>C1
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C2
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C3
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C4
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C5
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C6
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHGIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=308
C1 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C2 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C3 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C4 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C5 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C6 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
**************************************************
C1 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C2 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C3 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C4 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C5 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C6 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
**************************************************
C1 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C2 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C3 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C4 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C5 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C6 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
**************************************************
C1 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C2 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C3 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C4 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C5 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C6 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
**************************************************
C1 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C2 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C3 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C4 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C5 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C6 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHGIG
*********************************************** **
C1 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C2 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C3 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C4 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C5 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C6 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
**************************************************
C1 VCQFTLVK
C2 VCQFTLVK
C3 VCQFTLVK
C4 VCQFTLVK
C5 VCQFTLVK
C6 VCQFTLVK
********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 308 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 308 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [9240]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [9240]--->[9240]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.509 Mb, Max= 30.871 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C2 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C3 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C4 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C5 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
C6 MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
**************************************************
C1 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C2 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C3 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C4 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C5 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
C6 RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
**************************************************
C1 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C2 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C3 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C4 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C5 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
C6 VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
**************************************************
C1 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C2 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C3 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C4 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C5 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
C6 GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
**************************************************
C1 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C2 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C3 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C4 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C5 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
C6 LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHGIG
*********************************************** **
C1 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C2 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C3 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C4 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C5 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
C6 SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
**************************************************
C1 VCQFTLVK
C2 VCQFTLVK
C3 VCQFTLVK
C4 VCQFTLVK
C5 VCQFTLVK
C6 VCQFTLVK
********
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.68 C1 C6 99.68
TOP 5 0 99.68 C6 C1 99.68
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.68 C2 C6 99.68
TOP 5 1 99.68 C6 C2 99.68
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.68 C3 C6 99.68
TOP 5 2 99.68 C6 C3 99.68
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 99.68 C4 C6 99.68
TOP 5 3 99.68 C6 C4 99.68
BOT 4 5 99.68 C5 C6 99.68
TOP 5 4 99.68 C6 C5 99.68
AVG 0 C1 * 99.94
AVG 1 C2 * 99.94
AVG 2 C3 * 99.94
AVG 3 C4 * 99.94
AVG 4 C5 * 99.94
AVG 5 C6 * 99.68
TOT TOT * 99.89
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
C2 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
C3 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
C4 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
C5 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
C6 ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
**************************************************
C1 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
C2 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
C3 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
C4 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
C5 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
C6 ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
**************************************************
C1 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
C2 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
C3 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
C4 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
C5 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
C6 TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
**************************************************
C1 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
C2 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
C3 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
C4 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
C5 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
C6 CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
**************************************************
C1 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
C2 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
C3 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
C4 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
C5 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
C6 CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
**************************************************
C1 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
C2 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
C3 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
C4 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
C5 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
C6 GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
**************************************************
C1 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
C2 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
C3 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
C4 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
C5 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
C6 GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
**************************************************
C1 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
C2 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
C3 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
C4 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
C5 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
C6 GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
**************************************************
C1 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
C2 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
C3 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
C4 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
C5 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
C6 TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
**************************************************
C1 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
C2 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
C3 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
C4 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
C5 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
C6 GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
**************************************************
C1 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
C2 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
C3 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
C4 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
C5 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
C6 CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
**************************************************
C1 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
C2 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
C3 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
C4 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
C5 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
C6 GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
**************************************************
C1 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
C2 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
C3 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
C4 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
C5 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
C6 CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
**************************************************
C1 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
C2 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
C3 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
C4 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
C5 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
C6 GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
**************************************************
C1 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
C2 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
C3 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
C4 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
C5 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
C6 ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATGGGATCGGG
***************************************** ********
C1 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
C2 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
C3 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
C4 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
C5 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
C6 TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
**************************************************
C1 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
C2 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
C3 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
C4 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
C5 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
C6 CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
**************************************************
C1 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
C2 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
C3 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
C4 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
C5 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
C6 TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
**************************************************
C1 GTCTGCCAGTTCACCTTGGTCAAG
C2 GTCTGCCAGTTCACCTTGGTCAAG
C3 GTCTGCCAGTTCACCTTGGTCAAG
C4 GTCTGCCAGTTCACCTTGGTCAAG
C5 GTCTGCCAGTTCACCTTGGTCAAG
C6 GTCTGCCAGTTCACCTTGGTCAAG
************************
>C1
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C2
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C3
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C4
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C5
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATCGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C6
ATGGTTCCGTCACAGAGCCATCCGGCCAAAACCCCTCGTAAACAGCTGAA
ACCACCGATCGAAGCCGTACAGTCGCATTACGACCGATCGAATGAGTTCT
TCAAGCTGTGGCTCGATCCATCGATGACCTACAGCTGCGCATACTTTGAA
CGCCCCGACCTGACGCTGGAAGAGGCCCAGCGCGCTAAGCGTGACCTCGC
CTTGAGCAAGCTTGGGCTAGAACCCGGTATGACTCTGCTCGACATCGGCT
GCGGCTGGGGATCGACCATGCTGCACGCGATCGAAAAGTACGACGTTAAT
GTGATTGGCTTGACGCTGAGCGCGAATCAGCTCGCCCACAACAAGCTGAA
GTTTGCCGAAATAGACCACACCCGAACAGACCGGACCAAGGACGTACGGC
TGCAAGGCTGGGAACAATTCGACGAACCGGTCGACCGCATCATCTCACTC
GGCGCGTTCGAGCATTTTGCTGATGGCGCAGGCGACGCCGGATTCGAACG
CTACGACAGCTTCTTCAAGATGTGCTACGACGTGCTGCCCGACGATGGCA
GGATGCTGCTGCACACAATCATCGTGCCTGATGCCAAGGAAACCAAGGAG
CTGGGCTTGACGACGCCGATGAGCCTGCTCCGCTTCATCAAGTTCATCTT
GACCGAGATCTTCCCTGGCGGTCGGCTGCCGAAGATCTCGCAGGTCGACC
ACTATTCATCCAACGCTGGTTTCACGGTCGAGCGGTACCATGGGATCGGG
TCCCACTATGTCCCGACGCTGAACGCCTGGGCCGCAGCGCTGGAAGCTCA
CAAGGACGAGGCCATCGCACTGCAGGGGCGGCAAATCTACGACACCTACA
TGCACTACCTGACGGGGTGTTCAGACCTATTCCGCGACCGTTACACCGAC
GTCTGCCAGTTCACCTTGGTCAAG
>C1
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C2
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C3
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C4
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C5
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHRIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
>C6
MVPSQSHPAKTPRKQLKPPIEAVQSHYDRSNEFFKLWLDPSMTYSCAYFE
RPDLTLEEAQRAKRDLALSKLGLEPGMTLLDIGCGWGSTMLHAIEKYDVN
VIGLTLSANQLAHNKLKFAEIDHTRTDRTKDVRLQGWEQFDEPVDRIISL
GAFEHFADGAGDAGFERYDSFFKMCYDVLPDDGRMLLHTIIVPDAKETKE
LGLTTPMSLLRFIKFILTEIFPGGRLPKISQVDHYSSNAGFTVERYHGIG
SHYVPTLNAWAAALEAHKDEAIALQGRQIYDTYMHYLTGCSDLFRDRYTD
VCQFTLVK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 924 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579773890
Setting output file names to "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1447696570
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8210153551
Seed = 179123480
Swapseed = 1579773890
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 5 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2071.357498 -- -24.965149
Chain 2 -- -2071.357498 -- -24.965149
Chain 3 -- -2071.359165 -- -24.965149
Chain 4 -- -2071.359047 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2071.357616 -- -24.965149
Chain 2 -- -2071.359165 -- -24.965149
Chain 3 -- -2071.357616 -- -24.965149
Chain 4 -- -2071.359165 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2071.357] (-2071.357) (-2071.359) (-2071.359) * [-2071.358] (-2071.359) (-2071.358) (-2071.359)
500 -- (-1281.705) (-1295.570) [-1284.183] (-1280.563) * (-1284.759) (-1298.706) (-1290.247) [-1287.352] -- 0:00:00
1000 -- [-1287.010] (-1292.121) (-1288.312) (-1291.101) * (-1288.418) (-1289.888) [-1286.139] (-1284.425) -- 0:00:00
1500 -- (-1285.989) (-1283.465) [-1285.873] (-1283.896) * (-1286.541) (-1293.231) (-1285.947) [-1287.367] -- 0:00:00
2000 -- (-1294.097) (-1290.101) (-1281.282) [-1285.968] * (-1281.728) (-1289.184) [-1286.689] (-1289.963) -- 0:00:00
2500 -- (-1283.634) (-1284.474) (-1282.703) [-1283.757] * [-1287.400] (-1284.802) (-1289.630) (-1289.266) -- 0:00:00
3000 -- [-1288.193] (-1282.396) (-1285.084) (-1288.049) * [-1282.193] (-1283.653) (-1292.129) (-1293.538) -- 0:00:00
3500 -- (-1282.102) [-1284.004] (-1291.651) (-1293.057) * (-1282.315) (-1282.389) [-1289.211] (-1283.447) -- 0:00:00
4000 -- [-1281.622] (-1289.162) (-1288.687) (-1287.470) * [-1282.877] (-1282.311) (-1295.991) (-1285.480) -- 0:00:00
4500 -- (-1287.846) [-1281.259] (-1284.557) (-1285.244) * (-1285.070) [-1285.290] (-1290.598) (-1288.813) -- 0:00:00
5000 -- (-1284.845) (-1291.657) [-1283.430] (-1294.582) * (-1287.173) [-1284.831] (-1287.867) (-1289.276) -- 0:00:00
Average standard deviation of split frequencies: 0.068319
