 0:00:14
751500 -- (-553.967) (-555.012) [-554.474] (-553.979) * (-559.156) (-553.428) (-554.519) [-556.148] -- 0:00:14
752000 -- (-559.532) [-555.309] (-552.794) (-554.564) * (-554.234) (-553.725) [-554.406] (-557.538) -- 0:00:14
752500 -- (-555.158) [-556.356] (-556.398) (-554.301) * [-556.295] (-554.177) (-555.367) (-554.424) -- 0:00:14
753000 -- (-555.445) [-552.939] (-555.581) (-560.145) * (-556.507) [-554.741] (-555.516) (-558.914) -- 0:00:14
753500 -- (-553.553) (-553.472) [-554.242] (-557.988) * (-553.281) [-555.233] (-554.280) (-558.282) -- 0:00:14
754000 -- (-557.764) [-555.375] (-557.576) (-555.460) * [-555.193] (-555.194) (-554.415) (-557.141) -- 0:00:14
754500 -- (-555.655) (-557.869) [-555.378] (-555.509) * [-555.581] (-553.886) (-553.716) (-554.867) -- 0:00:14
755000 -- (-553.338) (-556.136) (-554.101) [-554.553] * (-555.308) (-559.162) [-554.486] (-556.332) -- 0:00:14
Average standard deviation of split frequencies: 0.013367
755500 -- (-553.948) (-554.701) [-554.013] (-556.647) * (-557.464) (-556.405) (-554.580) [-553.713] -- 0:00:14
756000 -- (-554.873) [-553.699] (-557.248) (-557.004) * (-554.067) (-553.954) [-553.260] (-554.456) -- 0:00:14
756500 -- (-553.907) [-554.334] (-557.237) (-553.025) * [-555.553] (-554.730) (-553.385) (-555.244) -- 0:00:14
757000 -- (-552.884) (-554.465) [-554.965] (-553.632) * (-561.816) (-553.724) [-554.599] (-554.862) -- 0:00:14
757500 -- (-554.650) (-554.867) (-555.898) [-554.322] * (-562.180) [-553.555] (-556.362) (-557.019) -- 0:00:14
758000 -- (-553.291) (-555.380) (-555.586) [-554.497] * (-556.849) [-554.001] (-555.760) (-557.786) -- 0:00:14
758500 -- [-555.287] (-553.638) (-556.513) (-553.485) * (-561.910) (-557.446) [-554.321] (-555.265) -- 0:00:14
759000 -- [-554.420] (-552.764) (-556.798) (-555.167) * [-553.695] (-556.507) (-559.550) (-556.119) -- 0:00:14
759500 -- (-554.045) (-557.396) (-556.041) [-555.017] * [-556.487] (-556.076) (-556.194) (-558.092) -- 0:00:14
760000 -- [-555.996] (-566.075) (-557.334) (-554.977) * [-553.896] (-554.890) (-555.197) (-554.384) -- 0:00:14
Average standard deviation of split frequencies: 0.013324
760500 -- (-555.917) (-553.580) [-553.409] (-558.875) * (-553.734) [-554.648] (-557.060) (-554.211) -- 0:00:14
761000 -- (-554.864) [-555.532] (-556.237) (-556.143) * (-556.907) (-554.200) (-554.114) [-554.009] -- 0:00:14
761500 -- [-554.748] (-553.791) (-556.601) (-555.879) * (-555.520) (-559.969) [-554.246] (-554.038) -- 0:00:14
762000 -- [-557.431] (-555.726) (-561.613) (-554.442) * [-556.646] (-558.315) (-554.349) (-554.735) -- 0:00:14
762500 -- [-555.626] (-554.244) (-557.843) (-555.694) * [-554.509] (-554.694) (-554.741) (-555.777) -- 0:00:14
763000 -- [-554.203] (-554.252) (-553.692) (-554.845) * (-555.045) [-554.284] (-557.916) (-554.009) -- 0:00:13
763500 -- (-555.850) (-555.267) [-557.528] (-556.366) * [-555.810] (-554.308) (-557.558) (-557.939) -- 0:00:13
764000 -- (-556.074) [-553.037] (-555.778) (-558.654) * (-554.564) [-552.868] (-555.790) (-556.259) -- 0:00:13