5500 -- [-1289.476] (-1287.780) (-1282.372) (-1290.193) * [-1278.875] (-1281.444) (-1291.999) (-1284.959) -- 0:00:00
6000 -- (-1288.390) (-1282.854) [-1284.245] (-1287.562) * (-1282.755) (-1292.031) [-1288.627] (-1283.815) -- 0:00:00
6500 -- (-1289.740) (-1295.734) (-1294.402) [-1285.373] * (-1286.552) (-1290.544) (-1290.488) [-1281.240] -- 0:00:00
7000 -- (-1286.795) [-1283.158] (-1294.195) (-1281.390) * (-1299.387) [-1278.998] (-1282.056) (-1282.733) -- 0:00:00
7500 -- (-1285.474) (-1282.987) [-1284.840] (-1293.671) * (-1286.794) [-1283.892] (-1287.139) (-1283.083) -- 0:00:00
8000 -- [-1285.348] (-1281.427) (-1288.313) (-1282.882) * (-1284.713) (-1285.800) [-1280.923] (-1282.526) -- 0:00:00
8500 -- (-1288.971) [-1285.886] (-1283.626) (-1285.154) * [-1281.455] (-1289.001) (-1285.988) (-1289.616) -- 0:00:00
9000 -- [-1282.402] (-1281.336) (-1289.169) (-1280.710) * (-1289.135) [-1287.089] (-1285.015) (-1280.615) -- 0:00:00
9500 -- (-1285.330) [-1285.782] (-1286.940) (-1290.019) * (-1297.723) (-1291.034) (-1283.226) [-1283.429] -- 0:00:00
10000 -- (-1296.328) [-1286.109] (-1287.317) (-1293.602) * (-1294.881) (-1282.486) [-1283.026] (-1288.037) -- 0:00:00
Average standard deviation of split frequencies: 0.080353
10500 -- (-1289.719) [-1280.867] (-1286.694) (-1291.830) * [-1283.645] (-1285.391) (-1294.990) (-1284.375) -- 0:00:00
11000 -- (-1287.731) [-1283.675] (-1286.128) (-1285.907) * (-1284.197) (-1286.377) [-1282.604] (-1286.582) -- 0:00:00
11500 -- (-1294.268) [-1285.420] (-1288.436) (-1287.807) * (-1288.141) (-1283.626) (-1288.884) [-1282.518] -- 0:00:00
12000 -- [-1283.959] (-1283.934) (-1291.120) (-1282.503) * [-1282.340] (-1281.532) (-1289.182) (-1288.536) -- 0:00:00
12500 -- (-1287.681) [-1283.128] (-1284.842) (-1284.277) * (-1283.891) (-1286.604) [-1283.134] (-1280.571) -- 0:00:00
13000 -- (-1288.567) (-1291.395) (-1297.463) [-1284.355] * (-1287.717) (-1290.578) [-1282.074] (-1287.262) -- 0:00:00
13500 -- (-1286.211) (-1284.143) [-1289.961] (-1294.100) * (-1287.507) (-1283.148) (-1282.237) [-1286.397] -- 0:00:00
14000 -- (-1287.633) [-1280.976] (-1284.778) (-1288.131) * (-1288.167) (-1282.754) [-1282.516] (-1302.241) -- 0:00:00
14500 -- (-1284.422) (-1283.652) (-1289.064) [-1289.469] * (-1284.534) (-1285.459) [-1285.931] (-1283.059) -- 0:01:07
15000 -- (-1286.859) (-1291.580) (-1285.640) [-1283.592] * [-1279.926] (-1280.373) (-1286.207) (-1282.694) -- 0:01:05
Average standard deviation of split frequencies: 0.081373
15500 -- (-1287.775) [-1284.079] (-1291.012) (-1288.498) * (-1281.637) (-1284.243) (-1285.240) [-1280.852] -- 0:01:03
16000 -- (-1290.038) (-1284.387) (-1298.564) [-1286.760] * (-1288.737) (-1285.315) [-1282.718] (-1282.169) -- 0:01:01
16500 -- (-1286.387) (-1283.843) (-1290.969) [-1285.939] * [-1281.272] (-1280.243) (-1287.462) (-1283.567) -- 0:00:59
17000 -- (-1289.226) (-1281.530) (-1282.896) [-1284.700] * (-1296.160) [-1281.274] (-1285.994) (-1283.826) -- 0:00:57
17500 -- (-1292.308) (-1285.644) [-1281.726] (-1294.817) * [-1282.962] (-1281.754) (-1291.039) (-1285.998) -- 0:00:56
18000 -- (-1288.840) (-1290.077) (-1293.208) [-1289.081] * (-1285.591) (-1279.143) [-1284.133] (-1278.767) -- 0:00:54
18500 -- (-1286.091) [-1279.564] (-1281.291) (-1283.923) * (-1292.219) (-1279.675) [-1284.446] (-1281.654) -- 0:00:53
19000 -- (-1286.022) (-1283.580) (-1281.612) [-1288.114] * [-1284.443] (-1283.988) (-1291.652) (-1280.070) -- 0:00:51
19500 -- [-1284.134] (-1289.076) (-1280.916) (-1289.540) * (-1287.250) (-1280.145) [-1289.131] (-1279.327) -- 0:00:50
20000 -- [-1290.637] (-1281.982) (-1280.650) (-1292.671) * (-1283.329) [-1282.958] (-1279.106) (-1281.890) -- 0:00:49
Average standard deviation of split frequencies: 0.057025
20500 -- [-1284.714] (-1291.592) (-1281.673) (-1292.653) * [-1278.101] (-1280.469) (-1284.738) (-1281.301) -- 0:00:47
21000 -- [-1281.839] (-1291.809) (-1283.747) (-1285.636) * (-1290.198) (-1281.362) [-1286.198] (-1281.832) -- 0:00:46
21500 -- [-1283.160] (-1287.458) (-1280.794) (-1291.779) * (-1287.100) [-1281.189] (-1286.144) (-1281.653) -- 0:00:45
22000 -- (-1280.627) (-1287.473) (-1280.918) [-1288.981] * [-1283.724] (-1278.082) (-1287.011) (-1282.504) -- 0:00:44
22500 -- (-1289.912) (-1292.628) (-1280.933) [-1289.090] * (-1282.719) (-1282.145) [-1284.619] (-1280.934) -- 0:00:43
23000 -- [-1285.252] (-1289.094) (-1281.556) (-1287.629) * (-1278.126) (-1280.695) [-1288.391] (-1281.247) -- 0:00:42
23500 -- (-1289.384) [-1285.296] (-1280.213) (-1290.484) * [-1281.351] (-1282.545) (-1290.383) (-1285.270) -- 0:00:41
24000 -- (-1292.256) (-1284.520) [-1279.918] (-1294.066) * (-1282.777) [-1282.807] (-1285.964) (-1280.138) -- 0:00:40
24500 -- [-1284.380] (-1282.552) (-1283.089) (-1289.555) * (-1289.506) (-1281.985) [-1282.181] (-1280.173) -- 0:00:39
25000 -- (-1290.170) [-1285.046] (-1282.550) (-1285.266) * (-1282.859) (-1284.064) [-1283.106] (-1280.625) -- 0:00:39
Average standard deviation of split frequencies: 0.037050
25500 -- (-1287.002) [-1289.101] (-1280.505) (-1285.318) * (-1291.430) (-1286.245) [-1283.202] (-1278.968) -- 0:00:38
26000 -- (-1292.151) [-1282.268] (-1285.811) (-1284.905) * (-1288.177) (-1281.663) [-1283.360] (-1282.901) -- 0:00:37
26500 -- (-1289.297) (-1282.625) [-1279.777] (-1288.162) * (-1284.041) (-1279.460) [-1285.423] (-1279.142) -- 0:00:36
27000 -- (-1289.850) (-1285.826) (-1283.609) [-1282.880] * (-1280.303) (-1283.469) [-1284.491] (-1282.831) -- 0:00:36
27500 -- (-1283.444) (-1289.538) [-1282.094] (-1281.356) * (-1292.446) (-1282.200) [-1281.986] (-1280.912) -- 0:00:35
28000 -- [-1290.569] (-1282.723) (-1281.263) (-1283.921) * (-1285.631) (-1282.581) (-1284.868) [-1281.607] -- 0:00:34
28500 -- (-1285.547) (-1281.504) [-1282.683] (-1281.387) * (-1286.753) [-1282.838] (-1287.064) (-1280.563) -- 0:00:34
29000 -- (-1282.569) [-1280.150] (-1280.001) (-1279.999) * (-1292.358) (-1281.529) (-1287.224) [-1282.090] -- 0:00:33
29500 -- (-1289.737) [-1281.150] (-1281.547) (-1282.382) * (-1291.227) (-1282.827) [-1287.229] (-1285.615) -- 0:01:05
30000 -- (-1282.519) (-1280.756) (-1281.400) [-1282.102] * [-1286.858] (-1282.800) (-1282.839) (-1280.969) -- 0:01:04
Average standard deviation of split frequencies: 0.040138
30500 -- (-1285.256) (-1282.894) [-1281.222] (-1282.276) * [-1283.456] (-1283.268) (-1283.540) (-1281.154) -- 0:01:03
31000 -- (-1291.888) [-1280.596] (-1280.245) (-1280.919) * (-1285.664) [-1284.025] (-1290.815) (-1281.086) -- 0:01:02
31500 -- [-1289.306] (-1285.486) (-1284.094) (-1282.474) * [-1282.991] (-1282.675) (-1279.596) (-1281.521) -- 0:01:01
32000 -- [-1287.300] (-1286.491) (-1281.657) (-1280.607) * (-1287.204) (-1281.751) (-1289.918) [-1281.231] -- 0:01:00
32500 -- [-1285.415] (-1280.045) (-1284.340) (-1280.232) * [-1285.954] (-1280.759) (-1279.681) (-1278.896) -- 0:00:59
33000 -- (-1284.007) (-1280.573) (-1282.777) [-1281.706] * (-1285.714) (-1281.005) [-1287.570] (-1280.999) -- 0:00:58
33500 -- (-1288.848) (-1281.852) (-1279.597) [-1284.008] * (-1284.105) (-1281.276) [-1284.406] (-1284.539) -- 0:00:57
34000 -- (-1284.470) (-1278.730) (-1280.895) [-1282.602] * (-1281.366) (-1283.394) [-1280.796] (-1282.308) -- 0:00:56
34500 -- [-1286.994] (-1279.404) (-1284.667) (-1281.712) * (-1289.751) (-1282.023) [-1283.724] (-1284.005) -- 0:00:55
35000 -- [-1284.571] (-1281.438) (-1281.399) (-1281.282) * (-1288.811) (-1278.153) [-1290.609] (-1287.759) -- 0:00:55
Average standard deviation of split frequencies: 0.036374
35500 -- (-1289.757) (-1281.511) (-1279.948) [-1280.970] * [-1281.134] (-1280.188) (-1287.560) (-1284.421) -- 0:00:54
36000 -- [-1281.014] (-1279.631) (-1285.555) (-1282.505) * (-1286.672) (-1283.538) [-1283.423] (-1283.340) -- 0:00:53
36500 -- (-1279.290) (-1280.311) [-1280.104] (-1281.575) * [-1288.830] (-1281.974) (-1287.865) (-1282.148) -- 0:00:52
37000 -- (-1283.186) (-1286.282) (-1287.941) [-1281.391] * (-1290.994) (-1282.694) (-1289.724) [-1282.373] -- 0:00:52
37500 -- [-1287.909] (-1283.790) (-1285.617) (-1280.581) * (-1283.259) (-1281.822) [-1283.392] (-1280.749) -- 0:00:51
38000 -- [-1286.374] (-1282.567) (-1281.896) (-1283.472) * [-1286.182] (-1278.827) (-1282.887) (-1282.124) -- 0:00:50
38500 -- (-1283.222) [-1285.121] (-1283.531) (-1283.234) * (-1285.167) (-1281.423) (-1285.956) [-1282.067] -- 0:00:49
39000 -- (-1287.718) (-1281.203) [-1281.000] (-1280.404) * (-1285.040) (-1281.521) (-1285.997) [-1281.535] -- 0:00:49
39500 -- (-1284.486) [-1279.749] (-1278.896) (-1281.055) * (-1291.293) (-1281.857) [-1290.241] (-1281.287) -- 0:00:48
40000 -- [-1288.375] (-1282.951) (-1279.100) (-1285.996) * [-1283.221] (-1281.870) (-1282.434) (-1279.824) -- 0:00:48
Average standard deviation of split frequencies: 0.035386
40500 -- (-1284.668) (-1279.301) [-1280.595] (-1283.869) * (-1283.621) (-1282.795) (-1282.852) [-1282.766] -- 0:00:47
41000 -- (-1292.206) (-1280.054) (-1280.425) [-1281.955] * (-1283.588) (-1286.185) (-1280.821) [-1279.369] -- 0:00:46
41500 -- [-1284.624] (-1281.962) (-1282.889) (-1281.312) * (-1281.954) (-1279.902) (-1279.989) [-1280.826] -- 0:00:46
42000 -- (-1284.782) [-1280.242] (-1282.889) (-1281.976) * (-1282.399) (-1283.865) (-1280.357) [-1279.576] -- 0:00:45
42500 -- (-1283.922) (-1279.969) [-1282.243] (-1281.383) * (-1280.607) (-1284.447) (-1286.363) [-1280.174] -- 0:00:45
43000 -- [-1297.760] (-1279.898) (-1281.162) (-1279.478) * (-1280.089) (-1282.506) [-1281.684] (-1279.738) -- 0:00:44
43500 -- (-1285.001) (-1281.648) [-1279.727] (-1280.214) * (-1281.855) [-1281.415] (-1282.149) (-1279.495) -- 0:00:43
44000 -- (-1286.045) [-1279.119] (-1282.409) (-1283.484) * (-1284.109) (-1280.683) [-1280.744] (-1281.194) -- 0:01:05
44500 -- (-1292.109) [-1278.855] (-1281.001) (-1281.525) * (-1279.234) (-1281.406) (-1281.595) [-1283.827] -- 0:01:04
45000 -- [-1287.050] (-1281.174) (-1282.240) (-1281.555) * (-1282.735) (-1281.932) (-1279.397) [-1282.154] -- 0:01:03
Average standard deviation of split frequencies: 0.037917
45500 -- [-1291.249] (-1282.473) (-1283.333) (-1280.617) * (-1280.870) (-1281.235) [-1277.963] (-1280.804) -- 0:01:02
46000 -- (-1285.341) (-1279.779) [-1280.626] (-1282.684) * (-1280.905) (-1278.899) [-1282.167] (-1282.763) -- 0:01:02
46500 -- (-1283.424) (-1280.910) (-1280.057) [-1283.527] * [-1280.737] (-1282.113) (-1281.383) (-1280.366) -- 0:01:01
47000 -- [-1286.772] (-1278.906) (-1281.461) (-1279.686) * [-1281.501] (-1279.862) (-1282.428) (-1279.647) -- 0:01:00
47500 -- (-1287.004) [-1280.537] (-1281.085) (-1279.348) * (-1280.710) [-1280.872] (-1280.858) (-1281.419) -- 0:01:00
48000 -- [-1288.312] (-1280.959) (-1281.552) (-1283.922) * (-1280.539) (-1280.693) [-1280.265] (-1279.710) -- 0:00:59
48500 -- [-1287.359] (-1281.949) (-1280.668) (-1282.908) * (-1281.850) [-1281.251] (-1282.039) (-1280.891) -- 0:00:58
49000 -- [-1289.580] (-1280.839) (-1280.806) (-1280.697) * (-1280.733) (-1279.156) (-1283.543) [-1281.698] -- 0:00:58
49500 -- (-1287.394) (-1281.290) (-1280.361) [-1283.824] * (-1281.219) (-1280.531) [-1279.144] (-1281.010) -- 0:00:57
50000 -- (-1284.306) [-1281.498] (-1281.975) (-1283.699) * (-1281.075) (-1287.992) [-1279.909] (-1281.523) -- 0:00:57
Average standard deviation of split frequencies: 0.030850
50500 -- [-1294.779] (-1279.922) (-1279.797) (-1286.439) * (-1283.211) [-1287.195] (-1278.811) (-1279.267) -- 0:00:56
51000 -- [-1287.575] (-1284.710) (-1280.245) (-1279.604) * (-1278.910) [-1282.721] (-1280.181) (-1282.290) -- 0:00:55
51500 -- (-1288.867) (-1283.563) (-1286.676) [-1278.799] * (-1281.663) (-1283.067) [-1280.693] (-1280.003) -- 0:00:55
52000 -- [-1284.861] (-1281.266) (-1281.010) (-1281.805) * (-1280.367) (-1280.090) (-1283.299) [-1280.222] -- 0:00:54
52500 -- (-1288.948) (-1279.602) (-1284.588) [-1279.596] * (-1282.557) [-1280.232] (-1280.187) (-1281.795) -- 0:00:54
53000 -- [-1288.980] (-1279.033) (-1281.412) (-1278.755) * (-1282.366) (-1281.180) [-1280.629] (-1283.836) -- 0:00:53
53500 -- (-1290.225) [-1281.644] (-1281.025) (-1279.632) * (-1280.037) (-1282.022) (-1281.163) [-1281.319] -- 0:00:53
54000 -- (-1285.378) [-1281.348] (-1280.058) (-1279.261) * (-1279.751) (-1283.340) [-1279.092] (-1281.289) -- 0:00:52
54500 -- (-1293.906) [-1280.592] (-1279.260) (-1281.722) * (-1279.297) (-1281.511) [-1279.959] (-1281.067) -- 0:00:52
55000 -- (-1286.546) (-1281.673) (-1282.226) [-1280.359] * (-1280.207) (-1281.609) [-1277.869] (-1278.958) -- 0:00:51
Average standard deviation of split frequencies: 0.027912
55500 -- [-1283.439] (-1280.596) (-1282.197) (-1280.506) * (-1282.391) [-1282.483] (-1282.355) (-1279.693) -- 0:00:51
56000 -- [-1287.227] (-1280.423) (-1279.693) (-1280.405) * (-1283.062) (-1281.291) (-1283.848) [-1282.094] -- 0:00:50
56500 -- (-1284.998) (-1284.004) [-1280.755] (-1283.911) * (-1282.939) (-1279.396) [-1280.984] (-1278.652) -- 0:00:50
57000 -- (-1285.445) (-1288.835) (-1284.176) [-1284.985] * (-1281.271) (-1278.503) [-1280.396] (-1280.792) -- 0:00:49
57500 -- (-1287.569) [-1280.734] (-1281.355) (-1284.311) * (-1281.438) (-1279.671) [-1279.836] (-1280.430) -- 0:00:49
58000 -- (-1287.685) (-1280.734) [-1282.804] (-1278.803) * (-1279.608) (-1278.876) (-1279.312) [-1283.682] -- 0:00:48
58500 -- (-1287.596) (-1278.264) [-1280.584] (-1286.630) * [-1280.035] (-1283.104) (-1279.428) (-1284.123) -- 0:00:48
59000 -- (-1294.202) [-1283.231] (-1282.328) (-1280.451) * (-1280.422) (-1280.273) [-1278.634] (-1281.127) -- 0:01:03
59500 -- (-1290.749) [-1281.107] (-1281.956) (-1280.883) * [-1279.527] (-1281.373) (-1280.170) (-1281.397) -- 0:01:03
60000 -- (-1282.379) (-1279.319) (-1281.835) [-1281.492] * (-1281.496) (-1288.557) [-1281.203] (-1279.716) -- 0:01:02
Average standard deviation of split frequencies: 0.025642
60500 -- [-1283.111] (-1277.872) (-1281.832) (-1280.238) * [-1279.623] (-1280.776) (-1279.997) (-1280.795) -- 0:01:02
61000 -- [-1284.191] (-1283.104) (-1281.163) (-1281.186) * (-1280.133) (-1281.811) (-1280.246) [-1278.474] -- 0:01:01
61500 -- [-1282.518] (-1282.808) (-1282.281) (-1284.584) * [-1280.306] (-1280.773) (-1281.938) (-1280.947) -- 0:01:01
62000 -- [-1283.242] (-1278.090) (-1280.855) (-1281.629) * (-1279.871) (-1281.774) (-1280.980) [-1280.097] -- 0:01:00
62500 -- [-1284.810] (-1279.404) (-1283.117) (-1281.327) * [-1280.801] (-1281.343) (-1280.614) (-1281.793) -- 0:01:00
63000 -- [-1288.496] (-1283.001) (-1280.559) (-1280.428) * (-1281.529) (-1281.089) (-1279.326) [-1278.922] -- 0:00:59
63500 -- (-1291.054) (-1283.629) (-1280.598) [-1280.355] * (-1283.334) [-1283.277] (-1281.936) (-1279.595) -- 0:00:58
64000 -- (-1283.850) (-1279.300) [-1281.567] (-1282.338) * (-1280.699) (-1281.120) (-1280.348) [-1281.809] -- 0:00:58
64500 -- [-1287.908] (-1280.533) (-1283.006) (-1283.020) * [-1279.821] (-1281.716) (-1280.815) (-1281.306) -- 0:00:58
65000 -- (-1292.716) [-1281.309] (-1279.660) (-1279.549) * (-1280.267) (-1281.585) [-1278.388] (-1280.039) -- 0:00:57
Average standard deviation of split frequencies: 0.021427
65500 -- (-1287.576) (-1280.224) (-1279.235) [-1278.045] * [-1281.447] (-1280.825) (-1278.662) (-1279.478) -- 0:00:57
66000 -- [-1284.099] (-1282.741) (-1280.998) (-1280.721) * [-1280.450] (-1280.731) (-1279.335) (-1280.144) -- 0:00:56
66500 -- [-1290.858] (-1281.323) (-1284.633) (-1279.837) * [-1278.821] (-1280.235) (-1278.818) (-1281.714) -- 0:00:56
67000 -- (-1285.010) (-1280.689) [-1282.491] (-1280.385) * (-1281.140) [-1283.143] (-1279.328) (-1281.873) -- 0:00:55
67500 -- (-1296.011) (-1284.775) (-1285.603) [-1281.696] * (-1279.219) [-1277.777] (-1280.772) (-1283.851) -- 0:00:55
68000 -- (-1289.801) (-1281.443) (-1280.654) [-1280.106] * (-1280.621) [-1279.458] (-1277.490) (-1285.873) -- 0:00:54
68500 -- (-1287.027) [-1281.004] (-1280.382) (-1279.174) * (-1280.425) (-1278.076) [-1278.587] (-1280.462) -- 0:00:54
69000 -- (-1286.419) [-1281.649] (-1279.331) (-1278.993) * [-1280.996] (-1281.810) (-1279.611) (-1281.222) -- 0:00:53
69500 -- [-1286.670] (-1281.894) (-1281.405) (-1282.966) * (-1283.579) (-1282.129) [-1281.732] (-1282.573) -- 0:00:53
70000 -- (-1284.824) (-1286.022) (-1282.010) [-1281.283] * (-1281.291) (-1279.603) (-1281.186) [-1280.843] -- 0:00:53
Average standard deviation of split frequencies: 0.023189
70500 -- (-1284.090) [-1285.326] (-1283.078) (-1282.081) * (-1280.693) (-1280.756) [-1280.351] (-1279.842) -- 0:00:52
71000 -- [-1285.434] (-1281.912) (-1282.243) (-1281.152) * [-1279.156] (-1280.429) (-1278.640) (-1281.225) -- 0:00:52
71500 -- [-1288.266] (-1281.453) (-1289.223) (-1282.242) * (-1280.975) [-1280.262] (-1277.725) (-1278.536) -- 0:00:51
72000 -- (-1293.919) (-1282.272) (-1285.925) [-1279.819] * (-1280.537) (-1283.892) (-1280.149) [-1278.228] -- 0:00:51
72500 -- (-1284.670) (-1286.077) (-1283.255) [-1280.533] * (-1279.662) (-1280.643) (-1279.802) [-1278.099] -- 0:00:51
73000 -- [-1290.540] (-1279.646) (-1280.691) (-1282.862) * (-1281.019) (-1285.655) (-1286.071) [-1281.349] -- 0:00:50
73500 -- (-1284.677) (-1280.389) [-1284.168] (-1283.171) * (-1281.754) [-1278.930] (-1284.397) (-1287.490) -- 0:00:50
74000 -- (-1287.580) (-1280.150) (-1284.728) [-1283.914] * (-1280.359) (-1283.123) [-1280.068] (-1282.934) -- 0:00:50
74500 -- [-1287.507] (-1283.075) (-1282.725) (-1281.828) * (-1279.890) (-1282.915) [-1281.638] (-1280.730) -- 0:01:02
75000 -- (-1289.683) (-1280.811) (-1281.927) [-1278.950] * (-1282.934) (-1280.783) [-1282.307] (-1279.693) -- 0:01:01
Average standard deviation of split frequencies: 0.023039
75500 -- (-1289.429) (-1280.561) (-1281.557) [-1279.235] * (-1283.263) (-1280.328) (-1279.192) [-1280.820] -- 0:01:01
76000 -- (-1300.631) (-1281.294) [-1281.995] (-1279.077) * (-1287.528) (-1281.394) (-1282.507) [-1279.921] -- 0:01:00
76500 -- (-1291.022) [-1279.688] (-1282.384) (-1280.405) * (-1280.300) (-1283.173) [-1279.406] (-1280.179) -- 0:01:00
77000 -- (-1292.581) (-1280.261) [-1280.704] (-1280.977) * (-1284.201) (-1287.079) (-1285.497) [-1279.847] -- 0:00:59
77500 -- [-1284.174] (-1280.481) (-1281.982) (-1279.957) * (-1281.251) (-1283.603) (-1279.718) [-1279.487] -- 0:00:59
78000 -- (-1292.955) (-1281.067) (-1283.559) [-1279.404] * (-1280.458) [-1280.914] (-1278.612) (-1279.587) -- 0:00:59
78500 -- [-1284.606] (-1281.053) (-1279.710) (-1280.664) * (-1280.032) (-1281.472) [-1283.214] (-1280.186) -- 0:00:58
79000 -- [-1288.226] (-1282.773) (-1279.053) (-1279.603) * (-1282.513) (-1283.662) (-1282.873) [-1279.697] -- 0:00:58
79500 -- (-1290.626) (-1281.532) [-1281.238] (-1284.641) * [-1279.702] (-1283.456) (-1283.846) (-1283.774) -- 0:00:57
80000 -- (-1284.094) [-1282.118] (-1280.994) (-1283.468) * (-1278.925) [-1279.502] (-1282.525) (-1280.151) -- 0:00:57
Average standard deviation of split frequencies: 0.024252
80500 -- (-1280.612) (-1280.674) (-1279.489) [-1283.587] * [-1280.027] (-1282.835) (-1283.381) (-1279.761) -- 0:00:57
81000 -- [-1286.805] (-1281.251) (-1281.225) (-1282.026) * (-1279.737) [-1281.090] (-1284.388) (-1280.827) -- 0:00:56
81500 -- (-1288.437) [-1280.357] (-1281.505) (-1282.046) * (-1280.153) [-1281.405] (-1281.183) (-1279.097) -- 0:00:56
82000 -- (-1280.890) [-1280.236] (-1281.504) (-1281.583) * (-1280.350) (-1281.124) (-1283.977) [-1280.207] -- 0:00:55
82500 -- (-1285.002) [-1279.145] (-1281.377) (-1284.386) * (-1283.630) (-1281.857) [-1281.131] (-1280.611) -- 0:00:55
83000 -- (-1279.557) (-1283.165) [-1282.643] (-1281.600) * (-1280.782) (-1282.026) [-1282.858] (-1280.493) -- 0:00:55
83500 -- (-1285.561) (-1281.353) (-1280.796) [-1282.370] * [-1281.766] (-1280.128) (-1283.497) (-1279.501) -- 0:00:54
84000 -- (-1283.936) [-1280.418] (-1283.933) (-1287.059) * (-1282.508) (-1281.432) [-1280.053] (-1278.119) -- 0:00:54
84500 -- (-1278.838) (-1281.722) (-1283.308) [-1282.856] * (-1281.255) [-1280.761] (-1280.749) (-1281.191) -- 0:00:54
85000 -- (-1290.773) (-1280.863) [-1281.998] (-1280.592) * [-1282.272] (-1280.185) (-1282.471) (-1283.838) -- 0:00:53
Average standard deviation of split frequencies: 0.019838
85500 -- (-1282.611) [-1282.618] (-1283.407) (-1279.230) * [-1280.338] (-1280.199) (-1283.220) (-1283.693) -- 0:00:53
86000 -- (-1286.455) (-1280.533) (-1280.994) [-1280.461] * (-1279.660) (-1280.580) [-1279.100] (-1281.009) -- 0:00:53
86500 -- (-1288.689) (-1281.676) (-1282.302) [-1279.321] * (-1279.473) (-1282.792) (-1280.263) [-1281.634] -- 0:00:52
87000 -- (-1286.828) [-1280.233] (-1281.699) (-1281.377) * (-1280.526) (-1283.218) [-1278.708] (-1279.604) -- 0:00:52
87500 -- [-1281.604] (-1283.502) (-1281.840) (-1282.681) * (-1282.256) (-1282.665) [-1281.845] (-1281.628) -- 0:00:52
88000 -- [-1293.428] (-1281.434) (-1284.713) (-1281.821) * (-1278.839) (-1281.063) [-1282.481] (-1279.293) -- 0:00:51
88500 -- (-1289.610) (-1281.521) (-1284.166) [-1282.040] * (-1280.716) (-1281.045) (-1279.605) [-1280.714] -- 0:00:51
89000 -- (-1290.363) [-1280.888] (-1280.958) (-1284.130) * (-1280.316) (-1282.927) [-1282.484] (-1281.717) -- 0:00:51
89500 -- [-1283.199] (-1280.274) (-1278.280) (-1280.285) * (-1281.451) (-1278.655) [-1280.052] (-1282.862) -- 0:01:01
90000 -- [-1285.457] (-1279.909) (-1279.268) (-1279.154) * (-1280.321) (-1277.942) [-1280.566] (-1282.103) -- 0:01:00
Average standard deviation of split frequencies: 0.017787
90500 -- (-1286.287) (-1280.207) [-1282.794] (-1281.674) * [-1280.614] (-1281.184) (-1285.290) (-1280.790) -- 0:01:00
91000 -- [-1286.007] (-1283.578) (-1282.139) (-1281.171) * (-1280.037) (-1279.717) [-1280.107] (-1285.940) -- 0:00:59
91500 -- [-1283.282] (-1284.371) (-1281.007) (-1287.013) * (-1280.147) (-1278.162) [-1279.203] (-1281.563) -- 0:00:59
92000 -- [-1288.646] (-1280.850) (-1279.313) (-1283.856) * (-1279.480) [-1280.955] (-1279.913) (-1282.388) -- 0:00:59
92500 -- (-1288.789) (-1280.287) (-1278.595) [-1280.602] * (-1278.362) [-1283.549] (-1281.650) (-1278.375) -- 0:00:58
93000 -- (-1289.569) (-1281.786) [-1278.216] (-1285.083) * (-1281.258) (-1280.468) (-1282.821) [-1278.577] -- 0:00:58
93500 -- (-1284.815) (-1280.714) [-1279.737] (-1283.613) * (-1281.059) (-1279.590) (-1283.136) [-1280.648] -- 0:00:58
94000 -- (-1286.869) (-1280.078) (-1278.765) [-1282.061] * (-1279.105) (-1279.659) [-1281.838] (-1279.647) -- 0:00:57
94500 -- (-1282.268) (-1281.626) [-1280.159] (-1279.549) * (-1280.060) (-1281.591) (-1282.013) [-1279.716] -- 0:00:57
95000 -- [-1284.760] (-1281.053) (-1279.053) (-1279.523) * [-1281.960] (-1279.433) (-1280.588) (-1279.193) -- 0:00:57
Average standard deviation of split frequencies: 0.019125
95500 -- [-1282.014] (-1281.023) (-1280.161) (-1280.532) * (-1283.707) [-1278.771] (-1284.537) (-1279.177) -- 0:00:56
96000 -- [-1280.252] (-1283.277) (-1279.504) (-1281.512) * (-1280.825) (-1282.309) (-1282.587) [-1280.017] -- 0:00:56
96500 -- (-1290.917) (-1281.712) (-1285.185) [-1280.574] * (-1280.312) [-1281.116] (-1284.246) (-1284.553) -- 0:00:56
97000 -- (-1284.607) (-1281.396) [-1281.821] (-1279.715) * (-1280.500) [-1283.016] (-1279.109) (-1280.404) -- 0:00:55
97500 -- [-1283.716] (-1282.117) (-1280.817) (-1279.877) * [-1281.965] (-1292.421) (-1280.515) (-1281.612) -- 0:00:55
98000 -- (-1294.100) (-1280.880) (-1282.721) [-1281.250] * (-1283.784) [-1280.843] (-1282.455) (-1280.417) -- 0:00:55
98500 -- [-1286.447] (-1279.157) (-1280.322) (-1281.777) * (-1283.429) [-1282.189] (-1279.658) (-1281.223) -- 0:00:54
99000 -- (-1282.433) [-1280.716] (-1281.189) (-1283.791) * (-1283.624) [-1278.508] (-1282.642) (-1280.828) -- 0:00:54
99500 -- [-1285.015] (-1280.202) (-1280.833) (-1279.783) * (-1284.225) (-1278.892) (-1285.481) [-1280.475] -- 0:00:54
100000 -- (-1294.097) (-1280.335) [-1280.412] (-1282.073) * [-1283.245] (-1278.626) (-1283.506) (-1278.355) -- 0:00:54
Average standard deviation of split frequencies: 0.018485
100500 -- (-1282.370) (-1280.529) [-1279.101] (-1283.353) * (-1281.513) (-1278.769) (-1283.348) [-1281.295] -- 0:00:53
101000 -- [-1280.582] (-1281.178) (-1279.565) (-1280.424) * [-1280.648] (-1281.397) (-1281.165) (-1282.960) -- 0:00:53
101500 -- [-1285.758] (-1284.197) (-1279.870) (-1284.132) * (-1283.887) (-1282.220) [-1281.712] (-1282.376) -- 0:00:53
102000 -- [-1284.679] (-1280.510) (-1280.432) (-1282.639) * [-1282.660] (-1289.263) (-1281.249) (-1282.808) -- 0:00:52
102500 -- [-1289.995] (-1280.849) (-1282.717) (-1280.881) * (-1280.526) (-1291.356) [-1280.585] (-1280.273) -- 0:00:52
103000 -- [-1286.485] (-1282.676) (-1282.398) (-1281.981) * [-1281.877] (-1283.169) (-1279.558) (-1280.916) -- 0:00:52
103500 -- [-1279.132] (-1280.038) (-1281.730) (-1288.398) * (-1279.697) (-1282.548) (-1280.055) [-1279.538] -- 0:00:51
104000 -- [-1282.570] (-1282.092) (-1280.086) (-1284.004) * (-1280.595) [-1284.049] (-1282.020) (-1281.492) -- 0:01:00
104500 -- [-1287.168] (-1285.414) (-1281.102) (-1282.790) * [-1279.936] (-1286.641) (-1282.703) (-1280.966) -- 0:00:59
105000 -- [-1288.614] (-1284.196) (-1281.987) (-1280.323) * (-1280.639) (-1282.438) (-1281.354) [-1280.290] -- 0:00:59
Average standard deviation of split frequencies: 0.019695
105500 -- (-1288.586) (-1284.748) (-1282.619) [-1281.068] * [-1280.481] (-1280.012) (-1282.364) (-1284.147) -- 0:00:59
106000 -- [-1287.662] (-1282.263) (-1280.124) (-1280.828) * (-1281.930) (-1278.635) [-1282.850] (-1280.850) -- 0:00:59
106500 -- [-1280.684] (-1284.108) (-1279.792) (-1278.404) * (-1280.837) [-1281.742] (-1280.927) (-1283.438) -- 0:00:58
107000 -- (-1294.351) (-1281.766) [-1281.501] (-1280.306) * (-1278.773) [-1281.348] (-1284.000) (-1282.051) -- 0:00:58
107500 -- [-1285.536] (-1282.135) (-1280.943) (-1283.767) * [-1281.777] (-1285.402) (-1280.121) (-1282.941) -- 0:00:58
108000 -- [-1285.177] (-1279.409) (-1280.312) (-1279.791) * [-1283.069] (-1281.383) (-1280.957) (-1281.881) -- 0:00:57
108500 -- (-1282.399) (-1280.008) (-1283.680) [-1280.263] * (-1285.375) [-1283.509] (-1280.419) (-1281.561) -- 0:00:57
109000 -- (-1291.251) (-1281.228) [-1282.097] (-1283.434) * [-1277.756] (-1285.369) (-1281.730) (-1285.201) -- 0:00:57
109500 -- (-1283.835) (-1281.956) (-1281.208) [-1280.572] * [-1279.302] (-1286.317) (-1283.213) (-1282.436) -- 0:00:56
110000 -- (-1285.432) (-1280.539) [-1281.208] (-1279.503) * [-1280.743] (-1283.963) (-1281.559) (-1283.169) -- 0:00:56
Average standard deviation of split frequencies: 0.018530
110500 -- (-1284.765) [-1281.135] (-1283.556) (-1280.480) * (-1280.486) [-1280.647] (-1280.111) (-1283.148) -- 0:00:56
111000 -- [-1287.962] (-1281.933) (-1282.926) (-1278.841) * (-1283.913) [-1281.058] (-1281.920) (-1280.685) -- 0:00:56
111500 -- [-1280.973] (-1284.498) (-1283.286) (-1279.739) * [-1282.164] (-1280.159) (-1283.070) (-1280.492) -- 0:00:55
112000 -- (-1284.177) (-1283.497) [-1284.873] (-1284.764) * (-1285.146) [-1280.082] (-1279.978) (-1280.652) -- 0:00:55
112500 -- [-1278.448] (-1283.804) (-1282.077) (-1280.801) * [-1280.727] (-1280.925) (-1280.347) (-1281.028) -- 0:00:55
113000 -- [-1283.210] (-1281.503) (-1284.167) (-1280.903) * (-1282.074) [-1278.856] (-1282.455) (-1280.035) -- 0:00:54
113500 -- (-1292.536) (-1280.995) (-1282.841) [-1279.704] * (-1279.960) [-1280.920] (-1279.540) (-1278.861) -- 0:00:54
114000 -- [-1281.435] (-1283.498) (-1285.507) (-1281.627) * (-1279.813) [-1281.630] (-1281.339) (-1282.513) -- 0:00:54
114500 -- (-1289.175) (-1282.992) (-1289.301) [-1280.215] * (-1282.392) [-1280.783] (-1281.648) (-1280.940) -- 0:00:54
115000 -- [-1284.906] (-1283.174) (-1284.154) (-1287.413) * (-1282.455) (-1282.835) [-1284.600] (-1280.306) -- 0:00:53
Average standard deviation of split frequencies: 0.019303
115500 -- (-1290.471) (-1281.094) [-1282.390] (-1285.780) * (-1281.280) [-1281.374] (-1288.333) (-1283.092) -- 0:00:53
116000 -- (-1286.710) [-1282.514] (-1280.242) (-1280.041) * [-1281.411] (-1280.908) (-1283.379) (-1279.955) -- 0:00:53
116500 -- (-1285.769) (-1283.286) (-1280.132) [-1282.297] * (-1286.473) [-1278.996] (-1282.064) (-1280.006) -- 0:00:53
117000 -- (-1284.701) (-1288.374) (-1281.181) [-1280.321] * (-1283.570) (-1279.194) (-1280.489) [-1280.173] -- 0:00:52
117500 -- (-1280.822) (-1288.054) (-1280.949) [-1280.734] * (-1284.966) (-1280.691) (-1281.761) [-1283.093] -- 0:00:52
118000 -- (-1285.504) (-1281.512) (-1287.553) [-1280.844] * (-1286.711) (-1280.891) [-1282.673] (-1282.483) -- 0:00:52
118500 -- [-1283.323] (-1282.633) (-1285.321) (-1280.764) * (-1283.250) (-1280.715) (-1281.303) [-1280.622] -- 0:00:52
119000 -- [-1283.048] (-1282.706) (-1282.318) (-1282.079) * (-1283.254) (-1280.113) [-1280.575] (-1280.105) -- 0:00:59
119500 -- (-1290.919) (-1288.255) (-1281.774) [-1288.830] * [-1282.782] (-1281.900) (-1285.986) (-1280.164) -- 0:00:58
120000 -- [-1282.176] (-1285.647) (-1280.286) (-1284.040) * (-1292.495) (-1282.540) (-1279.507) [-1279.936] -- 0:00:58
Average standard deviation of split frequencies: 0.021602
120500 -- (-1288.224) (-1282.212) [-1280.381] (-1284.889) * (-1288.370) [-1282.501] (-1278.085) (-1281.129) -- 0:00:58
121000 -- [-1280.948] (-1285.530) (-1279.883) (-1287.209) * (-1281.919) (-1280.549) (-1278.885) [-1281.692] -- 0:00:58
121500 -- (-1289.546) (-1281.604) [-1281.973] (-1290.001) * (-1281.594) (-1280.654) (-1281.367) [-1280.870] -- 0:00:57
122000 -- (-1286.456) (-1282.770) (-1281.507) [-1280.099] * [-1280.510] (-1281.440) (-1283.146) (-1283.386) -- 0:00:57
122500 -- [-1281.362] (-1290.629) (-1281.383) (-1279.760) * [-1282.184] (-1280.751) (-1284.702) (-1281.082) -- 0:00:57
123000 -- (-1297.339) [-1288.731] (-1280.566) (-1280.359) * (-1283.146) [-1281.216] (-1282.520) (-1282.212) -- 0:00:57
123500 -- [-1280.342] (-1282.116) (-1280.330) (-1280.674) * (-1281.393) [-1281.413] (-1281.637) (-1283.957) -- 0:00:56
124000 -- (-1282.795) [-1281.867] (-1278.581) (-1281.281) * [-1281.625] (-1282.148) (-1281.073) (-1281.170) -- 0:00:56
124500 -- [-1284.619] (-1282.226) (-1283.730) (-1280.692) * (-1280.545) (-1282.300) [-1281.101] (-1281.703) -- 0:00:56
125000 -- [-1285.788] (-1282.859) (-1280.855) (-1280.617) * (-1281.818) (-1280.332) [-1279.962] (-1282.358) -- 0:00:56
Average standard deviation of split frequencies: 0.020785
125500 -- [-1287.031] (-1282.628) (-1286.609) (-1281.376) * (-1283.895) [-1278.372] (-1282.361) (-1281.320) -- 0:00:55
126000 -- [-1282.555] (-1284.340) (-1286.027) (-1281.714) * (-1280.147) (-1280.021) (-1282.878) [-1281.198] -- 0:00:55
126500 -- (-1295.147) (-1283.430) [-1281.707] (-1280.556) * (-1280.369) (-1280.653) (-1283.061) [-1281.887] -- 0:00:55
127000 -- [-1289.531] (-1283.233) (-1283.078) (-1282.498) * (-1280.932) (-1280.779) [-1282.540] (-1280.062) -- 0:00:54
127500 -- (-1297.775) (-1281.084) (-1283.956) [-1281.548] * (-1280.380) [-1280.179] (-1280.696) (-1283.024) -- 0:00:54
128000 -- (-1291.083) (-1280.083) [-1280.995] (-1282.804) * (-1280.187) (-1281.955) [-1280.790] (-1282.538) -- 0:00:54
128500 -- (-1294.722) (-1282.112) (-1282.046) [-1281.822] * (-1280.830) (-1282.331) [-1283.120] (-1280.353) -- 0:00:54
129000 -- [-1284.578] (-1281.421) (-1283.008) (-1281.884) * (-1282.290) [-1280.962] (-1278.764) (-1284.020) -- 0:00:54
129500 -- [-1280.732] (-1280.328) (-1281.200) (-1280.401) * [-1280.405] (-1280.749) (-1280.476) (-1283.247) -- 0:00:53
130000 -- (-1291.347) (-1281.220) [-1279.128] (-1282.752) * (-1279.321) [-1279.190] (-1282.284) (-1280.374) -- 0:00:53
Average standard deviation of split frequencies: 0.018439
130500 -- [-1285.714] (-1284.330) (-1279.336) (-1280.925) * (-1280.028) (-1280.259) (-1286.462) [-1280.495] -- 0:00:53
131000 -- [-1284.496] (-1289.998) (-1279.678) (-1285.207) * [-1278.430] (-1283.023) (-1282.070) (-1280.576) -- 0:00:53
131500 -- (-1280.401) (-1284.002) [-1280.260] (-1281.894) * [-1278.923] (-1280.362) (-1282.962) (-1281.965) -- 0:00:52
132000 -- [-1291.829] (-1282.774) (-1283.929) (-1280.561) * (-1280.374) [-1280.315] (-1281.480) (-1281.875) -- 0:00:52
132500 -- [-1280.498] (-1281.180) (-1283.956) (-1281.232) * [-1280.403] (-1280.634) (-1281.893) (-1280.909) -- 0:00:52
133000 -- [-1286.287] (-1279.841) (-1282.960) (-1281.935) * (-1285.791) (-1281.089) [-1283.060] (-1278.489) -- 0:00:52
133500 -- [-1288.867] (-1283.074) (-1284.372) (-1280.377) * (-1280.289) (-1281.665) (-1281.367) [-1278.506] -- 0:00:51
134000 -- [-1284.438] (-1281.283) (-1281.048) (-1281.378) * (-1282.716) (-1280.826) [-1281.788] (-1281.542) -- 0:00:58
134500 -- (-1290.940) (-1280.373) [-1281.669] (-1283.729) * (-1280.577) (-1280.742) [-1278.363] (-1279.321) -- 0:00:57
135000 -- (-1288.463) (-1283.426) (-1281.781) [-1281.423] * (-1281.134) (-1279.641) [-1280.051] (-1279.862) -- 0:00:57
Average standard deviation of split frequencies: 0.017331
135500 -- [-1283.420] (-1283.757) (-1281.555) (-1283.601) * (-1280.991) (-1280.466) [-1279.348] (-1284.230) -- 0:00:57
136000 -- [-1286.525] (-1279.066) (-1280.368) (-1283.859) * (-1284.132) (-1283.876) [-1279.736] (-1281.447) -- 0:00:57
136500 -- (-1291.169) (-1279.692) [-1282.178] (-1279.044) * (-1282.319) (-1280.118) (-1281.430) [-1280.428] -- 0:00:56
137000 -- (-1287.967) [-1280.735] (-1282.002) (-1279.877) * (-1283.136) (-1280.995) [-1281.661] (-1279.676) -- 0:00:56
137500 -- (-1287.917) (-1280.302) [-1281.611] (-1281.851) * [-1281.185] (-1280.019) (-1280.399) (-1280.715) -- 0:00:56
138000 -- (-1290.979) (-1281.870) [-1281.590] (-1285.116) * [-1282.605] (-1280.901) (-1280.030) (-1282.318) -- 0:00:56
138500 -- (-1280.910) [-1281.157] (-1280.900) (-1281.185) * (-1280.993) [-1280.383] (-1285.187) (-1279.815) -- 0:00:55
139000 -- (-1284.082) (-1286.301) [-1280.743] (-1283.294) * [-1282.873] (-1281.613) (-1283.965) (-1280.744) -- 0:00:55
139500 -- (-1287.847) (-1279.604) [-1280.170] (-1284.839) * (-1278.347) (-1284.138) [-1282.178] (-1282.075) -- 0:00:55
140000 -- (-1294.824) [-1282.268] (-1279.933) (-1284.294) * [-1280.941] (-1284.418) (-1282.519) (-1281.690) -- 0:00:55
Average standard deviation of split frequencies: 0.016198
140500 -- (-1284.589) [-1279.232] (-1281.137) (-1286.760) * [-1279.276] (-1282.733) (-1281.696) (-1279.346) -- 0:00:55
141000 -- [-1282.932] (-1282.252) (-1279.975) (-1287.018) * (-1281.788) (-1282.198) [-1278.738] (-1281.291) -- 0:00:54
141500 -- (-1282.947) (-1281.805) [-1279.372] (-1284.364) * (-1282.471) [-1281.412] (-1278.992) (-1280.491) -- 0:00:54
142000 -- (-1284.944) [-1281.911] (-1280.923) (-1282.441) * (-1280.384) (-1280.478) [-1279.804] (-1280.948) -- 0:00:54
142500 -- (-1284.349) (-1283.253) [-1279.733] (-1282.405) * [-1282.973] (-1281.935) (-1280.396) (-1280.108) -- 0:00:54
143000 -- (-1292.728) (-1283.288) [-1280.701] (-1282.227) * [-1279.332] (-1281.689) (-1285.427) (-1281.864) -- 0:00:53
143500 -- [-1282.338] (-1283.456) (-1284.735) (-1282.579) * (-1283.087) (-1281.737) (-1284.232) [-1283.309] -- 0:00:53
144000 -- [-1284.435] (-1280.506) (-1282.914) (-1286.354) * (-1286.608) (-1280.535) (-1282.465) [-1283.309] -- 0:00:53
144500 -- (-1280.123) (-1280.268) (-1278.840) [-1283.319] * (-1281.431) (-1279.893) (-1279.678) [-1279.536] -- 0:00:53
145000 -- (-1285.361) (-1283.649) (-1282.624) [-1281.646] * (-1280.642) (-1285.760) [-1280.345] (-1281.111) -- 0:00:53
Average standard deviation of split frequencies: 0.014888
145500 -- (-1284.426) (-1280.818) [-1279.732] (-1285.240) * (-1280.149) (-1280.607) [-1282.465] (-1279.013) -- 0:00:52
146000 -- (-1294.142) (-1283.595) [-1281.984] (-1283.819) * (-1280.047) (-1280.052) (-1279.346) [-1279.956] -- 0:00:52