764500 -- (-553.286) (-557.589) (-554.459) [-560.730] * (-555.409) (-554.205) [-554.547] (-552.967) -- 0:00:13
765000 -- (-556.908) (-556.387) (-555.316) [-555.727] * [-555.715] (-554.288) (-553.640) (-556.114) -- 0:00:13
Average standard deviation of split frequencies: 0.013193
765500 -- (-555.595) (-554.245) (-557.672) [-556.458] * (-554.999) (-554.582) (-555.599) [-555.856] -- 0:00:13
766000 -- [-556.163] (-555.058) (-554.680) (-559.583) * (-561.830) [-553.234] (-558.060) (-555.070) -- 0:00:13
766500 -- (-555.364) (-555.505) (-555.904) [-554.332] * (-554.011) (-554.761) (-558.955) [-553.305] -- 0:00:13
767000 -- (-555.837) (-553.240) (-554.028) [-558.686] * (-554.830) (-554.759) (-555.489) [-554.697] -- 0:00:13
767500 -- [-554.986] (-553.577) (-559.186) (-555.269) * [-555.661] (-555.443) (-554.162) (-558.893) -- 0:00:13
768000 -- [-553.794] (-553.677) (-553.342) (-553.808) * (-555.110) (-554.215) [-553.687] (-555.969) -- 0:00:13
768500 -- [-553.579] (-554.715) (-554.023) (-553.773) * [-553.087] (-555.078) (-554.776) (-554.379) -- 0:00:13
769000 -- (-552.955) [-554.516] (-553.362) (-555.984) * [-555.705] (-556.699) (-558.391) (-554.443) -- 0:00:13
769500 -- (-555.449) [-555.898] (-554.353) (-555.175) * (-554.994) [-553.654] (-556.649) (-557.083) -- 0:00:13
770000 -- (-553.940) (-555.690) [-554.545] (-553.589) * [-556.056] (-552.756) (-556.820) (-558.956) -- 0:00:13
Average standard deviation of split frequencies: 0.012692
770500 -- [-554.720] (-553.647) (-553.345) (-554.402) * [-554.079] (-555.224) (-554.150) (-555.810) -- 0:00:13
771000 -- (-554.378) (-553.375) [-554.011] (-558.491) * (-556.534) (-554.896) [-554.803] (-554.522) -- 0:00:13
771500 -- (-553.774) (-554.186) (-559.156) [-553.576] * [-554.669] (-553.289) (-554.145) (-560.965) -- 0:00:13
772000 -- (-554.315) (-556.489) (-555.082) [-554.503] * (-557.074) (-555.437) (-553.588) [-554.206] -- 0:00:13
772500 -- (-554.253) [-554.007] (-554.215) (-553.600) * (-555.685) [-554.801] (-554.098) (-554.237) -- 0:00:13
773000 -- (-554.266) (-555.814) (-556.200) [-554.433] * (-561.906) [-555.678] (-554.492) (-554.375) -- 0:00:13
773500 -- (-558.387) [-554.207] (-555.346) (-558.851) * (-556.781) (-558.986) (-555.304) [-557.074] -- 0:00:13
774000 -- (-562.694) (-554.176) (-556.848) [-557.443] * (-555.080) [-552.857] (-553.546) (-554.045) -- 0:00:13
774500 -- (-559.296) (-553.639) [-557.401] (-557.707) * (-552.979) [-553.828] (-553.779) (-556.482) -- 0:00:13
775000 -- (-559.456) (-554.085) [-556.875] (-552.988) * (-554.784) (-558.430) (-556.176) [-557.037] -- 0:00:13
Average standard deviation of split frequencies: 0.012833
775500 -- [-554.879] (-560.363) (-555.075) (-554.056) * (-557.977) [-554.118] (-557.633) (-554.670) -- 0:00:13
776000 -- (-554.617) (-556.846) (-558.614) [-553.397] * [-559.623] (-556.996) (-555.176) (-555.433) -- 0:00:13
776500 -- (-558.074) (-555.447) [-554.459] (-554.286) * (-557.313) [-558.094] (-555.819) (-555.569) -- 0:00:13
777000 -- (-554.896) [-555.040] (-553.366) (-555.926) * (-554 