146500 -- (-1289.379) (-1281.267) (-1280.639) [-1286.809] * (-1281.512) (-1281.445) (-1280.691) [-1279.233] -- 0:00:52
147000 -- (-1298.863) (-1281.881) (-1281.818) [-1286.112] * [-1282.157] (-1281.019) (-1286.112) (-1279.783) -- 0:00:52
147500 -- (-1287.705) (-1279.093) [-1279.992] (-1280.736) * (-1281.925) (-1281.962) (-1281.056) [-1280.525] -- 0:00:52
148000 -- (-1288.965) (-1280.039) (-1287.356) [-1280.518] * (-1282.967) (-1280.936) (-1280.984) [-1280.872] -- 0:00:51
148500 -- [-1290.509] (-1280.590) (-1284.936) (-1281.543) * (-1281.736) (-1284.601) (-1282.974) [-1283.117] -- 0:00:51
149000 -- (-1283.354) (-1284.290) (-1282.880) [-1281.178] * (-1281.673) (-1280.233) (-1279.978) [-1281.983] -- 0:00:57
149500 -- (-1289.967) [-1279.973] (-1279.459) (-1280.476) * (-1282.233) (-1280.593) (-1278.979) [-1279.196] -- 0:00:56
150000 -- [-1290.381] (-1280.114) (-1282.340) (-1280.673) * [-1280.244] (-1283.066) (-1278.326) (-1279.224) -- 0:00:56
Average standard deviation of split frequencies: 0.015092
150500 -- (-1289.174) [-1281.121] (-1278.875) (-1280.840) * (-1286.372) (-1280.780) [-1282.206] (-1279.772) -- 0:00:56
151000 -- (-1290.592) [-1284.069] (-1280.299) (-1282.345) * (-1283.219) (-1282.794) (-1285.975) [-1283.203] -- 0:00:56
151500 -- (-1296.883) (-1279.283) [-1278.309] (-1282.045) * (-1278.982) (-1282.504) [-1284.797] (-1285.884) -- 0:00:56
152000 -- [-1293.909] (-1280.480) (-1279.448) (-1282.174) * (-1282.068) (-1283.356) (-1282.251) [-1282.637] -- 0:00:55
152500 -- (-1291.094) (-1280.687) (-1280.390) [-1283.751] * [-1284.649] (-1283.103) (-1281.109) (-1281.378) -- 0:00:55
153000 -- (-1292.692) (-1282.775) (-1279.997) [-1280.281] * (-1284.089) [-1285.445] (-1282.379) (-1284.261) -- 0:00:55
153500 -- (-1291.577) (-1283.618) (-1281.433) [-1285.716] * (-1278.457) (-1281.015) [-1280.403] (-1281.995) -- 0:00:55
154000 -- (-1288.940) (-1282.080) [-1281.167] (-1282.960) * [-1278.717] (-1282.710) (-1280.990) (-1281.947) -- 0:00:54
154500 -- (-1282.357) (-1279.140) [-1280.996] (-1282.308) * [-1278.587] (-1282.930) (-1281.455) (-1281.032) -- 0:00:54
155000 -- [-1285.546] (-1279.351) (-1281.699) (-1281.100) * (-1280.657) (-1282.567) [-1283.883] (-1279.417) -- 0:00:54
Average standard deviation of split frequencies: 0.014398
155500 -- [-1284.092] (-1281.610) (-1278.942) (-1279.314) * (-1279.621) (-1280.867) (-1285.039) [-1282.711] -- 0:00:54
156000 -- (-1292.724) (-1279.753) (-1278.912) [-1281.796] * [-1279.554] (-1281.189) (-1280.516) (-1282.313) -- 0:00:54
156500 -- (-1281.234) [-1280.378] (-1279.216) (-1282.047) * [-1278.872] (-1281.153) (-1281.897) (-1279.297) -- 0:00:53
157000 -- (-1287.583) (-1284.406) (-1280.693) [-1281.259] * (-1280.893) (-1284.165) (-1280.984) [-1284.580] -- 0:00:53
157500 -- (-1293.141) (-1281.816) [-1281.716] (-1282.952) * [-1279.067] (-1280.486) (-1282.057) (-1284.225) -- 0:00:53
158000 -- (-1288.655) (-1279.859) (-1279.863) [-1282.117] * (-1279.719) [-1283.483] (-1282.205) (-1284.565) -- 0:00:53
158500 -- (-1287.910) (-1281.467) [-1281.297] (-1281.705) * (-1287.336) [-1278.681] (-1280.961) (-1280.085) -- 0:00:53
159000 -- [-1282.018] (-1282.782) (-1280.109) (-1283.056) * (-1278.918) (-1281.434) [-1279.913] (-1282.428) -- 0:00:52
159500 -- (-1283.818) (-1282.304) [-1282.124] (-1285.508) * (-1279.457) [-1281.474] (-1285.105) (-1283.136) -- 0:00:52
160000 -- (-1283.340) (-1281.935) [-1280.561] (-1280.208) * (-1283.707) (-1281.944) (-1282.407) [-1281.939] -- 0:00:52
Average standard deviation of split frequencies: 0.015706
160500 -- [-1285.842] (-1283.854) (-1279.672) (-1280.843) * (-1286.282) [-1281.854] (-1281.275) (-1279.136) -- 0:00:52
161000 -- (-1289.495) [-1285.395] (-1279.266) (-1283.389) * (-1281.156) [-1283.678] (-1279.980) (-1280.404) -- 0:00:52
161500 -- (-1284.112) (-1286.401) [-1282.383] (-1281.869) * (-1285.685) (-1283.464) [-1281.809] (-1280.785) -- 0:00:51
162000 -- (-1282.409) [-1280.291] (-1282.340) (-1279.627) * (-1277.905) (-1281.140) (-1281.558) [-1279.900] -- 0:00:51
162500 -- [-1282.116] (-1281.488) (-1280.789) (-1280.910) * [-1281.304] (-1280.973) (-1280.540) (-1281.670) -- 0:00:51
163000 -- [-1283.418] (-1282.586) (-1280.839) (-1279.811) * [-1279.099] (-1281.206) (-1288.587) (-1280.626) -- 0:00:51
163500 -- (-1281.521) (-1282.706) (-1282.527) [-1279.748] * [-1280.658] (-1282.201) (-1280.798) (-1281.787) -- 0:00:51
164000 -- (-1283.061) [-1281.899] (-1284.158) (-1280.838) * [-1281.117] (-1284.444) (-1281.446) (-1284.918) -- 0:00:56
164500 -- [-1284.052] (-1283.644) (-1281.531) (-1282.088) * [-1277.953] (-1285.225) (-1281.628) (-1280.874) -- 0:00:55
165000 -- (-1290.175) (-1279.647) (-1281.479) [-1283.413] * (-1281.699) (-1283.640) [-1280.184] (-1281.394) -- 0:00:55
Average standard deviation of split frequencies: 0.014672
165500 -- [-1290.112] (-1281.712) (-1281.321) (-1281.621) * (-1286.901) (-1283.129) [-1280.143] (-1282.640) -- 0:00:55
166000 -- [-1279.500] (-1280.419) (-1280.160) (-1280.671) * (-1279.962) (-1280.903) (-1281.470) [-1281.622] -- 0:00:55
166500 -- (-1292.418) (-1281.047) (-1283.819) [-1281.365] * [-1280.421] (-1282.040) (-1280.804) (-1281.457) -- 0:00:55
167000 -- (-1285.337) (-1288.069) [-1279.188] (-1280.690) * [-1280.092] (-1282.102) (-1280.601) (-1283.101) -- 0:00:54
167500 -- [-1286.164] (-1282.099) (-1278.886) (-1284.319) * (-1280.533) (-1282.325) [-1283.573] (-1281.603) -- 0:00:54
168000 -- [-1282.088] (-1280.883) (-1278.932) (-1284.696) * [-1280.111] (-1281.449) (-1282.211) (-1279.104) -- 0:00:54
168500 -- (-1281.686) (-1279.602) (-1279.504) [-1284.369] * [-1278.918] (-1280.333) (-1283.092) (-1280.304) -- 0:00:54
169000 -- (-1285.655) (-1282.976) [-1280.419] (-1283.881) * [-1279.506] (-1282.577) (-1281.956) (-1281.473) -- 0:00:54
169500 -- [-1282.434] (-1282.122) (-1280.106) (-1283.641) * (-1281.328) [-1280.456] (-1282.210) (-1282.524) -- 0:00:53
170000 -- [-1285.804] (-1283.748) (-1282.336) (-1284.019) * (-1281.103) (-1280.558) (-1282.360) [-1280.882] -- 0:00:53
Average standard deviation of split frequencies: 0.013964
170500 -- (-1286.371) (-1280.384) [-1282.979] (-1285.100) * [-1279.616] (-1280.254) (-1283.626) (-1281.967) -- 0:00:53
171000 -- (-1305.134) [-1280.213] (-1280.798) (-1279.118) * [-1281.576] (-1282.808) (-1281.200) (-1282.029) -- 0:00:53
171500 -- [-1292.863] (-1280.255) (-1280.763) (-1277.527) * [-1281.845] (-1279.827) (-1284.036) (-1281.099) -- 0:00:53
172000 -- (-1281.284) (-1284.736) [-1280.796] (-1278.256) * (-1280.551) [-1280.922] (-1285.479) (-1282.618) -- 0:00:52
172500 -- [-1281.670] (-1283.396) (-1281.884) (-1281.373) * (-1285.186) (-1279.901) (-1280.196) [-1281.027] -- 0:00:52
173000 -- (-1281.317) (-1285.872) [-1283.059] (-1280.640) * (-1279.406) [-1279.811] (-1279.623) (-1284.552) -- 0:00:52
173500 -- (-1280.248) [-1281.733] (-1282.311) (-1282.598) * [-1279.347] (-1282.100) (-1279.803) (-1281.494) -- 0:00:52
174000 -- (-1280.558) [-1280.756] (-1280.215) (-1280.394) * (-1282.815) (-1283.776) [-1281.227] (-1281.141) -- 0:00:52
174500 -- [-1284.854] (-1281.567) (-1286.433) (-1281.131) * (-1278.575) (-1282.366) (-1279.738) [-1281.669] -- 0:00:52
175000 -- (-1280.845) (-1286.317) [-1279.989] (-1279.962) * (-1278.149) (-1282.621) (-1279.686) [-1279.906] -- 0:00:51
Average standard deviation of split frequencies: 0.012202
175500 -- (-1280.733) (-1284.506) [-1282.669] (-1281.069) * (-1282.446) (-1283.388) [-1279.976] (-1280.025) -- 0:00:51
176000 -- (-1278.783) (-1280.642) [-1282.663] (-1281.923) * (-1281.014) (-1285.339) (-1282.488) [-1279.934] -- 0:00:51
176500 -- (-1285.666) (-1281.769) (-1285.770) [-1280.973] * (-1284.849) (-1283.099) [-1283.525] (-1278.707) -- 0:00:51
177000 -- (-1281.106) [-1280.095] (-1282.544) (-1282.133) * [-1285.194] (-1280.886) (-1281.622) (-1279.889) -- 0:00:51
177500 -- (-1277.369) (-1282.413) (-1283.429) [-1279.074] * (-1282.604) (-1281.405) (-1280.439) [-1280.365] -- 0:00:50
178000 -- (-1280.927) (-1278.792) (-1281.500) [-1279.539] * (-1282.130) (-1284.234) [-1280.225] (-1281.462) -- 0:00:50
178500 -- (-1278.894) [-1281.073] (-1280.351) (-1280.476) * (-1280.226) (-1282.652) [-1280.468] (-1284.518) -- 0:00:50
179000 -- [-1281.774] (-1280.407) (-1282.196) (-1279.151) * (-1280.793) (-1282.618) (-1281.903) [-1281.873] -- 0:00:55
179500 -- (-1280.614) (-1280.255) [-1280.629] (-1279.972) * (-1280.723) (-1285.550) (-1281.224) [-1282.827] -- 0:00:54
180000 -- [-1279.614] (-1278.821) (-1280.003) (-1280.456) * (-1282.927) [-1283.012] (-1280.479) (-1281.550) -- 0:00:54
Average standard deviation of split frequencies: 0.013916
180500 -- (-1282.816) [-1280.197] (-1281.128) (-1279.127) * (-1278.523) [-1279.957] (-1279.848) (-1283.892) -- 0:00:54
181000 -- (-1278.637) (-1281.147) [-1281.145] (-1282.506) * (-1281.252) (-1281.831) [-1281.778] (-1283.369) -- 0:00:54
181500 -- (-1279.528) (-1281.965) [-1281.814] (-1282.801) * (-1283.132) [-1282.922] (-1281.137) (-1281.721) -- 0:00:54
182000 -- (-1281.079) (-1280.069) [-1280.987] (-1282.264) * (-1280.161) (-1281.521) [-1281.150] (-1281.906) -- 0:00:53
182500 -- (-1281.674) (-1281.714) (-1282.180) [-1281.078] * (-1280.556) (-1280.314) [-1279.922] (-1281.639) -- 0:00:53
183000 -- (-1279.179) [-1283.094] (-1279.851) (-1282.135) * (-1283.649) [-1279.244] (-1280.848) (-1285.890) -- 0:00:53
183500 -- (-1279.918) (-1282.222) (-1281.617) [-1281.763] * (-1280.949) [-1280.824] (-1282.593) (-1283.366) -- 0:00:53
184000 -- (-1279.387) (-1280.578) (-1281.665) [-1281.212] * (-1282.513) [-1280.933] (-1282.193) (-1283.515) -- 0:00:53
184500 -- (-1284.065) (-1280.540) (-1283.526) [-1279.606] * (-1280.315) [-1281.157] (-1282.947) (-1281.542) -- 0:00:53
185000 -- (-1280.413) [-1278.175] (-1282.041) (-1281.269) * [-1281.563] (-1281.277) (-1282.000) (-1280.337) -- 0:00:52
Average standard deviation of split frequencies: 0.014643
185500 -- (-1278.917) (-1281.389) (-1281.127) [-1280.294] * [-1281.277] (-1283.443) (-1281.765) (-1281.299) -- 0:00:52
186000 -- (-1282.984) (-1279.980) [-1278.353] (-1280.384) * (-1280.074) (-1280.846) (-1280.413) [-1280.657] -- 0:00:52
186500 -- (-1284.193) [-1279.857] (-1280.489) (-1279.527) * (-1280.064) (-1281.579) [-1280.794] (-1280.653) -- 0:00:52
187000 -- (-1282.881) (-1281.223) [-1280.469] (-1283.307) * (-1279.474) (-1278.565) [-1282.886] (-1282.386) -- 0:00:52
187500 -- (-1282.595) (-1282.147) (-1280.337) [-1279.054] * (-1279.027) (-1280.203) (-1289.994) [-1281.129] -- 0:00:52
188000 -- (-1282.492) (-1281.568) (-1280.082) [-1279.895] * (-1281.185) (-1280.216) [-1283.413] (-1283.304) -- 0:00:51
188500 -- (-1282.198) (-1282.634) [-1280.061] (-1283.458) * [-1280.130] (-1281.989) (-1282.653) (-1285.396) -- 0:00:51
189000 -- (-1283.782) (-1281.931) (-1282.601) [-1282.932] * (-1279.909) (-1278.311) [-1282.063] (-1280.588) -- 0:00:51
189500 -- (-1284.820) (-1280.659) [-1282.226] (-1281.772) * (-1289.139) [-1279.004] (-1285.548) (-1280.668) -- 0:00:51
190000 -- (-1280.994) (-1280.391) [-1281.353] (-1282.361) * [-1281.193] (-1282.861) (-1281.097) (-1285.054) -- 0:00:51
Average standard deviation of split frequencies: 0.015659
190500 -- (-1281.687) (-1280.642) (-1280.883) [-1283.258] * [-1279.381] (-1282.264) (-1278.987) (-1284.048) -- 0:00:50
191000 -- (-1282.375) (-1280.339) (-1281.107) [-1281.426] * (-1281.660) (-1284.920) [-1283.568] (-1285.331) -- 0:00:50
191500 -- (-1284.057) (-1280.431) [-1281.969] (-1282.490) * (-1279.387) [-1281.489] (-1280.357) (-1289.209) -- 0:00:50
192000 -- (-1283.323) (-1282.300) (-1282.416) [-1278.867] * (-1279.257) [-1282.230] (-1282.263) (-1281.398) -- 0:00:50
192500 -- (-1282.961) (-1284.123) (-1280.811) [-1282.340] * [-1282.012] (-1282.252) (-1282.625) (-1284.496) -- 0:00:50
193000 -- (-1289.098) (-1281.817) [-1281.267] (-1282.954) * (-1279.801) [-1278.680] (-1280.704) (-1280.870) -- 0:00:50
193500 -- (-1282.599) [-1280.134] (-1279.984) (-1281.158) * (-1280.248) (-1278.807) [-1281.960] (-1280.507) -- 0:00:54
194000 -- [-1281.011] (-1281.798) (-1281.322) (-1283.848) * [-1280.270] (-1282.163) (-1282.461) (-1279.877) -- 0:00:54
194500 -- (-1281.128) [-1281.842] (-1280.895) (-1282.241) * (-1280.724) (-1281.210) [-1280.485] (-1280.381) -- 0:00:53
195000 -- (-1280.829) [-1279.412] (-1281.444) (-1281.725) * (-1280.085) (-1279.835) [-1280.482] (-1283.122) -- 0:00:53
Average standard deviation of split frequencies: 0.016702
195500 -- (-1282.589) (-1288.618) (-1282.873) [-1285.370] * (-1282.844) [-1281.318] (-1281.245) (-1281.997) -- 0:00:53
196000 -- (-1284.575) (-1282.590) (-1283.204) [-1278.969] * (-1284.133) (-1282.524) (-1281.707) [-1283.659] -- 0:00:53
196500 -- (-1280.914) (-1284.953) (-1282.198) [-1281.635] * [-1280.780] (-1281.312) (-1285.604) (-1283.288) -- 0:00:53
197000 -- (-1284.829) [-1281.741] (-1283.535) (-1279.353) * [-1282.252] (-1282.744) (-1280.978) (-1280.125) -- 0:00:52
197500 -- [-1284.171] (-1279.806) (-1284.181) (-1278.911) * (-1283.636) (-1280.583) [-1280.848] (-1279.822) -- 0:00:52
198000 -- (-1280.780) [-1284.458] (-1280.591) (-1277.778) * (-1280.564) (-1283.330) [-1281.028] (-1281.189) -- 0:00:52
198500 -- [-1281.651] (-1285.359) (-1280.925) (-1280.050) * (-1282.675) (-1282.317) [-1283.539] (-1280.757) -- 0:00:52
199000 -- (-1284.396) [-1280.711] (-1281.689) (-1281.085) * (-1282.574) (-1282.617) [-1284.997] (-1279.438) -- 0:00:52
199500 -- (-1280.561) [-1282.854] (-1281.289) (-1279.217) * [-1280.410] (-1282.532) (-1278.793) (-1281.532) -- 0:00:52
200000 -- (-1280.259) (-1280.143) [-1282.516] (-1278.499) * [-1278.961] (-1282.405) (-1282.425) (-1279.540) -- 0:00:51
Average standard deviation of split frequencies: 0.016705
200500 -- (-1278.720) (-1278.529) [-1281.172] (-1284.131) * (-1279.852) (-1283.636) (-1284.180) [-1279.021] -- 0:00:51
201000 -- (-1281.198) (-1285.194) [-1278.656] (-1284.733) * (-1283.563) (-1283.971) (-1282.949) [-1281.318] -- 0:00:51
201500 -- (-1280.823) (-1280.963) [-1281.638] (-1283.507) * (-1281.981) [-1279.785] (-1279.824) (-1279.869) -- 0:00:51
202000 -- (-1280.164) (-1281.640) (-1285.552) [-1283.894] * (-1286.509) (-1282.668) (-1283.614) [-1278.803] -- 0:00:51
202500 -- (-1280.868) [-1280.865] (-1285.697) (-1283.821) * (-1282.177) (-1286.126) [-1280.835] (-1281.247) -- 0:00:51
203000 -- [-1281.407] (-1279.281) (-1284.143) (-1284.442) * [-1284.550] (-1284.660) (-1281.080) (-1280.666) -- 0:00:51
203500 -- (-1281.970) [-1282.044] (-1284.673) (-1281.298) * (-1282.219) (-1282.297) [-1279.874] (-1280.581) -- 0:00:50
204000 -- (-1280.308) [-1278.270] (-1280.281) (-1280.009) * (-1280.664) (-1280.100) (-1279.420) [-1279.052] -- 0:00:50
204500 -- [-1278.746] (-1279.002) (-1279.773) (-1278.902) * (-1281.408) (-1277.654) (-1279.492) [-1280.542] -- 0:00:50
205000 -- (-1279.014) [-1280.852] (-1279.055) (-1279.052) * (-1282.029) [-1279.165] (-1281.302) (-1279.254) -- 0:00:50
Average standard deviation of split frequencies: 0.019324
205500 -- [-1285.289] (-1282.439) (-1280.019) (-1280.461) * [-1281.236] (-1282.768) (-1278.698) (-1280.582) -- 0:00:50
206000 -- (-1284.643) (-1280.183) [-1281.535] (-1279.354) * (-1280.634) [-1279.781] (-1282.000) (-1281.635) -- 0:00:50
206500 -- (-1285.186) (-1280.386) [-1284.191] (-1279.567) * (-1279.880) (-1281.084) [-1283.670] (-1281.775) -- 0:00:49
207000 -- (-1280.905) [-1281.032] (-1281.509) (-1282.569) * (-1282.977) (-1283.577) (-1280.420) [-1281.421] -- 0:00:49
207500 -- (-1281.982) (-1282.439) (-1280.392) [-1280.775] * (-1281.452) (-1282.544) (-1282.445) [-1280.528] -- 0:00:49
208000 -- (-1282.070) (-1285.076) [-1280.993] (-1280.996) * [-1285.400] (-1280.270) (-1279.548) (-1281.825) -- 0:00:49
208500 -- (-1281.675) (-1282.737) (-1279.901) [-1283.883] * [-1280.602] (-1279.872) (-1282.567) (-1279.701) -- 0:00:53
209000 -- (-1280.372) (-1282.614) (-1281.141) [-1282.211] * (-1279.557) [-1281.109] (-1283.816) (-1279.512) -- 0:00:52
209500 -- (-1283.209) (-1282.409) (-1279.934) [-1282.081] * [-1280.104] (-1278.700) (-1283.856) (-1281.748) -- 0:00:52
210000 -- (-1283.706) [-1280.769] (-1280.783) (-1285.783) * [-1281.155] (-1284.258) (-1279.124) (-1283.236) -- 0:00:52
Average standard deviation of split frequencies: 0.018772
210500 -- [-1279.394] (-1280.749) (-1282.799) (-1284.728) * (-1281.956) [-1280.632] (-1280.776) (-1283.358) -- 0:00:52
211000 -- (-1280.429) [-1278.417] (-1281.427) (-1282.145) * [-1286.000] (-1277.951) (-1280.490) (-1281.423) -- 0:00:52
211500 -- (-1281.307) [-1287.133] (-1282.330) (-1285.854) * (-1283.537) [-1281.039] (-1280.995) (-1282.058) -- 0:00:52
212000 -- (-1279.019) (-1282.368) [-1280.583] (-1291.045) * (-1281.161) (-1280.177) (-1281.432) [-1282.244] -- 0:00:52
212500 -- (-1280.789) (-1281.979) (-1284.359) [-1282.077] * (-1280.591) [-1278.299] (-1282.457) (-1282.415) -- 0:00:51
213000 -- [-1279.953] (-1279.668) (-1282.651) (-1280.350) * (-1279.611) (-1278.727) (-1280.599) [-1284.790] -- 0:00:51
213500 -- (-1281.177) [-1282.130] (-1281.304) (-1280.683) * (-1287.447) [-1280.109] (-1281.388) (-1281.247) -- 0:00:51
214000 -- (-1281.850) (-1284.595) [-1281.501] (-1280.458) * [-1281.415] (-1279.492) (-1288.047) (-1281.761) -- 0:00:51
214500 -- (-1280.236) [-1283.897] (-1284.249) (-1283.196) * (-1280.706) [-1279.997] (-1286.297) (-1284.448) -- 0:00:51
215000 -- (-1283.307) (-1280.880) (-1281.908) [-1279.878] * (-1282.594) (-1282.909) (-1282.271) [-1279.438] -- 0:00:51
Average standard deviation of split frequencies: 0.018551
215500 -- [-1285.310] (-1283.091) (-1282.044) (-1283.948) * (-1279.682) (-1282.986) (-1283.541) [-1280.921] -- 0:00:50
216000 -- [-1281.520] (-1285.715) (-1283.513) (-1282.473) * (-1280.038) [-1282.519] (-1284.018) (-1281.418) -- 0:00:50
216500 -- (-1281.788) (-1281.818) (-1281.133) [-1283.096] * (-1282.278) (-1283.907) [-1280.867] (-1280.749) -- 0:00:50
217000 -- (-1279.856) (-1281.645) [-1280.794] (-1280.712) * (-1279.570) (-1285.185) (-1282.383) [-1282.718] -- 0:00:50
217500 -- (-1281.886) (-1286.545) (-1278.655) [-1280.186] * (-1280.860) [-1279.190] (-1281.845) (-1282.099) -- 0:00:50
218000 -- (-1282.952) (-1279.218) (-1281.235) [-1279.036] * (-1284.010) [-1282.404] (-1281.842) (-1280.519) -- 0:00:50
218500 -- (-1282.908) [-1279.667] (-1281.033) (-1279.274) * (-1283.714) (-1282.023) (-1282.937) [-1280.276] -- 0:00:50
219000 -- (-1281.964) (-1280.186) [-1286.131] (-1281.553) * [-1287.399] (-1282.980) (-1279.803) (-1283.279) -- 0:00:49
219500 -- (-1284.951) [-1280.488] (-1284.038) (-1280.296) * (-1283.423) (-1284.677) [-1280.637] (-1281.669) -- 0:00:49
220000 -- (-1281.920) (-1280.544) [-1282.942] (-1279.257) * (-1285.720) [-1282.697] (-1281.107) (-1281.728) -- 0:00:49
Average standard deviation of split frequencies: 0.018396
220500 -- (-1283.792) (-1282.197) (-1281.965) [-1279.899] * (-1284.079) [-1280.045] (-1282.737) (-1283.051) -- 0:00:49
221000 -- [-1280.908] (-1281.293) (-1286.310) (-1279.191) * (-1282.964) (-1285.721) [-1284.835] (-1284.651) -- 0:00:49
221500 -- (-1284.017) (-1281.081) (-1287.939) [-1279.422] * [-1280.399] (-1284.331) (-1280.396) (-1282.731) -- 0:00:49
222000 -- (-1281.196) (-1282.350) (-1282.859) [-1282.184] * (-1280.781) (-1284.452) (-1281.552) [-1282.530] -- 0:00:49
222500 -- [-1280.537] (-1283.073) (-1282.884) (-1281.932) * [-1280.506] (-1280.824) (-1281.045) (-1286.617) -- 0:00:48
223000 -- (-1283.553) [-1281.158] (-1281.969) (-1280.460) * (-1284.990) (-1282.917) (-1281.906) [-1283.153] -- 0:00:48
223500 -- (-1284.388) (-1283.559) (-1280.059) [-1281.667] * [-1282.946] (-1285.240) (-1281.221) (-1282.113) -- 0:00:52
224000 -- (-1281.595) (-1285.458) (-1281.323) [-1283.175] * (-1283.272) (-1283.484) (-1280.994) [-1281.076] -- 0:00:51
224500 -- [-1280.724] (-1282.970) (-1285.613) (-1282.827) * (-1282.516) (-1280.711) (-1282.414) [-1281.556] -- 0:00:51
225000 -- [-1284.253] (-1282.582) (-1280.780) (-1281.064) * (-1281.117) [-1279.853] (-1280.642) (-1281.317) -- 0:00:51
Average standard deviation of split frequencies: 0.016138
225500 -- (-1282.999) [-1280.719] (-1281.013) (-1279.267) * (-1281.065) [-1280.088] (-1282.750) (-1283.518) -- 0:00:51
226000 -- [-1280.892] (-1281.838) (-1283.543) (-1278.901) * [-1280.353] (-1282.175) (-1281.691) (-1281.816) -- 0:00:51
226500 -- (-1280.687) [-1279.131] (-1283.403) (-1281.507) * [-1280.429] (-1282.900) (-1282.744) (-1282.852) -- 0:00:51
227000 -- (-1281.149) (-1280.849) (-1281.229) [-1283.608] * (-1280.259) (-1284.975) (-1282.894) [-1279.934] -- 0:00:51
227500 -- (-1284.275) (-1280.779) [-1287.271] (-1282.827) * [-1279.879] (-1280.479) (-1280.145) (-1282.323) -- 0:00:50
228000 -- (-1281.861) [-1281.130] (-1282.656) (-1283.122) * (-1280.822) (-1282.554) [-1281.011] (-1280.172) -- 0:00:50
228500 -- (-1282.560) [-1283.024] (-1283.434) (-1279.170) * (-1282.027) (-1284.290) (-1281.152) [-1279.848] -- 0:00:50
229000 -- (-1284.467) (-1280.516) [-1280.152] (-1281.370) * (-1280.597) (-1281.801) (-1281.209) [-1280.963] -- 0:00:50
229500 -- (-1283.436) [-1279.362] (-1280.447) (-1281.178) * [-1284.090] (-1280.960) (-1280.482) (-1280.119) -- 0:00:50
230000 -- (-1283.491) [-1282.309] (-1280.729) (-1280.365) * (-1283.283) [-1282.602] (-1281.204) (-1280.909) -- 0:00:50
Average standard deviation of split frequencies: 0.015441
230500 -- (-1282.603) [-1280.526] (-1284.022) (-1282.995) * (-1280.178) [-1281.543] (-1281.040) (-1285.305) -- 0:00:50
231000 -- (-1281.113) (-1283.453) (-1280.488) [-1280.419] * (-1285.480) (-1282.143) [-1284.057] (-1282.524) -- 0:00:49
231500 -- (-1283.229) (-1286.877) [-1280.345] (-1280.910) * (-1281.318) [-1280.268] (-1285.684) (-1281.476) -- 0:00:49
232000 -- (-1279.069) [-1279.375] (-1282.585) (-1281.529) * [-1281.304] (-1280.716) (-1283.037) (-1282.218) -- 0:00:49
232500 -- (-1283.671) [-1280.842] (-1283.096) (-1281.864) * (-1282.880) (-1281.804) [-1284.170] (-1285.198) -- 0:00:49
233000 -- (-1280.557) (-1281.479) [-1282.016] (-1283.165) * [-1281.492] (-1280.162) (-1280.463) (-1281.034) -- 0:00:49
233500 -- [-1279.889] (-1279.739) (-1283.465) (-1286.114) * (-1284.290) (-1281.509) (-1279.879) [-1281.140] -- 0:00:49
234000 -- (-1285.424) [-1280.658] (-1281.891) (-1280.250) * (-1282.270) (-1280.346) [-1280.507] (-1281.583) -- 0:00:49
234500 -- (-1285.760) (-1281.612) [-1281.275] (-1282.457) * (-1281.454) [-1279.778] (-1280.035) (-1284.185) -- 0:00:48
235000 -- (-1282.942) (-1281.087) [-1282.219] (-1282.413) * (-1284.090) (-1279.382) [-1280.615] (-1281.089) -- 0:00:48
Average standard deviation of split frequencies: 0.016979
235500 -- (-1282.271) [-1286.983] (-1282.221) (-1280.821) * (-1286.565) (-1280.146) [-1281.648] (-1281.342) -- 0:00:48
236000 -- [-1281.338] (-1282.360) (-1281.517) (-1286.445) * (-1283.696) (-1278.570) (-1282.092) [-1281.475] -- 0:00:48
236500 -- (-1281.424) (-1285.028) [-1280.709] (-1278.697) * (-1282.251) [-1279.790] (-1281.495) (-1280.703) -- 0:00:48
237000 -- (-1277.470) [-1282.233] (-1279.783) (-1278.879) * (-1282.638) (-1280.963) [-1280.079] (-1281.302) -- 0:00:48
237500 -- (-1286.095) [-1279.668] (-1280.524) (-1278.905) * (-1284.991) (-1283.027) [-1282.074] (-1285.726) -- 0:00:48
238000 -- (-1282.973) (-1281.340) (-1281.658) [-1282.518] * (-1283.499) [-1280.961] (-1282.548) (-1280.615) -- 0:00:51
238500 -- (-1282.358) [-1281.795] (-1284.431) (-1278.828) * [-1281.821] (-1280.461) (-1281.135) (-1281.978) -- 0:00:51
239000 -- (-1282.468) (-1280.941) [-1280.413] (-1279.038) * (-1281.534) (-1281.051) [-1280.842] (-1283.685) -- 0:00:50
239500 -- (-1284.980) (-1279.379) (-1281.100) [-1281.461] * (-1279.863) (-1280.782) [-1281.150] (-1284.243) -- 0:00:50
240000 -- (-1285.286) [-1280.258] (-1281.972) (-1281.238) * (-1281.116) (-1281.223) [-1281.137] (-1282.262) -- 0:00:50
Average standard deviation of split frequencies: 0.017010
240500 -- (-1281.860) (-1280.016) (-1281.981) [-1279.353] * (-1279.553) (-1281.454) [-1282.335] (-1281.275) -- 0:00:50
241000 -- (-1282.210) [-1280.667] (-1282.378) (-1283.213) * [-1277.991] (-1284.978) (-1285.101) (-1277.972) -- 0:00:50
241500 -- (-1282.533) (-1281.454) (-1281.033) [-1283.214] * [-1280.252] (-1280.662) (-1282.189) (-1279.571) -- 0:00:50
242000 -- (-1280.484) [-1281.222] (-1282.670) (-1282.404) * (-1280.236) (-1282.342) [-1281.610] (-1281.910) -- 0:00:50
242500 -- (-1280.325) (-1284.170) [-1281.447] (-1282.798) * (-1280.972) (-1278.902) [-1282.359] (-1283.461) -- 0:00:49
243000 -- [-1280.569] (-1282.532) (-1280.341) (-1280.136) * (-1279.163) [-1284.275] (-1282.384) (-1280.777) -- 0:00:49
243500 -- [-1280.465] (-1281.666) (-1282.198) (-1282.470) * (-1279.961) (-1280.412) (-1279.742) [-1281.509] -- 0:00:49
244000 -- (-1284.238) (-1279.988) (-1282.528) [-1280.927] * (-1284.399) (-1280.049) [-1283.323] (-1281.133) -- 0:00:49
244500 -- (-1282.201) [-1281.105] (-1284.723) (-1281.517) * (-1280.267) [-1280.384] (-1281.031) (-1280.289) -- 0:00:49
245000 -- (-1283.324) (-1282.909) (-1282.856) [-1279.457] * (-1279.421) [-1282.263] (-1282.787) (-1280.894) -- 0:00:49
Average standard deviation of split frequencies: 0.016742
245500 -- (-1282.465) (-1280.660) [-1285.627] (-1280.515) * (-1279.644) [-1281.075] (-1281.668) (-1281.943) -- 0:00:49
246000 -- (-1282.494) [-1281.354] (-1285.191) (-1279.174) * (-1280.108) [-1279.690] (-1284.052) (-1280.186) -- 0:00:49
246500 -- [-1280.579] (-1279.095) (-1280.775) (-1280.474) * [-1280.301] (-1278.762) (-1279.888) (-1282.743) -- 0:00:48
247000 -- (-1282.508) (-1282.645) (-1281.773) [-1279.810] * (-1279.602) (-1282.024) [-1280.217] (-1282.466) -- 0:00:48
247500 -- (-1280.055) (-1282.723) [-1281.693] (-1281.566) * (-1280.089) (-1281.008) (-1280.608) [-1281.501] -- 0:00:48
248000 -- (-1280.651) (-1279.997) [-1279.343] (-1283.016) * (-1279.000) [-1280.439] (-1283.302) (-1281.418) -- 0:00:48
248500 -- (-1279.618) [-1281.340] (-1280.973) (-1280.475) * (-1280.647) [-1280.276] (-1282.643) (-1283.850) -- 0:00:48
249000 -- (-1278.810) (-1282.543) [-1278.797] (-1285.006) * (-1283.380) [-1282.257] (-1283.636) (-1282.125) -- 0:00:48
249500 -- [-1281.021] (-1283.969) (-1277.993) (-1285.011) * [-1282.001] (-1280.337) (-1281.833) (-1282.016) -- 0:00:48
250000 -- (-1280.996) (-1279.867) [-1279.392] (-1280.198) * [-1281.085] (-1280.818) (-1280.126) (-1282.521) -- 0:00:48
Average standard deviation of split frequencies: 0.017134
250500 -- [-1284.428] (-1279.646) (-1280.261) (-1279.825) * (-1284.125) (-1282.069) [-1282.142] (-1283.864) -- 0:00:47
251000 -- [-1280.999] (-1279.935) (-1281.766) (-1280.548) * (-1284.897) (-1280.073) (-1282.884) [-1283.199] -- 0:00:47
251500 -- (-1279.768) (-1285.313) (-1283.939) [-1278.763] * (-1280.758) (-1280.153) (-1281.976) [-1282.152] -- 0:00:47
252000 -- (-1278.868) (-1280.243) [-1282.105] (-1281.280) * (-1279.478) (-1282.715) (-1280.557) [-1282.413] -- 0:00:47
252500 -- (-1279.036) (-1281.968) (-1284.028) [-1283.411] * (-1279.559) (-1281.809) [-1280.962] (-1281.310) -- 0:00:50
253000 -- [-1278.595] (-1280.540) (-1281.718) (-1278.708) * (-1281.740) (-1278.905) [-1280.238] (-1283.639) -- 0:00:50
253500 -- [-1279.720] (-1278.467) (-1279.703) (-1281.586) * (-1288.887) (-1280.783) [-1279.676] (-1282.542) -- 0:00:50
254000 -- [-1280.157] (-1278.870) (-1280.580) (-1280.162) * (-1289.084) (-1283.120) [-1279.230] (-1278.958) -- 0:00:49
254500 -- (-1280.382) (-1280.305) [-1279.640] (-1281.236) * [-1285.190] (-1282.787) (-1280.685) (-1278.411) -- 0:00:49
255000 -- (-1278.825) (-1280.255) [-1283.702] (-1280.009) * (-1281.539) (-1280.365) (-1280.773) [-1281.301] -- 0:00:49
Average standard deviation of split frequencies: 0.016982
255500 -- (-1283.350) (-1281.393) (-1283.238) [-1279.292] * (-1283.404) (-1281.287) [-1280.488] (-1282.054) -- 0:00:49
256000 -- (-1282.733) (-1283.862) [-1280.812] (-1280.443) * (-1281.253) (-1283.167) [-1280.176] (-1285.279) -- 0:00:49
256500 -- (-1289.169) (-1282.439) (-1282.065) [-1279.975] * (-1282.086) (-1283.232) [-1278.936] (-1280.102) -- 0:00:49
257000 -- [-1280.892] (-1282.791) (-1280.913) (-1280.359) * [-1280.274] (-1282.804) (-1281.841) (-1278.308) -- 0:00:49
257500 -- (-1281.244) [-1280.280] (-1281.563) (-1280.873) * (-1280.857) (-1281.072) (-1283.308) [-1279.692] -- 0:00:49
258000 -- [-1279.827] (-1278.554) (-1283.155) (-1280.729) * (-1280.384) (-1283.137) (-1284.748) [-1280.255] -- 0:00:48
258500 -- (-1279.383) [-1280.350] (-1281.413) (-1281.496) * [-1280.456] (-1285.047) (-1286.450) (-1281.149) -- 0:00:48
259000 -- (-1280.942) (-1280.635) (-1279.292) [-1282.697] * [-1282.159] (-1282.480) (-1280.504) (-1281.516) -- 0:00:48
259500 -- (-1281.840) [-1282.336] (-1285.024) (-1282.362) * [-1280.048] (-1279.985) (-1280.786) (-1280.851) -- 0:00:48
260000 -- (-1283.970) (-1280.268) [-1281.364] (-1283.712) * (-1282.898) (-1281.210) [-1279.023] (-1282.110) -- 0:00:48
Average standard deviation of split frequencies: 0.017281
260500 -- [-1281.080] (-1280.573) (-1282.226) (-1283.784) * (-1282.608) [-1280.242] (-1280.860) (-1284.877) -- 0:00:48
261000 -- [-1280.944] (-1280.062) (-1282.226) (-1280.704) * (-1285.892) (-1282.936) (-1281.166) [-1281.024] -- 0:00:48
261500 -- (-1279.362) [-1283.018] (-1281.647) (-1284.896) * (-1281.789) [-1281.355] (-1281.189) (-1279.348) -- 0:00:48
262000 -- (-1279.334) (-1279.363) (-1280.817) [-1281.249] * (-1281.748) (-1280.369) [-1280.132] (-1278.357) -- 0:00:47
262500 -- [-1279.762] (-1280.042) (-1281.304) (-1280.224) * (-1281.880) [-1279.964] (-1280.381) (-1279.505) -- 0:00:47
263000 -- (-1283.280) [-1283.383] (-1280.056) (-1278.905) * [-1284.039] (-1282.364) (-1282.008) (-1280.820) -- 0:00:47
263500 -- (-1283.109) (-1283.956) [-1279.580] (-1282.114) * (-1281.549) (-1281.471) (-1284.534) [-1280.984] -- 0:00:47
264000 -- [-1281.026] (-1281.706) (-1281.762) (-1281.003) * (-1281.445) (-1282.001) [-1280.056] (-1281.753) -- 0:00:47
264500 -- [-1283.922] (-1280.378) (-1283.891) (-1282.834) * [-1278.496] (-1282.179) (-1280.574) (-1284.562) -- 0:00:47
265000 -- (-1282.961) [-1278.662] (-1280.545) (-1284.973) * [-1278.849] (-1281.322) (-1280.762) (-1288.386) -- 0:00:47
Average standard deviation of split frequencies: 0.018116
265500 -- (-1281.065) (-1283.112) (-1280.242) [-1280.303] * (-1282.742) [-1281.926] (-1280.443) (-1285.411) -- 0:00:47
266000 -- [-1281.439] (-1285.282) (-1280.707) (-1280.885) * (-1282.261) (-1280.610) [-1280.831] (-1283.618) -- 0:00:46
266500 -- [-1281.943] (-1284.755) (-1280.719) (-1282.567) * (-1278.187) [-1279.631] (-1279.944) (-1279.799) -- 0:00:46
267000 -- (-1279.059) (-1282.275) [-1279.559] (-1280.587) * (-1281.901) (-1282.062) [-1280.722] (-1278.003) -- 0:00:46
267500 -- [-1280.589] (-1284.751) (-1282.385) (-1279.336) * (-1278.715) (-1280.885) (-1281.311) [-1278.956] -- 0:00:49
268000 -- (-1282.884) (-1282.939) (-1283.651) [-1281.742] * [-1279.797] (-1282.138) (-1281.957) (-1282.224) -- 0:00:49
268500 -- (-1280.301) (-1281.050) (-1283.861) [-1279.830] * (-1281.720) [-1282.740] (-1281.358) (-1282.282) -- 0:00:49
269000 -- (-1280.196) (-1284.242) [-1281.162] (-1279.713) * (-1281.248) (-1282.702) [-1283.158] (-1281.348) -- 0:00:48
269500 -- (-1278.360) (-1289.092) [-1281.352] (-1280.141) * (-1282.571) (-1283.738) [-1281.233] (-1277.549) -- 0:00:48
270000 -- (-1283.647) [-1284.837] (-1283.653) (-1279.534) * (-1282.813) (-1282.568) (-1281.768) [-1279.139] -- 0:00:48
Average standard deviation of split frequencies: 0.015675
270500 -- (-1280.180) (-1283.170) [-1278.753] (-1282.061) * [-1280.522] (-1282.036) (-1280.979) (-1281.592) -- 0:00:48
271000 -- (-1282.381) (-1281.769) (-1284.926) [-1283.915] * (-1284.613) (-1281.515) [-1282.300] (-1283.069) -- 0:00:48
271500 -- (-1284.005) [-1281.933] (-1281.374) (-1279.317) * (-1282.813) (-1282.799) (-1282.552) [-1281.296] -- 0:00:48
272000 -- [-1279.447] (-1280.269) (-1283.101) (-1279.785) * [-1283.139] (-1281.177) (-1279.666) (-1280.421) -- 0:00:48
272500 -- (-1283.868) [-1281.429] (-1282.769) (-1282.631) * (-1282.465) (-1283.126) [-1280.804] (-1281.403) -- 0:00:48
273000 -- [-1280.558] (-1282.822) (-1285.407) (-1280.056) * [-1281.390] (-1285.310) (-1281.078) (-1281.231) -- 0:00:47
273500 -- [-1279.869] (-1281.052) (-1283.064) (-1280.147) * (-1279.894) [-1285.712] (-1280.701) (-1279.976) -- 0:00:47
274000 -- (-1280.073) (-1283.070) [-1280.957] (-1278.833) * (-1282.224) (-1283.087) [-1279.763] (-1279.699) -- 0:00:47
274500 -- (-1281.092) (-1282.728) [-1280.002] (-1282.098) * (-1283.891) (-1281.720) (-1281.181) [-1278.664] -- 0:00:47
275000 -- (-1280.372) (-1280.092) [-1280.188] (-1278.669) * (-1282.835) (-1282.159) [-1284.015] (-1282.446) -- 0:00:47
Average standard deviation of split frequencies: 0.016036
275500 -- (-1280.730) (-1281.339) [-1279.129] (-1279.967) * [-1279.387] (-1282.077) (-1281.717) (-1279.864) -- 0:00:47
276000 -- (-1281.400) (-1280.813) [-1280.394] (-1278.604) * (-1284.692) [-1281.772] (-1287.125) (-1283.929) -- 0:00:47
276500 -- (-1285.309) (-1280.607) [-1279.946] (-1280.944) * (-1280.382) (-1286.141) [-1281.771] (-1286.850) -- 0:00:47
277000 -- (-1281.955) (-1280.162) (-1282.978) [-1279.685] * (-1279.107) (-1281.196) (-1280.633) [-1281.425] -- 0:00:46
277500 -- [-1281.617] (-1280.783) (-1282.611) (-1281.476) * [-1279.605] (-1280.149) (-1280.311) (-1280.449) -- 0:00:46
278000 -- (-1281.642) [-1282.399] (-1281.791) (-1280.270) * [-1280.875] (-1279.720) (-1282.089) (-1280.160) -- 0:00:46
278500 -- (-1282.632) (-1280.705) (-1280.277) [-1279.695] * (-1278.876) (-1280.244) (-1282.567) [-1279.884] -- 0:00:46
279000 -- (-1282.431) (-1280.746) [-1280.932] (-1281.043) * (-1280.510) (-1282.899) (-1281.922) [-1280.660] -- 0:00:46
279500 -- [-1281.008] (-1281.163) (-1282.008) (-1278.944) * (-1280.317) (-1281.130) [-1284.577] (-1283.921) -- 0:00:46
280000 -- (-1284.113) [-1281.383] (-1281.268) (-1281.261) * [-1280.503] (-1280.245) (-1282.928) (-1280.318) -- 0:00:46
Average standard deviation of split frequencies: 0.016423
280500 -- [-1279.502] (-1281.936) (-1282.770) (-1281.493) * (-1284.006) (-1280.871) (-1283.233) [-1281.745] -- 0:00:46
281000 -- (-1281.055) [-1280.888] (-1280.664) (-1281.366) * (-1280.971) (-1278.757) (-1282.235) [-1282.857] -- 0:00:46
281500 -- (-1281.722) [-1280.237] (-1279.358) (-1281.081) * (-1283.556) [-1280.612] (-1280.152) (-1281.811) -- 0:00:45
282000 -- [-1280.540] (-1280.487) (-1278.166) (-1281.902) * (-1279.974) (-1279.593) (-1281.740) [-1281.005] -- 0:00:45
282500 -- [-1279.765] (-1280.247) (-1278.475) (-1283.743) * [-1279.863] (-1282.590) (-1283.827) (-1282.663) -- 0:00:48
283000 -- (-1281.868) (-1284.386) (-1280.616) [-1282.584] * (-1282.960) [-1279.464] (-1280.931) (-1280.987) -- 0:00:48
283500 -- [-1283.641] (-1279.896) (-1280.842) (-1279.900) * (-1283.286) [-1278.839] (-1284.347) (-1283.661) -- 0:00:48
284000 -- [-1280.602] (-1280.682) (-1281.593) (-1282.615) * (-1278.668) [-1281.847] (-1283.151) (-1281.096) -- 0:00:47
284500 -- (-1280.431) [-1280.927] (-1280.861) (-1283.905) * (-1277.800) (-1283.147) [-1280.720] (-1283.638) -- 0:00:47
285000 -- (-1280.748) (-1280.511) (-1282.276) [-1281.331] * (-1282.792) (-1283.432) [-1279.120] (-1282.762) -- 0:00:47
Average standard deviation of split frequencies: 0.015018
285500 -- (-1279.100) (-1281.599) [-1281.447] (-1284.936) * (-1281.722) (-1281.120) (-1281.472) [-1282.321] -- 0:00:47
286000 -- (-1280.597) (-1280.891) (-1282.044) [-1280.767] * (-1279.357) [-1282.003] (-1282.113) (-1283.000) -- 0:00:47
286500 -- (-1282.983) (-1283.545) (-1285.450) [-1281.030] * (-1279.195) (-1282.029) [-1279.858] (-1282.362) -- 0:00:47
287000 -- [-1281.333] (-1285.421) (-1282.257) (-1280.539) * (-1278.171) (-1279.700) (-1279.786) [-1280.514] -- 0:00:47
287500 -- (-1280.889) (-1283.473) [-1282.273] (-1284.964) * (-1280.396) (-1280.291) (-1279.333) [-1281.627] -- 0:00:47
288000 -- (-1282.183) [-1283.078] (-1285.004) (-1282.641) * (-1280.023) (-1281.913) (-1282.725) [-1281.240] -- 0:00:46
288500 -- (-1280.266) (-1281.927) (-1281.080) [-1278.282] * [-1280.434] (-1282.361) (-1280.628) (-1281.615) -- 0:00:46
289000 -- (-1283.810) [-1280.219] (-1284.466) (-1280.298) * [-1281.742] (-1280.762) (-1281.716) (-1282.237) -- 0:00:46
289500 -- (-1279.795) [-1281.389] (-1280.507) (-1280.601) * (-1281.136) (-1280.496) [-1280.732] (-1283.052) -- 0:00:46
290000 -- (-1279.893) (-1279.834) [-1279.649] (-1282.509) * (-1279.063) [-1285.754] (-1280.528) (-1283.952) -- 0:00:46
Average standard deviation of split frequencies: 0.014882
290500 -- (-1280.834) [-1281.063] (-1279.806) (-1278.545) * [-1280.302] (-1282.737) (-1280.452) (-1285.565) -- 0:00:46
291000 -- [-1278.640] (-1287.105) (-1280.808) (-1281.402) * (-1280.811) (-1282.413) (-1278.990) [-1280.094] -- 0:00:46
291500 -- (-1279.406) (-1284.341) (-1279.262) [-1281.754] * (-1283.444) (-1280.647) (-1281.060) [-1281.058] -- 0:00:46
292000 -- [-1282.996] (-1282.221) (-1279.852) (-1280.576) * (-1279.141) (-1281.823) [-1281.464] (-1281.535) -- 0:00:46
292500 -- (-1280.993) (-1282.139) [-1279.222] (-1278.168) * (-1280.502) [-1282.051] (-1281.688) (-1280.815) -- 0:00:45
293000 -- [-1280.812] (-1280.179) (-1283.388) (-1280.579) * (-1280.267) [-1281.394] (-1281.353) (-1280.700) -- 0:00:45
293500 -- (-1278.635) [-1280.118] (-1283.222) (-1285.345) * (-1280.014) (-1279.645) [-1281.448] (-1281.162) -- 0:00:45
294000 -- (-1280.154) (-1282.676) [-1279.876] (-1278.727) * (-1281.755) (-1280.913) [-1281.173] (-1281.494) -- 0:00:45
294500 -- (-1279.404) (-1284.777) (-1283.095) [-1279.520] * (-1281.778) (-1281.545) (-1282.075) [-1280.202] -- 0:00:45
295000 -- (-1280.658) [-1285.809] (-1278.057) (-1278.944) * (-1281.233) [-1282.004] (-1283.319) (-1285.383) -- 0:00:45
Average standard deviation of split frequencies: 0.013448
295500 -- [-1279.393] (-1279.760) (-1283.652) (-1280.478) * (-1283.912) (-1281.730) (-1282.383) [-1280.183] -- 0:00:45
296000 -- (-1279.597) (-1280.878) (-1281.096) [-1282.603] * [-1286.070] (-1278.974) (-1285.253) (-1281.948) -- 0:00:45
296500 -- (-1279.666) (-1281.042) (-1280.664) [-1279.747] * (-1279.595) [-1280.243] (-1281.485) (-1283.013) -- 0:00:45
297000 -- (-1279.934) (-1280.594) [-1284.571] (-1283.426) * (-1279.563) [-1282.123] (-1283.268) (-1282.840) -- 0:00:44
297500 -- [-1281.723] (-1279.854) (-1281.490) (-1285.323) * (-1279.915) [-1279.744] (-1282.856) (-1282.254) -- 0:00:47
298000 -- (-1278.933) (-1280.059) (-1280.348) [-1283.280] * (-1281.785) (-1280.611) [-1280.620] (-1280.404) -- 0:00:47
298500 -- (-1278.575) (-1281.609) (-1285.293) [-1280.753] * (-1280.987) (-1280.206) (-1283.394) [-1285.080] -- 0:00:47
299000 -- [-1277.132] (-1279.731) (-1281.836) (-1282.188) * (-1281.435) [-1282.819] (-1280.586) (-1280.476) -- 0:00:46
299500 -- (-1281.591) [-1281.115] (-1280.630) (-1282.840) * (-1280.132) [-1281.778] (-1283.672) (-1279.829) -- 0:00:46
300000 -- (-1279.467) (-1280.834) [-1282.445] (-1287.013) * (-1281.183) [-1283.264] (-1285.456) (-1281.494) -- 0:00:46
Average standard deviation of split frequencies: 0.013240
300500 -- (-1279.392) (-1280.535) (-1282.104) [-1279.819] * (-1280.213) [-1284.530] (-1280.637) (-1282.013) -- 0:00:46
301000 -- [-1279.612] (-1282.093) (-1281.333) (-1281.072) * (-1279.932) (-1286.950) (-1282.683) [-1280.432] -- 0:00:46
301500 -- (-1280.440) (-1282.516) [-1280.634] (-1279.583) * (-1283.340) (-1279.468) (-1281.791) [-1278.666] -- 0:00:46
302000 -- (-1284.833) (-1284.415) [-1282.962] (-1280.730) * (-1282.965) (-1279.548) [-1280.269] (-1280.783) -- 0:00:46
302500 -- [-1280.807] (-1282.813) (-1281.175) (-1282.432) * (-1281.080) [-1283.097] (-1282.763) (-1282.674) -- 0:00:46
303000 -- (-1283.012) [-1280.187] (-1286.453) (-1280.094) * (-1279.873) [-1281.648] (-1280.876) (-1287.168) -- 0:00:46
303500 -- [-1280.315] (-1286.394) (-1281.594) (-1279.185) * [-1283.082] (-1280.698) (-1283.018) (-1280.614) -- 0:00:45
304000 -- (-1281.577) (-1285.350) (-1281.306) [-1281.013] * [-1280.874] (-1282.733) (-1280.764) (-1280.690) -- 0:00:45
304500 -- (-1282.040) [-1280.750] (-1279.847) (-1280.463) * (-1283.391) (-1281.576) [-1278.072] (-1281.997) -- 0:00:45
305000 -- (-1279.347) (-1280.720) [-1279.697] (-1280.023) * (-1281.697) [-1278.717] (-1279.938) (-1286.326) -- 0:00:45
Average standard deviation of split frequencies: 0.013180
305500 -- [-1279.487] (-1279.798) (-1277.851) (-1281.033) * [-1279.161] (-1281.127) (-1281.883) (-1284.392) -- 0:00:45
306000 -- [-1279.303] (-1279.780) (-1284.126) (-1280.276) * (-1280.613) (-1279.743) [-1288.597] (-1286.698) -- 0:00:45
306500 -- (-1281.564) [-1280.050] (-1279.894) (-1280.190) * (-1286.847) (-1279.361) [-1281.541] (-1290.871) -- 0:00:45
307000 -- (-1279.155) (-1283.918) (-1281.349) [-1280.520] * (-1283.410) (-1285.020) (-1281.031) [-1282.763] -- 0:00:45
307500 -- (-1280.093) [-1285.864] (-1283.456) (-1284.685) * (-1279.037) (-1278.102) [-1279.777] (-1281.890) -- 0:00:45
308000 -- (-1281.265) [-1282.063] (-1284.188) (-1284.454) * (-1282.640) [-1278.144] (-1282.737) (-1281.376) -- 0:00:44
308500 -- (-1283.975) [-1281.574] (-1279.569) (-1280.408) * (-1281.235) [-1280.188] (-1280.560) (-1278.601) -- 0:00:44
309000 -- [-1280.711] (-1283.059) (-1280.372) (-1280.992) * (-1281.319) (-1280.213) [-1280.186] (-1283.655) -- 0:00:44
309500 -- (-1284.732) (-1282.832) (-1280.490) [-1280.850] * (-1280.988) [-1280.573] (-1280.723) (-1279.414) -- 0:00:44
310000 -- (-1280.585) (-1283.338) [-1282.250] (-1281.492) * [-1281.768] (-1282.154) (-1281.702) (-1280.918) -- 0:00:44
Average standard deviation of split frequencies: 0.012318
310500 -- (-1282.911) (-1283.508) [-1281.930] (-1280.733) * (-1282.987) (-1283.502) (-1283.329) [-1281.051] -- 0:00:44
311000 -- (-1278.743) (-1286.950) (-1286.506) [-1281.064] * (-1280.501) (-1282.353) (-1283.452) [-1279.684] -- 0:00:44
311500 -- (-1279.475) (-1283.175) [-1287.450] (-1282.252) * [-1283.272] (-1279.274) (-1285.689) (-1279.506) -- 0:00:44
312000 -- (-1281.032) (-1280.987) [-1278.890] (-1286.045) * (-1283.744) (-1280.938) [-1281.202] (-1279.898) -- 0:00:44
312500 -- (-1281.822) [-1280.208] (-1281.643) (-1284.836) * (-1282.204) (-1283.151) (-1280.477) [-1278.165] -- 0:00:46
313000 -- (-1284.908) (-1282.455) (-1281.954) [-1281.235] * (-1281.631) [-1284.673] (-1282.366) (-1280.895) -- 0:00:46
313500 -- [-1282.526] (-1278.751) (-1280.762) (-1287.997) * (-1280.577) [-1281.428] (-1284.124) (-1284.223) -- 0:00:45
314000 -- (-1280.603) (-1279.116) (-1281.561) [-1281.901] * (-1280.829) [-1279.731] (-1281.107) (-1282.489) -- 0:00:45
314500 -- (-1280.966) [-1281.230] (-1286.320) (-1283.793) * (-1284.225) [-1279.696] (-1281.569) (-1283.452) -- 0:00:45
315000 -- (-1281.077) (-1280.305) [-1283.971] (-1281.268) * [-1282.487] (-1277.480) (-1283.811) (-1285.181) -- 0:00:45
Average standard deviation of split frequencies: 0.012285
315500 -- (-1282.117) [-1278.929] (-1279.800) (-1280.004) * (-1280.550) (-1279.596) (-1281.660) [-1279.495] -- 0:00:45
316000 -- (-1282.528) (-1285.118) (-1280.428) [-1280.467] * [-1280.546] (-1281.002) (-1280.718) (-1282.925) -- 0:00:45
316500 -- [-1281.184] (-1282.790) (-1282.807) (-1283.144) * [-1279.904] (-1279.557) (-1285.075) (-1283.349) -- 0:00:45
317000 -- (-1279.342) (-1281.469) (-1284.087) [-1281.186] * (-1280.526) (-1281.125) (-1280.878) [-1282.218] -- 0:00:45
317500 -- [-1280.697] (-1281.927) (-1281.708) (-1281.902) * [-1279.415] (-1279.228) (-1281.990) (-1282.357) -- 0:00:45
318000 -- (-1279.576) [-1281.629] (-1284.472) (-1281.043) * (-1280.070) (-1280.528) (-1280.689) [-1283.761] -- 0:00:45
318500 -- (-1281.497) (-1280.439) (-1279.991) [-1280.414] * [-1279.552] (-1280.865) (-1282.355) (-1279.943) -- 0:00:44
319000 -- [-1281.525] (-1280.812) (-1280.934) (-1281.803) * [-1279.264] (-1285.321) (-1280.969) (-1281.168) -- 0:00:44
319500 -- (-1280.335) (-1280.496) [-1281.781] (-1282.395) * (-1279.677) (-1281.290) [-1281.353] (-1282.904) -- 0:00:44
320000 -- (-1281.115) (-1280.737) (-1280.898) [-1278.141] * [-1279.071] (-1282.807) (-1280.780) (-1283.755) -- 0:00:44
Average standard deviation of split frequencies: 0.011155
320500 -- (-1278.294) (-1282.327) (-1281.029) [-1281.562] * (-1280.530) (-1280.638) (-1281.148) [-1281.524] -- 0:00:44
321000 -- [-1280.275] (-1281.541) (-1279.616) (-1282.112) * (-1280.047) [-1280.435] (-1282.867) (-1282.916) -- 0:00:44
321500 -- (-1281.505) (-1280.767) (-1280.278) [-1280.375] * (-1278.659) (-1283.118) (-1279.892) [-1282.185] -- 0:00:44
322000 -- (-1282.890) (-1281.691) (-1282.755) [-1280.068] * (-1282.648) (-1280.059) (-1277.842) [-1280.378] -- 0:00:44
322500 -- (-1280.052) (-1281.346) [-1279.712] (-1281.808) * (-1282.215) [-1281.376] (-1280.036) (-1280.715) -- 0:00:44
323000 -- (-1282.350) (-1282.563) (-1280.662) [-1279.892] * (-1281.561) [-1284.586] (-1283.634) (-1282.744) -- 0:00:44
323500 -- (-1282.964) [-1280.878] (-1278.746) (-1281.298) * (-1278.986) [-1281.087] (-1282.114) (-1281.283) -- 0:00:43
324000 -- [-1279.892] (-1280.229) (-1278.706) (-1282.800) * (-1281.565) [-1280.069] (-1278.546) (-1280.308) -- 0:00:43
324500 -- [-1278.896] (-1280.228) (-1279.983) (-1279.171) * [-1280.299] (-1280.825) (-1279.405) (-1279.264) -- 0:00:43
325000 -- [-1283.285] (-1284.023) (-1280.114) (-1280.987) * (-1280.443) [-1279.235] (-1281.113) (-1281.355) -- 0:00:43
Average standard deviation of split frequencies: 0.011483
325500 -- (-1278.947) (-1281.633) [-1279.561] (-1282.250) * [-1279.475] (-1282.030) (-1283.191) (-1282.721) -- 0:00:43
326000 -- (-1279.773) (-1283.479) (-1281.124) [-1281.254] * [-1280.939] (-1280.470) (-1281.092) (-1279.438) -- 0:00:43
326500 -- [-1281.474] (-1280.704) (-1280.331) (-1281.962) * [-1278.982] (-1280.985) (-1280.808) (-1281.593) -- 0:00:43
327000 -- (-1282.778) (-1280.312) (-1284.158) [-1282.612] * (-1278.872) [-1281.989] (-1283.556) (-1284.070) -- 0:00:43
327500 -- [-1280.590] (-1284.947) (-1278.637) (-1282.831) * [-1278.929] (-1281.749) (-1282.787) (-1283.034) -- 0:00:45
328000 -- (-1282.400) (-1290.085) (-1280.752) [-1280.669] * (-1281.406) [-1282.713] (-1281.302) (-1280.054) -- 0:00:45
328500 -- (-1286.721) (-1288.328) [-1281.636] (-1280.638) * [-1278.059] (-1279.944) (-1287.829) (-1279.402) -- 0:00:44
329000 -- (-1280.413) (-1289.616) (-1279.069) [-1282.170] * (-1281.928) [-1279.425] (-1283.486) (-1280.075) -- 0:00:44
329500 -- (-1281.572) (-1282.146) (-1279.803) [-1280.360] * (-1279.408) (-1279.000) [-1281.277] (-1281.118) -- 0:00:44
330000 -- (-1280.104) [-1282.604] (-1283.008) (-1281.019) * (-1280.080) (-1280.120) [-1279.914] (-1284.700) -- 0:00:44
Average standard deviation of split frequencies: 0.011908
330500 -- (-1280.707) (-1279.875) (-1282.255) [-1283.917] * (-1282.201) [-1281.662] (-1285.399) (-1282.451) -- 0:00:44
331000 -- [-1280.444] (-1281.656) (-1279.047) (-1281.674) * [-1278.468] (-1295.427) (-1281.174) (-1279.707) -- 0:00:44
331500 -- [-1278.460] (-1283.333) (-1282.524) (-1282.753) * [-1279.835] (-1282.685) (-1280.853) (-1282.374) -- 0:00:44
332000 -- (-1279.427) [-1281.273] (-1279.882) (-1283.357) * (-1281.271) [-1280.668] (-1280.766) (-1278.897) -- 0:00:44
332500 -- (-1280.827) [-1280.348] (-1282.578) (-1281.889) * (-1282.408) (-1286.323) (-1280.382) [-1278.365] -- 0:00:44
333000 -- [-1280.426] (-1281.461) (-1284.346) (-1280.918) * (-1284.370) [-1280.574] (-1282.822) (-1283.462) -- 0:00:44
333500 -- (-1281.215) (-1281.206) [-1280.891] (-1281.613) * (-1280.931) (-1281.183) [-1280.838] (-1281.265) -- 0:00:43
334000 -- (-1280.598) (-1281.080) [-1282.985] (-1286.742) * (-1281.805) [-1281.215] (-1280.427) (-1283.474) -- 0:00:43
334500 -- [-1279.903] (-1280.560) (-1287.749) (-1286.556) * [-1279.008] (-1282.870) (-1282.212) (-1283.912) -- 0:00:43
335000 -- (-1280.221) (-1280.150) (-1280.659) [-1279.925] * (-1279.417) [-1281.513] (-1280.507) (-1283.571) -- 0:00:43
Average standard deviation of split frequencies: 0.011925
335500 -- (-1279.903) (-1280.977) [-1282.035] (-1283.043) * (-1280.180) [-1279.470] (-1281.975) (-1282.790) -- 0:00:43
336000 -- (-1281.098) (-1280.667) [-1280.705] (-1284.143) * (-1281.486) [-1281.352] (-1282.766) (-1281.920) -- 0:00:43
336500 -- (-1282.018) (-1279.981) [-1282.178] (-1282.608) * (-1279.354) [-1279.850] (-1282.529) (-1279.279) -- 0:00:43
337000 -- [-1279.192] (-1281.196) (-1281.153) (-1280.049) * (-1280.278) (-1282.502) (-1282.588) [-1279.970] -- 0:00:43
337500 -- (-1280.919) (-1279.910) (-1280.748) [-1280.847] * (-1281.917) [-1279.453] (-1281.462) (-1281.226) -- 0:00:43
338000 -- [-1281.329] (-1279.384) (-1281.398) (-1285.327) * (-1282.773) [-1280.849] (-1287.066) (-1280.089) -- 0:00:43
338500 -- (-1280.307) [-1285.183] (-1281.759) (-1287.844) * (-1278.861) (-1282.047) (-1282.043) [-1279.554] -- 0:00:42
339000 -- (-1278.085) (-1282.663) [-1280.790] (-1283.369) * (-1280.447) (-1281.782) (-1282.198) [-1282.064] -- 0:00:42
339500 -- (-1280.698) (-1283.121) [-1280.851] (-1282.237) * (-1281.191) (-1281.607) (-1281.389) [-1277.813] -- 0:00:42
340000 -- (-1281.884) (-1281.408) (-1282.502) [-1280.424] * (-1282.123) (-1280.235) [-1282.415] (-1282.772) -- 0:00:42
Average standard deviation of split frequencies: 0.010663
340500 -- (-1283.971) [-1280.895] (-1288.996) (-1283.086) * [-1285.532] (-1281.533) (-1280.798) (-1287.601) -- 0:00:42
341000 -- (-1289.863) (-1283.265) (-1282.842) [-1286.901] * [-1280.868] (-1283.835) (-1284.491) (-1282.554) -- 0:00:42
341500 -- (-1282.591) (-1279.914) (-1283.172) [-1282.660] * [-1279.796] (-1280.709) (-1281.881) (-1280.865) -- 0:00:42
342000 -- (-1284.422) (-1280.050) [-1282.069] (-1280.742) * [-1281.673] (-1281.588) (-1284.275) (-1280.419) -- 0:00:42
342500 -- [-1280.281] (-1279.125) (-1281.628) (-1278.790) * (-1279.130) [-1284.099] (-1281.836) (-1282.556) -- 0:00:44
343000 -- [-1280.546] (-1280.777) (-1281.713) (-1281.965) * (-1284.272) (-1281.918) [-1280.842] (-1282.221) -- 0:00:44
343500 -- (-1281.896) (-1280.718) [-1280.775] (-1280.234) * (-1283.284) (-1280.612) [-1279.799] (-1281.525) -- 0:00:43
344000 -- [-1281.101] (-1281.216) (-1280.126) (-1280.373) * (-1281.697) [-1281.729] (-1286.125) (-1280.449) -- 0:00:43
344500 -- [-1280.277] (-1280.865) (-1279.274) (-1280.492) * [-1281.514] (-1283.483) (-1281.048) (-1282.203) -- 0:00:43
345000 -- (-1280.731) (-1282.768) [-1280.514] (-1279.305) * (-1281.217) [-1279.408] (-1283.777) (-1283.005) -- 0:00:43
Average standard deviation of split frequencies: 0.010980
345500 -- (-1281.355) (-1281.721) (-1281.476) [-1280.987] * [-1283.234] (-1280.290) (-1282.305) (-1280.577) -- 0:00:43
346000 -- [-1281.858] (-1287.426) (-1281.247) (-1281.137) * [-1281.212] (-1281.215) (-1279.870) (-1281.621) -- 0:00:43
346500 -- (-1281.643) (-1281.037) (-1279.897) [-1279.488] * (-1281.483) (-1278.513) (-1282.888) [-1280.219] -- 0:00:43
347000 -- (-1280.920) (-1281.370) [-1278.720] (-1281.232) * (-1281.060) [-1280.129] (-1282.995) (-1281.551) -- 0:00:43
347500 -- (-1282.154) (-1281.373) (-1280.582) [-1280.149] * (-1280.220) (-1281.390) [-1279.732] (-1282.231) -- 0:00:43
348000 -- (-1279.719) (-1281.267) (-1279.256) [-1281.526] * (-1287.772) (-1281.477) (-1279.745) [-1289.972] -- 0:00:43
348500 -- (-1278.265) (-1280.787) [-1282.428] (-1280.722) * (-1278.434) (-1281.213) (-1283.698) [-1282.242] -- 0:00:42
349000 -- (-1282.781) [-1279.982] (-1282.336) (-1280.051) * [-1281.729] (-1278.745) (-1282.711) (-1280.224) -- 0:00:42
349500 -- [-1282.531] (-1279.319) (-1282.980) (-1281.562) * [-1282.043] (-1281.156) (-1281.411) (-1281.622) -- 0:00:42
350000 -- (-1280.344) [-1279.596] (-1291.666) (-1281.035) * (-1283.811) [-1281.344] (-1281.636) (-1281.639) -- 0:00:42
Average standard deviation of split frequencies: 0.011308
350500 -- (-1278.026) [-1279.410] (-1285.888) (-1280.469) * (-1280.017) (-1279.268) [-1281.043] (-1281.869) -- 0:00:42
351000 -- (-1278.641) (-1278.940) [-1278.889] (-1280.870) * (-1278.330) (-1279.627) (-1282.987) [-1284.503] -- 0:00:42
351500 -- (-1278.890) [-1278.879] (-1281.549) (-1281.453) * [-1279.643] (-1279.767) (-1279.924) (-1280.508) -- 0:00:42
352000 -- (-1280.602) [-1281.907] (-1282.182) (-1280.157) * (-1280.906) (-1280.407) (-1280.787) [-1280.036] -- 0:00:42
352500 -- (-1280.726) [-1281.876] (-1282.172) (-1281.249) * (-1285.657) (-1278.735) (-1284.947) [-1281.290] -- 0:00:42
353000 -- [-1280.237] (-1281.894) (-1281.996) (-1285.266) * (-1279.902) [-1280.272] (-1283.646) (-1284.764) -- 0:00:42
353500 -- (-1283.148) [-1279.058] (-1280.321) (-1283.670) * [-1278.931] (-1284.622) (-1282.136) (-1280.683) -- 0:00:42
354000 -- (-1281.466) (-1281.872) [-1282.526] (-1279.669) * (-1280.311) (-1282.539) [-1284.084] (-1282.274) -- 0:00:41
354500 -- [-1280.905] (-1280.123) (-1281.586) (-1279.894) * (-1280.670) [-1282.728] (-1284.524) (-1282.782) -- 0:00:41
355000 -- [-1279.702] (-1288.736) (-1285.041) (-1280.161) * (-1281.075) (-1283.947) (-1282.541) [-1280.402] -- 0:00:41
Average standard deviation of split frequencies: 0.011528
355500 -- [-1279.610] (-1284.573) (-1283.843) (-1280.316) * (-1280.125) (-1286.262) (-1280.785) [-1282.682] -- 0:00:41
356000 -- (-1283.241) (-1280.379) (-1281.935) [-1277.803] * (-1284.026) (-1285.081) (-1282.184) [-1283.218] -- 0:00:41
356500 -- (-1282.480) (-1280.297) (-1283.250) [-1279.013] * (-1281.861) (-1281.605) (-1281.123) [-1281.180] -- 0:00:41
357000 -- (-1283.141) [-1279.085] (-1283.339) (-1280.752) * (-1282.647) [-1284.745] (-1282.363) (-1280.680) -- 0:00:41
357500 -- [-1278.316] (-1280.201) (-1280.780) (-1281.817) * (-1283.610) [-1281.038] (-1280.321) (-1280.675) -- 0:00:43
358000 -- [-1278.591] (-1284.311) (-1282.996) (-1282.160) * [-1279.062] (-1279.563) (-1282.687) (-1283.563) -- 0:00:43
358500 -- (-1281.657) [-1280.872] (-1284.410) (-1280.883) * [-1279.190] (-1279.173) (-1283.310) (-1285.028) -- 0:00:42
359000 -- (-1279.776) (-1279.148) (-1280.936) [-1279.482] * [-1281.004] (-1281.618) (-1280.419) (-1282.112) -- 0:00:42
359500 -- (-1279.628) [-1281.524] (-1278.831) (-1281.406) * (-1282.873) (-1279.878) [-1280.676] (-1283.601) -- 0:00:42
360000 -- [-1279.521] (-1281.483) (-1281.573) (-1279.761) * (-1280.778) [-1279.616] (-1278.876) (-1281.980) -- 0:00:42
Average standard deviation of split frequencies: 0.011600
360500 -- (-1279.910) [-1281.251] (-1281.081) (-1280.266) * (-1283.148) (-1279.254) (-1282.042) [-1281.322] -- 0:00:42
361000 -- [-1282.034] (-1281.272) (-1280.252) (-1280.553) * (-1283.534) (-1280.333) [-1282.888] (-1280.853) -- 0:00:42
361500 -- (-1281.720) (-1280.494) [-1279.009] (-1279.939) * (-1281.051) (-1280.107) [-1282.514] (-1285.534) -- 0:00:42
362000 -- (-1280.373) (-1280.124) (-1281.850) [-1279.766] * (-1278.921) [-1279.439] (-1285.919) (-1281.645) -- 0:00:42
362500 -- (-1281.906) (-1279.514) [-1281.868] (-1284.820) * (-1279.627) (-1280.953) [-1280.369] (-1282.167) -- 0:00:42
363000 -- (-1281.253) [-1281.905] (-1282.235) (-1280.370) * (-1280.749) (-1279.239) [-1279.871] (-1282.809) -- 0:00:42
363500 -- [-1280.930] (-1278.952) (-1283.187) (-1280.553) * (-1278.815) (-1281.320) (-1283.507) [-1282.636] -- 0:00:42
364000 -- (-1279.781) [-1280.203] (-1283.861) (-1283.065) * (-1281.367) (-1279.904) (-1280.505) [-1281.644] -- 0:00:41
364500 -- [-1279.725] (-1281.801) (-1281.608) (-1283.218) * (-1280.053) (-1281.203) (-1281.221) [-1280.444] -- 0:00:41
365000 -- (-1284.383) (-1280.618) (-1279.556) [-1281.220] * [-1282.840] (-1282.821) (-1278.708) (-1282.758) -- 0:00:41
Average standard deviation of split frequencies: 0.010759
365500 -- (-1282.676) [-1278.896] (-1281.019) (-1278.280) * (-1280.001) (-1282.071) [-1278.548] (-1282.217) -- 0:00:41
366000 -- (-1281.766) (-1280.998) [-1282.946] (-1281.448) * (-1283.375) [-1279.283] (-1278.953) (-1281.744) -- 0:00:41
366500 -- (-1281.920) (-1279.547) [-1282.950] (-1281.533) * [-1277.328] (-1281.167) (-1282.781) (-1280.845) -- 0:00:41
367000 -- (-1280.982) [-1281.217] (-1281.394) (-1283.498) * [-1279.194] (-1283.027) (-1282.577) (-1282.356) -- 0:00:41
367500 -- (-1279.313) (-1279.378) [-1281.816] (-1281.100) * (-1282.546) (-1280.488) [-1281.811] (-1286.054) -- 0:00:41
368000 -- (-1279.461) (-1278.935) [-1278.675] (-1278.889) * [-1279.590] (-1280.585) (-1280.658) (-1284.095) -- 0:00:41
368500 -- (-1279.219) (-1279.534) (-1283.123) [-1278.775] * [-1280.740] (-1283.900) (-1281.345) (-1280.502) -- 0:00:41
369000 -- (-1282.135) (-1280.878) (-1282.970) [-1278.792] * (-1279.815) (-1282.223) [-1282.472] (-1280.050) -- 0:00:41
369500 -- (-1282.947) (-1280.389) (-1282.298) [-1279.460] * (-1280.583) [-1278.992] (-1283.313) (-1281.664) -- 0:00:40
370000 -- (-1278.749) (-1280.289) (-1283.796) [-1281.293] * (-1279.415) (-1282.866) (-1282.628) [-1280.761] -- 0:00:40
Average standard deviation of split frequencies: 0.010025
370500 -- (-1287.819) (-1280.225) [-1287.301] (-1280.472) * (-1280.152) (-1281.863) [-1280.154] (-1280.572) -- 0:00:40
371000 -- (-1281.180) [-1283.534] (-1284.652) (-1283.527) * (-1280.058) (-1280.036) [-1282.026] (-1283.651) -- 0:00:40
371500 -- (-1279.175) (-1280.044) (-1281.936) [-1281.339] * [-1282.230] (-1282.379) (-1280.907) (-1286.042) -- 0:00:40
372000 -- [-1280.947] (-1280.552) (-1280.293) (-1281.017) * (-1279.586) [-1284.980] (-1281.018) (-1282.522) -- 0:00:40
372500 -- [-1281.222] (-1279.616) (-1285.293) (-1281.299) * (-1279.650) (-1282.122) [-1281.807] (-1282.688) -- 0:00:42
373000 -- (-1281.073) [-1279.865] (-1285.408) (-1284.922) * (-1281.161) [-1280.750] (-1282.309) (-1281.031) -- 0:00:42
373500 -- (-1282.779) (-1281.671) (-1282.919) [-1284.700] * (-1280.744) [-1280.283] (-1280.243) (-1281.613) -- 0:00:41
374000 -- (-1282.186) [-1281.625] (-1281.116) (-1280.863) * (-1280.515) (-1279.406) (-1285.236) [-1282.026] -- 0:00:41
374500 -- [-1281.695] (-1285.468) (-1280.914) (-1283.033) * [-1281.807] (-1284.203) (-1281.140) (-1281.837) -- 0:00:41
375000 -- (-1283.858) (-1283.360) [-1284.843] (-1282.644) * [-1280.452] (-1279.406) (-1280.490) (-1282.678) -- 0:00:41
Average standard deviation of split frequencies: 0.009246
375500 -- (-1281.078) (-1281.996) (-1280.521) [-1283.360] * (-1279.319) (-1280.209) [-1280.280] (-1284.403) -- 0:00:41
376000 -- [-1280.773] (-1283.281) (-1284.059) (-1282.451) * (-1281.516) [-1282.166] (-1280.126) (-1279.573) -- 0:00:41
376500 -- (-1278.704) [-1279.841] (-1283.745) (-1281.383) * (-1282.057) [-1281.796] (-1281.676) (-1280.254) -- 0:00:41
377000 -- [-1281.441] (-1279.635) (-1281.466) (-1282.590) * (-1282.830) [-1280.417] (-1282.297) (-1288.064) -- 0:00:41
377500 -- (-1283.805) (-1282.354) [-1283.268] (-1281.745) * (-1281.023) (-1281.094) [-1282.310] (-1282.958) -- 0:00:41
378000 -- (-1279.222) (-1282.221) [-1281.724] (-1280.213) * [-1279.625] (-1282.791) (-1280.063) (-1281.904) -- 0:00:41
378500 -- (-1282.238) (-1280.729) (-1280.455) [-1278.042] * (-1280.358) [-1281.794] (-1284.056) (-1284.209) -- 0:00:41
379000 -- (-1278.895) [-1281.474] (-1280.497) (-1282.971) * (-1281.708) (-1283.774) (-1280.775) [-1280.086] -- 0:00:40
379500 -- [-1279.488] (-1279.688) (-1282.030) (-1283.765) * (-1285.811) (-1282.792) (-1281.424) [-1279.757] -- 0:00:40
380000 -- (-1283.219) (-1282.034) [-1285.014] (-1280.353) * (-1284.336) (-1280.653) [-1282.315] (-1279.925) -- 0:00:40
Average standard deviation of split frequencies: 0.008978
380500 -- (-1282.401) [-1280.730] (-1282.725) (-1281.856) * (-1281.587) [-1280.955] (-1280.481) (-1283.996) -- 0:00:40
381000 -- (-1279.057) (-1280.165) [-1280.564] (-1280.335) * (-1283.110) (-1286.844) [-1280.824] (-1283.671) -- 0:00:40
381500 -- (-1280.767) [-1278.357] (-1281.563) (-1280.166) * (-1282.963) [-1281.520] (-1282.295) (-1281.380) -- 0:00:40
382000 -- [-1281.264] (-1281.452) (-1281.555) (-1280.845) * (-1280.960) (-1280.481) (-1282.030) [-1279.707] -- 0:00:40
382500 -- (-1280.832) (-1279.799) (-1281.422) [-1278.878] * [-1278.469] (-1283.131) (-1281.240) (-1278.296) -- 0:00:40
383000 -- (-1279.176) [-1281.357] (-1281.434) (-1281.642) * (-1279.834) (-1282.678) [-1281.843] (-1278.243) -- 0:00:40
383500 -- (-1282.041) (-1282.935) [-1280.483] (-1278.922) * [-1280.472] (-1281.052) (-1283.986) (-1281.052) -- 0:00:40
384000 -- (-1279.692) (-1281.036) [-1281.064] (-1280.536) * (-1280.893) (-1280.767) [-1280.414] (-1279.317) -- 0:00:40
384500 -- [-1281.424] (-1284.839) (-1281.920) (-1281.111) * (-1280.131) (-1281.439) [-1279.902] (-1280.391) -- 0:00:40
385000 -- [-1279.848] (-1279.940) (-1281.839) (-1279.982) * [-1283.633] (-1290.224) (-1280.452) (-1282.479) -- 0:00:39
Average standard deviation of split frequencies: 0.010075
385500 -- (-1281.077) (-1283.202) (-1280.062) [-1282.670] * (-1284.152) [-1280.358] (-1280.135) (-1282.215) -- 0:00:39
386000 -- (-1281.948) (-1283.207) (-1282.066) [-1280.729] * (-1280.614) [-1280.352] (-1281.262) (-1281.754) -- 0:00:39
386500 -- (-1280.776) (-1281.654) [-1282.462] (-1281.643) * [-1280.418] (-1280.057) (-1281.696) (-1284.708) -- 0:00:39
387000 -- (-1281.609) (-1277.933) [-1280.936] (-1281.254) * (-1281.532) [-1279.113] (-1280.856) (-1282.330) -- 0:00:39
387500 -- (-1281.938) (-1283.980) (-1280.099) [-1279.353] * (-1279.025) (-1281.304) (-1281.231) [-1281.230] -- 0:00:39
388000 -- (-1279.742) (-1284.684) (-1280.409) [-1281.462] * (-1280.041) [-1280.445] (-1281.200) (-1282.531) -- 0:00:41
388500 -- (-1279.003) [-1283.731] (-1279.425) (-1281.558) * (-1279.078) (-1280.127) [-1282.384] (-1280.800) -- 0:00:40
389000 -- (-1279.650) (-1284.019) [-1280.614] (-1281.029) * (-1282.317) [-1281.116] (-1283.788) (-1284.924) -- 0:00:40
389500 -- [-1279.789] (-1284.617) (-1281.682) (-1281.136) * (-1281.741) (-1280.859) (-1281.287) [-1281.522] -- 0:00:40
390000 -- [-1279.789] (-1283.735) (-1281.339) (-1283.593) * (-1282.484) (-1283.772) [-1280.909] (-1280.115) -- 0:00:40
Average standard deviation of split frequencies: 0.010257
390500 -- (-1281.229) [-1279.100] (-1282.154) (-1285.193) * (-1283.746) (-1282.872) (-1280.729) [-1280.479] -- 0:00:40
391000 -- (-1281.701) [-1280.928] (-1281.283) (-1282.531) * (-1282.298) (-1281.731) (-1283.866) [-1280.996] -- 0:00:40
391500 -- (-1281.409) (-1281.627) (-1279.437) [-1281.259] * (-1280.164) (-1282.818) [-1281.023] (-1281.132) -- 0:00:40
392000 -- (-1280.177) [-1281.637] (-1281.033) (-1280.968) * [-1281.425] (-1283.737) (-1281.075) (-1278.521) -- 0:00:40
392500 -- [-1280.139] (-1278.524) (-1283.367) (-1282.226) * (-1282.492) (-1281.107) [-1283.237] (-1280.383) -- 0:00:40
393000 -- (-1281.288) (-1278.186) (-1284.893) [-1280.952] * (-1281.944) [-1280.127] (-1279.717) (-1287.338) -- 0:00:40
393500 -- (-1280.312) (-1279.653) (-1284.942) [-1279.432] * [-1279.840] (-1281.041) (-1282.761) (-1280.386) -- 0:00:40
394000 -- [-1279.927] (-1279.926) (-1280.878) (-1282.643) * (-1280.170) [-1280.350] (-1287.536) (-1281.546) -- 0:00:39
394500 -- (-1280.599) (-1278.168) [-1278.344] (-1281.303) * (-1280.004) [-1278.998] (-1281.876) (-1278.424) -- 0:00:39
395000 -- (-1281.729) (-1279.817) [-1281.704] (-1281.826) * (-1281.852) [-1279.966] (-1282.436) (-1278.860) -- 0:00:39
Average standard deviation of split frequencies: 0.009375
395500 -- (-1284.722) [-1280.318] (-1283.940) (-1281.054) * (-1281.069) [-1280.589] (-1283.594) (-1280.087) -- 0:00:39
396000 -- (-1281.905) (-1283.740) (-1284.242) [-1283.953] * [-1280.401] (-1282.647) (-1284.190) (-1281.879) -- 0:00:39
396500 -- (-1279.627) [-1280.969] (-1282.490) (-1286.856) * (-1280.575) (-1280.291) (-1286.982) [-1280.693] -- 0:00:39
397000 -- (-1282.424) (-1278.540) [-1282.708] (-1279.984) * [-1279.223] (-1283.473) (-1283.199) (-1281.271) -- 0:00:39
397500 -- (-1278.568) (-1285.632) [-1286.418] (-1281.572) * [-1283.539] (-1283.530) (-1288.774) (-1280.447) -- 0:00:39
398000 -- (-1279.991) [-1280.605] (-1282.619) (-1279.512) * (-1281.156) (-1280.904) [-1282.291] (-1280.089) -- 0:00:39
398500 -- (-1280.010) (-1279.300) [-1283.477] (-1281.994) * (-1281.213) (-1279.368) [-1281.979] (-1279.867) -- 0:00:39
399000 -- [-1280.665] (-1279.087) (-1282.009) (-1280.968) * (-1281.341) (-1282.499) (-1283.774) [-1281.902] -- 0:00:39
399500 -- (-1280.810) [-1279.418] (-1280.849) (-1281.551) * [-1279.150] (-1281.865) (-1282.113) (-1280.920) -- 0:00:39
400000 -- (-1281.397) (-1282.634) (-1282.186) [-1281.432] * [-1281.584] (-1283.438) (-1281.313) (-1284.082) -- 0:00:39
Average standard deviation of split frequencies: 0.009559
400500 -- [-1281.175] (-1281.177) (-1281.399) (-1281.153) * (-1280.316) [-1282.781] (-1282.774) (-1280.984) -- 0:00:38
401000 -- (-1281.393) (-1286.646) [-1280.146] (-1281.735) * (-1281.568) (-1281.157) (-1280.674) [-1280.214] -- 0:00:38
401500 -- (-1280.246) (-1284.551) (-1280.492) [-1277.896] * (-1281.070) (-1280.938) (-1281.423) [-1282.370] -- 0:00:38
402000 -- (-1281.281) (-1282.082) (-1282.722) [-1286.541] * [-1280.912] (-1284.501) (-1281.825) (-1280.870) -- 0:00:38
402500 -- [-1281.452] (-1283.228) (-1280.595) (-1282.599) * (-1281.173) [-1284.133] (-1282.202) (-1277.473) -- 0:00:38
403000 -- [-1281.051] (-1282.935) (-1280.049) (-1285.434) * (-1280.032) (-1283.312) [-1282.686] (-1282.919) -- 0:00:39
403500 -- (-1278.760) (-1280.554) (-1282.091) [-1282.015] * (-1279.443) (-1282.114) (-1281.192) [-1281.804] -- 0:00:39
404000 -- (-1280.411) [-1280.179] (-1280.077) (-1281.859) * [-1279.238] (-1279.735) (-1277.527) (-1281.993) -- 0:00:39
404500 -- (-1280.263) (-1281.927) [-1281.837] (-1282.309) * (-1281.869) (-1279.128) [-1283.703] (-1282.249) -- 0:00:39
405000 -- (-1278.552) (-1281.298) [-1281.855] (-1279.327) * (-1280.971) (-1280.102) (-1284.936) [-1280.699] -- 0:00:39
Average standard deviation of split frequencies: 0.009972
405500 -- (-1280.248) (-1281.034) (-1280.597) [-1278.859] * [-1285.400] (-1280.655) (-1280.001) (-1280.619) -- 0:00:39
406000 -- (-1282.075) (-1282.393) (-1279.983) [-1281.426] * (-1281.781) (-1281.260) [-1281.419] (-1279.405) -- 0:00:39
406500 -- (-1281.960) [-1282.893] (-1280.436) (-1281.141) * (-1282.992) (-1280.061) (-1283.999) [-1279.828] -- 0:00:39
407000 -- (-1281.383) (-1283.922) (-1281.500) [-1279.828] * (-1280.844) (-1284.140) [-1279.984] (-1280.570) -- 0:00:39
407500 -- [-1281.382] (-1281.755) (-1282.241) (-1281.086) * [-1280.572] (-1281.764) (-1281.713) (-1282.078) -- 0:00:39
408000 -- (-1282.969) (-1282.551) (-1281.965) [-1282.368] * [-1280.157] (-1282.533) (-1282.298) (-1283.089) -- 0:00:39
408500 -- [-1281.899] (-1280.545) (-1281.606) (-1281.197) * [-1282.133] (-1279.551) (-1281.433) (-1279.597) -- 0:00:39
409000 -- (-1280.597) (-1284.019) [-1282.965] (-1282.705) * (-1281.019) (-1281.922) (-1280.601) [-1281.884] -- 0:00:39
409500 -- [-1279.911] (-1281.270) (-1281.083) (-1282.387) * (-1280.664) (-1280.681) [-1284.669] (-1282.816) -- 0:00:38
410000 -- (-1281.901) (-1281.039) [-1280.491] (-1281.779) * (-1280.063) [-1282.847] (-1279.657) (-1281.468) -- 0:00:38
Average standard deviation of split frequencies: 0.009318
410500 -- (-1281.092) [-1282.062] (-1280.297) (-1282.288) * [-1279.601] (-1280.916) (-1281.479) (-1281.817) -- 0:00:38
411000 -- (-1280.941) [-1278.671] (-1280.979) (-1281.984) * (-1284.369) (-1280.701) [-1280.718] (-1281.415) -- 0:00:38
411500 -- (-1281.200) (-1280.936) (-1286.211) [-1278.674] * [-1281.675] (-1280.823) (-1285.153) (-1282.292) -- 0:00:38
412000 -- (-1281.057) (-1280.283) [-1282.018] (-1281.922) * (-1283.511) [-1282.462] (-1281.814) (-1282.508) -- 0:00:38
412500 -- [-1286.263] (-1280.838) (-1283.109) (-1285.969) * (-1280.803) (-1280.747) (-1281.131) [-1279.133] -- 0:00:38
413000 -- [-1282.158] (-1285.259) (-1286.912) (-1284.028) * (-1283.509) (-1286.064) (-1281.904) [-1278.438] -- 0:00:38
413500 -- [-1279.742] (-1278.833) (-1282.610) (-1284.577) * (-1282.554) [-1284.732] (-1283.271) (-1280.511) -- 0:00:38
414000 -- [-1281.120] (-1281.701) (-1281.242) (-1282.908) * [-1281.589] (-1286.083) (-1280.567) (-1283.536) -- 0:00:38
414500 -- [-1280.943] (-1283.075) (-1281.523) (-1279.753) * (-1285.195) (-1280.735) (-1281.911) [-1279.711] -- 0:00:38
415000 -- (-1278.917) (-1283.142) (-1284.856) [-1280.230] * (-1282.226) (-1281.010) (-1280.212) [-1278.598] -- 0:00:38
Average standard deviation of split frequencies: 0.009265
415500 -- [-1281.674] (-1284.900) (-1283.459) (-1279.002) * (-1283.300) [-1281.451] (-1280.931) (-1284.547) -- 0:00:37
416000 -- (-1281.475) [-1278.664] (-1280.569) (-1279.894) * (-1279.356) (-1279.325) [-1281.119] (-1280.670) -- 0:00:37
416500 -- [-1284.312] (-1282.050) (-1282.481) (-1280.587) * (-1282.948) (-1284.323) (-1281.117) [-1282.844] -- 0:00:37
417000 -- (-1280.024) (-1283.497) (-1279.042) [-1280.611] * (-1279.905) [-1283.606] (-1281.002) (-1280.623) -- 0:00:37
417500 -- (-1282.072) [-1280.051] (-1279.229) (-1280.583) * (-1281.687) (-1280.949) [-1280.438] (-1282.331) -- 0:00:39
418000 -- (-1281.317) (-1280.772) (-1280.196) [-1280.535] * (-1280.090) (-1284.484) [-1281.157] (-1280.438) -- 0:00:38
418500 -- (-1280.144) (-1282.875) [-1282.812] (-1281.349) * (-1284.138) (-1284.437) (-1284.447) [-1278.952] -- 0:00:38
419000 -- [-1280.933] (-1281.187) (-1283.427) (-1281.981) * [-1282.266] (-1283.751) (-1280.639) (-1282.287) -- 0:00:38
419500 -- [-1280.409] (-1284.335) (-1280.009) (-1280.286) * [-1280.778] (-1282.616) (-1280.837) (-1281.212) -- 0:00:38
420000 -- (-1284.591) [-1283.258] (-1280.451) (-1280.331) * (-1281.908) (-1281.811) [-1280.617] (-1280.995) -- 0:00:38
Average standard deviation of split frequencies: 0.009690
420500 -- (-1285.650) (-1285.494) [-1281.193] (-1283.257) * (-1280.566) (-1280.931) [-1281.600] (-1281.470) -- 0:00:38
421000 -- (-1281.564) (-1284.500) (-1280.324) [-1281.217] * (-1279.314) (-1280.815) (-1282.145) [-1278.889] -- 0:00:38
421500 -- (-1281.934) (-1284.978) (-1284.047) [-1279.189] * [-1279.747] (-1282.689) (-1280.228) (-1281.787) -- 0:00:38
422000 -- (-1280.295) (-1282.078) (-1279.652) [-1280.509] * [-1280.889] (-1281.680) (-1280.526) (-1282.838) -- 0:00:38
422500 -- (-1277.758) [-1285.098] (-1281.072) (-1282.988) * (-1278.343) (-1281.247) (-1281.448) [-1283.219] -- 0:00:38
423000 -- (-1280.543) (-1282.550) (-1285.987) [-1283.120] * (-1280.628) [-1281.883] (-1282.351) (-1280.812) -- 0:00:38
423500 -- (-1280.374) [-1281.862] (-1284.958) (-1285.520) * (-1281.817) (-1281.414) (-1280.845) [-1279.794] -- 0:00:38
424000 -- (-1282.611) (-1281.584) (-1288.722) [-1280.298] * [-1281.235] (-1281.681) (-1282.064) (-1279.842) -- 0:00:38
424500 -- (-1281.048) (-1280.563) (-1280.176) [-1278.514] * (-1285.011) (-1281.139) [-1288.790] (-1281.157) -- 0:00:37
425000 -- (-1284.758) (-1282.720) [-1280.978] (-1280.423) * (-1282.007) (-1283.127) (-1286.313) [-1279.356] -- 0:00:37
Average standard deviation of split frequencies: 0.009829
425500 -- [-1281.891] (-1281.102) (-1282.382) (-1281.845) * (-1282.301) (-1284.286) (-1281.399) [-1282.195] -- 0:00:37
426000 -- [-1282.343] (-1280.061) (-1282.232) (-1280.251) * (-1282.563) (-1280.581) (-1282.569) [-1279.377] -- 0:00:37
426500 -- [-1282.973] (-1283.066) (-1283.715) (-1279.721) * (-1282.926) [-1281.613] (-1280.175) (-1281.935) -- 0:00:37
427000 -- (-1283.235) (-1282.430) [-1279.884] (-1280.927) * (-1282.777) [-1279.655] (-1284.971) (-1282.202) -- 0:00:37
427500 -- (-1284.161) (-1284.205) [-1278.644] (-1281.283) * [-1279.492] (-1279.210) (-1281.574) (-1285.609) -- 0:00:37
428000 -- (-1281.548) (-1280.967) [-1278.652] (-1280.882) * (-1283.195) [-1279.596] (-1280.393) (-1282.194) -- 0:00:37
428500 -- (-1279.544) (-1282.912) (-1284.672) [-1282.973] * (-1283.337) [-1280.138] (-1279.995) (-1283.664) -- 0:00:37
429000 -- [-1284.268] (-1281.372) (-1282.721) (-1282.127) * [-1281.979] (-1281.128) (-1283.510) (-1283.830) -- 0:00:37
429500 -- (-1282.118) (-1281.531) (-1281.239) [-1278.052] * (-1285.593) [-1280.470] (-1279.046) (-1282.432) -- 0:00:37
430000 -- (-1281.451) (-1281.592) [-1279.170] (-1277.816) * (-1280.589) [-1283.055] (-1284.843) (-1281.725) -- 0:00:37
Average standard deviation of split frequencies: 0.009143
430500 -- (-1287.974) (-1280.166) (-1279.466) [-1281.661] * [-1282.207] (-1284.578) (-1283.789) (-1279.910) -- 0:00:37
431000 -- (-1280.732) (-1280.839) (-1284.232) [-1280.926] * (-1282.311) (-1283.233) (-1280.743) [-1280.841] -- 0:00:36
431500 -- (-1280.353) [-1282.447] (-1280.796) (-1282.138) * (-1282.590) [-1278.392] (-1283.264) (-1280.366) -- 0:00:36
432000 -- (-1280.794) (-1281.312) (-1279.817) [-1283.043] * [-1280.319] (-1277.951) (-1282.406) (-1281.739) -- 0:00:38
432500 -- (-1285.925) (-1284.488) [-1280.461] (-1281.623) * (-1282.549) (-1281.195) [-1281.986] (-1282.278) -- 0:00:38
433000 -- [-1279.192] (-1290.444) (-1280.066) (-1280.335) * (-1278.943) (-1277.910) [-1280.948] (-1283.021) -- 0:00:37
433500 -- (-1281.168) [-1280.062] (-1280.005) (-1280.198) * (-1279.292) (-1279.620) (-1283.370) [-1282.350] -- 0:00:37
434000 -- (-1278.781) (-1282.686) (-1282.016) [-1281.493] * (-1282.063) [-1279.615] (-1286.040) (-1280.298) -- 0:00:37
434500 -- [-1279.920] (-1284.349) (-1279.367) (-1279.526) * (-1282.037) (-1282.778) (-1284.087) [-1281.046] -- 0:00:37
435000 -- (-1280.935) (-1282.053) [-1281.869] (-1282.442) * (-1279.935) [-1279.973] (-1281.580) (-1278.266) -- 0:00:37
Average standard deviation of split frequencies: 0.009222
435500 -- (-1281.831) (-1280.636) [-1283.045] (-1280.869) * (-1281.741) (-1280.973) (-1281.224) [-1279.366] -- 0:00:37
436000 -- (-1282.542) (-1280.262) [-1285.553] (-1280.747) * (-1281.330) (-1279.906) (-1281.980) [-1282.047] -- 0:00:37
436500 -- (-1283.339) (-1281.489) [-1280.635] (-1280.492) * [-1283.231] (-1282.880) (-1289.198) (-1278.351) -- 0:00:37
437000 -- (-1282.304) (-1287.714) [-1278.927] (-1280.544) * [-1279.414] (-1282.821) (-1286.257) (-1279.801) -- 0:00:37
437500 -- [-1281.256] (-1281.079) (-1280.243) (-1280.146) * (-1278.426) (-1281.167) [-1282.242] (-1283.871) -- 0:00:37
438000 -- [-1280.357] (-1280.488) (-1280.020) (-1283.396) * (-1278.965) [-1282.742] (-1282.012) (-1279.736) -- 0:00:37
438500 -- (-1282.606) (-1282.820) (-1280.872) [-1279.021] * (-1278.398) [-1282.088] (-1281.349) (-1280.641) -- 0:00:37
439000 -- (-1285.026) [-1279.241] (-1283.204) (-1280.287) * [-1280.437] (-1279.543) (-1281.148) (-1279.832) -- 0:00:37
439500 -- (-1279.842) (-1281.672) [-1284.370] (-1280.615) * (-1283.192) (-1282.920) [-1283.037] (-1282.240) -- 0:00:36
440000 -- (-1286.545) (-1283.112) [-1281.562] (-1282.843) * [-1282.997] (-1279.879) (-1281.844) (-1284.537) -- 0:00:36
Average standard deviation of split frequencies: 0.008810
440500 -- [-1283.188] (-1283.720) (-1284.476) (-1280.849) * (-1284.768) (-1282.551) (-1281.872) [-1281.876] -- 0:00:36
441000 -- (-1279.449) [-1278.893] (-1281.731) (-1282.340) * (-1280.875) (-1280.292) [-1282.167] (-1283.860) -- 0:00:36
441500 -- (-1282.238) (-1281.649) (-1283.288) [-1280.587] * (-1281.294) (-1281.376) [-1282.125] (-1279.381) -- 0:00:36
442000 -- (-1284.741) (-1282.034) (-1281.905) [-1281.530] * (-1281.575) (-1284.512) (-1280.568) [-1280.483] -- 0:00:36
442500 -- (-1280.849) (-1279.043) [-1280.906] (-1280.378) * (-1284.432) (-1281.356) (-1282.012) [-1279.487] -- 0:00:36
443000 -- (-1281.301) [-1280.267] (-1280.115) (-1280.535) * [-1284.448] (-1281.356) (-1281.962) (-1285.046) -- 0:00:36
443500 -- (-1279.068) (-1283.383) (-1284.515) [-1281.598] * (-1282.433) [-1277.352] (-1282.174) (-1281.604) -- 0:00:36
444000 -- [-1280.305] (-1281.485) (-1281.373) (-1282.509) * (-1282.824) [-1282.350] (-1282.178) (-1279.920) -- 0:00:36
444500 -- [-1280.212] (-1285.072) (-1282.358) (-1282.035) * (-1283.928) (-1281.836) (-1280.782) [-1283.977] -- 0:00:36
445000 -- (-1282.954) (-1283.950) [-1282.867] (-1281.838) * [-1280.723] (-1282.906) (-1280.765) (-1281.823) -- 0:00:36
Average standard deviation of split frequencies: 0.008207
445500 -- (-1279.054) (-1283.803) (-1280.791) [-1282.008] * (-1283.719) [-1281.945] (-1280.672) (-1281.122) -- 0:00:36
446000 -- (-1283.578) (-1281.797) (-1282.980) [-1283.256] * (-1284.793) [-1279.979] (-1286.815) (-1282.120) -- 0:00:36
446500 -- (-1279.383) (-1281.204) [-1283.136] (-1280.621) * [-1283.117] (-1281.372) (-1288.158) (-1279.111) -- 0:00:35
447000 -- (-1286.336) [-1281.192] (-1281.291) (-1281.501) * (-1280.822) (-1280.292) (-1281.156) [-1279.401] -- 0:00:37
447500 -- (-1279.055) (-1282.623) [-1282.827] (-1283.368) * (-1281.564) [-1279.888] (-1282.746) (-1282.612) -- 0:00:37
448000 -- (-1282.951) [-1286.350] (-1282.893) (-1281.051) * (-1281.981) (-1282.874) [-1281.474] (-1283.177) -- 0:00:36
448500 -- [-1281.021] (-1282.477) (-1282.451) (-1281.510) * [-1280.926] (-1280.934) (-1282.159) (-1278.801) -- 0:00:36
449000 -- (-1280.228) [-1279.264] (-1282.026) (-1280.827) * (-1280.216) (-1280.689) (-1282.490) [-1278.120] -- 0:00:36
449500 -- (-1280.556) [-1280.433] (-1282.901) (-1283.240) * [-1283.612] (-1284.381) (-1282.416) (-1278.924) -- 0:00:36
450000 -- (-1281.748) [-1281.265] (-1282.438) (-1280.374) * (-1282.301) [-1281.282] (-1282.727) (-1282.721) -- 0:00:36
Average standard deviation of split frequencies: 0.007999
450500 -- (-1279.726) [-1289.211] (-1281.262) (-1281.039) * (-1282.925) (-1282.220) (-1282.015) [-1279.287] -- 0:00:36
451000 -- (-1282.370) [-1281.464] (-1281.965) (-1283.882) * (-1283.347) (-1281.963) (-1281.572) [-1282.417] -- 0:00:36
451500 -- (-1277.325) (-1281.043) [-1281.025] (-1283.426) * [-1278.108] (-1279.713) (-1280.496) (-1284.028) -- 0:00:36
452000 -- [-1280.343] (-1285.123) (-1280.855) (-1284.528) * (-1278.934) [-1280.567] (-1282.682) (-1282.034) -- 0:00:36
452500 -- (-1279.340) (-1284.282) (-1280.835) [-1280.882] * [-1285.351] (-1280.580) (-1281.218) (-1281.176) -- 0:00:36
453000 -- (-1279.496) (-1282.880) [-1280.716] (-1280.872) * [-1282.377] (-1290.659) (-1281.770) (-1284.711) -- 0:00:36
453500 -- (-1279.743) (-1280.834) (-1281.856) [-1281.454] * (-1281.054) (-1286.009) (-1280.862) [-1282.813] -- 0:00:36
454000 -- (-1280.960) (-1281.076) [-1280.441] (-1281.398) * [-1282.608] (-1280.039) (-1285.316) (-1280.350) -- 0:00:36
454500 -- (-1284.728) (-1282.966) (-1281.328) [-1280.985] * [-1280.430] (-1279.040) (-1286.300) (-1282.936) -- 0:00:36
455000 -- (-1283.410) (-1281.211) [-1283.351] (-1279.579) * [-1280.101] (-1284.326) (-1282.797) (-1282.618) -- 0:00:35
Average standard deviation of split frequencies: 0.008399
455500 -- (-1283.734) (-1281.939) (-1280.974) [-1281.715] * (-1282.969) (-1281.213) [-1280.944] (-1279.911) -- 0:00:35
456000 -- (-1279.293) (-1284.360) [-1279.464] (-1280.942) * (-1281.475) (-1279.744) [-1281.299] (-1285.183) -- 0:00:35
456500 -- [-1278.409] (-1283.168) (-1281.045) (-1281.865) * [-1278.232] (-1284.583) (-1282.745) (-1280.753) -- 0:00:35
457000 -- (-1280.077) [-1280.389] (-1279.971) (-1281.649) * (-1282.053) (-1281.471) (-1281.152) [-1281.916] -- 0:00:35
457500 -- [-1282.770] (-1282.907) (-1281.426) (-1280.225) * [-1285.165] (-1280.490) (-1280.917) (-1279.852) -- 0:00:35
458000 -- [-1281.770] (-1283.452) (-1281.061) (-1281.513) * (-1285.160) (-1280.885) (-1281.931) [-1280.873] -- 0:00:35
458500 -- [-1282.546] (-1285.793) (-1279.683) (-1279.001) * (-1280.806) [-1279.779] (-1283.945) (-1280.767) -- 0:00:35
459000 -- (-1284.671) (-1283.079) [-1279.597] (-1279.743) * (-1278.546) (-1280.961) (-1281.138) [-1282.541] -- 0:00:35
459500 -- (-1281.782) (-1281.175) [-1280.033] (-1280.663) * (-1280.524) [-1284.700] (-1281.168) (-1282.412) -- 0:00:35
460000 -- (-1280.329) (-1282.141) (-1280.827) [-1281.827] * (-1283.805) [-1280.498] (-1281.241) (-1280.480) -- 0:00:35
Average standard deviation of split frequencies: 0.008314
460500 -- (-1282.417) (-1282.697) (-1279.876) [-1279.677] * (-1286.328) (-1284.871) [-1280.024] (-1280.454) -- 0:00:35
461000 -- (-1285.773) (-1281.385) (-1280.227) [-1278.235] * (-1284.281) [-1281.013] (-1282.230) (-1280.204) -- 0:00:35
461500 -- (-1283.280) (-1284.636) (-1280.529) [-1285.904] * (-1280.732) (-1280.941) (-1282.389) [-1278.636] -- 0:00:35
462000 -- (-1288.256) [-1281.800] (-1279.225) (-1278.259) * (-1281.151) (-1283.776) (-1282.505) [-1280.120] -- 0:00:36
462500 -- (-1283.073) (-1279.593) (-1279.844) [-1281.515] * (-1282.174) (-1281.361) [-1281.536] (-1281.985) -- 0:00:36
463000 -- (-1281.084) [-1281.096] (-1281.850) (-1281.455) * (-1285.543) [-1282.516] (-1281.936) (-1282.587) -- 0:00:35
463500 -- (-1279.677) (-1283.373) [-1277.923] (-1278.966) * (-1286.171) (-1278.669) [-1280.536] (-1283.939) -- 0:00:35
464000 -- (-1282.206) [-1281.224] (-1279.800) (-1279.024) * (-1282.173) [-1279.814] (-1281.215) (-1281.934) -- 0:00:35
464500 -- [-1282.156] (-1279.582) (-1282.226) (-1280.362) * (-1279.897) (-1283.042) [-1279.815] (-1284.460) -- 0:00:35
465000 -- [-1279.895] (-1280.597) (-1283.076) (-1281.263) * (-1279.073) (-1281.404) [-1281.383] (-1281.273) -- 0:00:35
Average standard deviation of split frequencies: 0.008599
465500 -- (-1280.415) (-1283.550) [-1281.469] (-1280.152) * (-1279.439) [-1279.918] (-1280.353) (-1280.528) -- 0:00:35
466000 -- (-1285.192) (-1287.542) (-1279.059) [-1282.679] * [-1282.018] (-1281.004) (-1286.334) (-1281.126) -- 0:00:35
466500 -- (-1279.980) (-1284.719) [-1279.738] (-1280.395) * (-1285.178) (-1281.569) [-1278.918] (-1280.480) -- 0:00:35
467000 -- (-1280.614) [-1278.948] (-1280.944) (-1277.951) * (-1283.006) (-1282.648) [-1281.275] (-1281.587) -- 0:00:35
467500 -- [-1280.647] (-1282.342) (-1281.570) (-1280.272) * [-1279.533] (-1280.530) (-1285.479) (-1283.894) -- 0:00:35
468000 -- (-1279.395) [-1281.610] (-1279.884) (-1281.821) * (-1280.758) [-1282.292] (-1281.516) (-1281.625) -- 0:00:35
468500 -- (-1279.317) [-1280.977] (-1281.982) (-1280.456) * (-1281.703) (-1281.385) [-1278.469] (-1284.163) -- 0:00:35
469000 -- [-1280.457] (-1280.342) (-1280.253) (-1283.741) * [-1279.588] (-1281.968) (-1278.522) (-1284.634) -- 0:00:35
469500 -- [-1278.510] (-1280.070) (-1283.540) (-1281.715) * (-1280.958) (-1283.357) [-1279.568] (-1285.085) -- 0:00:35
470000 -- (-1283.611) (-1280.037) [-1280.933] (-1279.920) * (-1281.198) [-1283.061] (-1279.828) (-1283.302) -- 0:00:34
Average standard deviation of split frequencies: 0.009327
470500 -- (-1281.670) [-1282.598] (-1284.079) (-1279.392) * (-1283.899) [-1281.943] (-1280.233) (-1284.782) -- 0:00:34
471000 -- (-1281.998) (-1283.665) (-1283.484) [-1281.783] * [-1278.537] (-1283.657) (-1281.103) (-1282.204) -- 0:00:34
471500 -- (-1281.511) (-1283.193) (-1282.511) [-1279.809] * [-1279.504] (-1281.705) (-1285.645) (-1282.170) -- 0:00:34
472000 -- (-1284.517) (-1282.800) (-1282.703) [-1280.860] * (-1280.203) (-1280.401) [-1280.642] (-1282.252) -- 0:00:34
472500 -- [-1282.347] (-1280.951) (-1280.582) (-1278.501) * (-1282.634) (-1281.089) (-1280.332) [-1280.576] -- 0:00:34
473000 -- (-1283.818) (-1281.626) (-1280.921) [-1277.891] * (-1285.500) (-1279.055) [-1280.829] (-1279.235) -- 0:00:34
473500 -- [-1281.853] (-1278.933) (-1277.753) (-1280.740) * (-1285.809) (-1283.437) (-1281.082) [-1284.300] -- 0:00:34
474000 -- (-1282.312) (-1280.294) (-1282.465) [-1282.385] * (-1284.078) (-1284.255) [-1278.629] (-1283.525) -- 0:00:34
474500 -- [-1281.683] (-1281.442) (-1285.158) (-1281.091) * (-1282.749) (-1281.045) [-1280.476] (-1281.267) -- 0:00:34
475000 -- [-1282.744] (-1284.147) (-1282.458) (-1280.999) * [-1280.286] (-1282.282) (-1280.873) (-1282.065) -- 0:00:34
Average standard deviation of split frequencies: 0.009177
475500 -- [-1280.264] (-1280.776) (-1282.843) (-1280.944) * (-1282.239) (-1279.863) (-1281.295) [-1283.238] -- 0:00:34
476000 -- [-1281.812] (-1283.883) (-1281.897) (-1281.043) * (-1280.823) (-1280.279) (-1281.355) [-1279.789] -- 0:00:34
476500 -- (-1279.065) [-1281.268] (-1282.915) (-1279.369) * (-1280.262) [-1283.155] (-1281.189) (-1279.492) -- 0:00:34
477000 -- (-1280.072) [-1281.817] (-1281.272) (-1280.502) * (-1282.005) (-1280.653) [-1280.343] (-1282.339) -- 0:00:35
477500 -- (-1281.576) [-1280.365] (-1279.187) (-1280.690) * (-1280.139) (-1282.986) [-1280.303] (-1283.076) -- 0:00:35
478000 -- [-1280.075] (-1282.652) (-1280.428) (-1280.376) * (-1284.135) (-1286.310) (-1288.248) [-1282.541] -- 0:00:34
478500 -- (-1282.811) [-1282.192] (-1281.836) (-1280.104) * (-1280.199) [-1279.391] (-1286.727) (-1281.409) -- 0:00:34
479000 -- (-1285.278) [-1283.066] (-1284.771) (-1280.766) * (-1281.543) (-1283.332) (-1281.512) [-1282.533] -- 0:00:34
479500 -- (-1284.343) [-1279.846] (-1280.333) (-1279.475) * (-1280.710) (-1278.772) [-1282.642] (-1280.796) -- 0:00:34
480000 -- [-1283.299] (-1279.874) (-1283.777) (-1282.627) * (-1283.188) (-1282.265) (-1280.981) [-1281.583] -- 0:00:34
Average standard deviation of split frequencies: 0.008434
480500 -- (-1282.544) [-1283.572] (-1280.155) (-1287.146) * (-1280.681) (-1283.102) (-1282.349) [-1280.228] -- 0:00:34
481000 -- (-1281.103) (-1281.687) (-1280.955) [-1279.069] * (-1280.263) (-1280.131) [-1282.079] (-1280.884) -- 0:00:34
481500 -- (-1281.419) (-1281.072) [-1279.982] (-1281.989) * (-1281.872) [-1281.331] (-1283.060) (-1283.990) -- 0:00:34
482000 -- [-1280.685] (-1283.509) (-1281.939) (-1279.401) * (-1281.090) (-1279.028) [-1281.170] (-1282.180) -- 0:00:34
482500 -- [-1280.111] (-1281.508) (-1283.866) (-1279.655) * (-1280.828) (-1282.333) [-1281.819] (-1281.131) -- 0:00:34
483000 -- (-1284.428) (-1283.724) [-1282.909] (-1280.966) * (-1279.517) (-1280.490) [-1280.547] (-1280.750) -- 0:00:34
483500 -- (-1282.177) (-1280.798) [-1280.941] (-1285.131) * (-1279.255) (-1279.360) [-1280.939] (-1282.630) -- 0:00:34
484000 -- (-1282.652) (-1279.119) (-1281.390) [-1280.225] * [-1282.026] (-1282.270) (-1281.289) (-1282.109) -- 0:00:34
484500 -- (-1281.219) (-1280.496) [-1279.613] (-1279.940) * [-1281.774] (-1281.463) (-1283.820) (-1280.419) -- 0:00:34
485000 -- (-1282.481) (-1277.698) [-1280.026] (-1280.235) * (-1282.460) (-1281.489) (-1283.661) [-1278.925] -- 0:00:33
Average standard deviation of split frequencies: 0.008851
485500 -- (-1280.672) (-1285.459) [-1280.744] (-1279.666) * (-1287.599) (-1283.129) [-1281.126] (-1279.363) -- 0:00:33
486000 -- (-1284.171) (-1280.958) (-1279.477) [-1283.433] * (-1283.605) (-1281.079) (-1281.700) [-1279.408] -- 0:00:33
486500 -- (-1284.136) (-1281.933) [-1280.569] (-1281.193) * (-1284.749) (-1282.080) (-1280.312) [-1279.545] -- 0:00:33
487000 -- (-1282.533) (-1280.013) (-1283.339) [-1281.650] * [-1284.249] (-1283.246) (-1280.302) (-1280.684) -- 0:00:33
487500 -- (-1280.950) [-1277.757] (-1279.900) (-1279.846) * (-1283.077) [-1281.482] (-1285.382) (-1282.082) -- 0:00:33
488000 -- (-1281.796) [-1282.596] (-1282.857) (-1284.573) * [-1280.935] (-1280.515) (-1282.012) (-1280.391) -- 0:00:33
488500 -- [-1279.864] (-1280.564) (-1280.893) (-1283.086) * (-1281.652) [-1282.132] (-1281.653) (-1280.136) -- 0:00:33
489000 -- (-1284.035) (-1282.407) [-1281.608] (-1284.119) * [-1280.431] (-1286.245) (-1283.305) (-1278.911) -- 0:00:33
489500 -- (-1280.350) [-1278.674] (-1281.836) (-1283.805) * (-1280.492) (-1282.743) (-1284.005) [-1282.342] -- 0:00:33
490000 -- [-1280.161] (-1282.770) (-1281.486) (-1283.161) * (-1286.429) (-1281.492) [-1280.113] (-1285.166) -- 0:00:33
Average standard deviation of split frequencies: 0.008519
490500 -- (-1280.729) (-1281.462) [-1281.100] (-1282.184) * [-1280.401] (-1281.234) (-1280.355) (-1283.710) -- 0:00:33
491000 -- (-1281.155) (-1279.023) (-1279.006) [-1280.039] * (-1282.818) [-1279.789] (-1281.569) (-1280.288) -- 0:00:33
491500 -- [-1281.271] (-1285.376) (-1283.868) (-1279.048) * (-1282.077) (-1280.849) [-1280.223] (-1280.221) -- 0:00:33
492000 -- (-1281.899) (-1278.030) (-1281.981) [-1280.286] * (-1280.014) (-1280.212) (-1279.045) [-1279.941] -- 0:00:34
492500 -- (-1280.700) (-1280.710) (-1280.695) [-1281.171] * (-1281.132) [-1280.609] (-1280.659) (-1279.169) -- 0:00:34
493000 -- (-1278.807) (-1280.343) (-1280.353) [-1281.423] * [-1279.934] (-1283.432) (-1281.548) (-1280.693) -- 0:00:33
493500 -- (-1279.086) (-1282.028) (-1279.993) [-1279.776] * (-1278.517) [-1280.045] (-1280.751) (-1282.219) -- 0:00:33
494000 -- [-1278.787] (-1284.159) (-1282.683) (-1279.109) * (-1280.048) [-1279.421] (-1282.879) (-1281.021) -- 0:00:33
494500 -- (-1278.546) (-1280.469) (-1280.378) [-1279.453] * (-1280.445) (-1281.609) (-1282.962) [-1281.231] -- 0:00:33
495000 -- [-1279.733] (-1284.439) (-1280.771) (-1281.483) * (-1280.889) (-1280.191) (-1282.747) [-1278.840] -- 0:00:33
Average standard deviation of split frequencies: 0.009251
495500 -- (-1280.744) (-1282.771) (-1279.645) [-1279.808] * [-1280.807] (-1281.328) (-1283.100) (-1281.419) -- 0:00:33
496000 -- (-1282.053) [-1282.958] (-1283.532) (-1281.212) * [-1280.610] (-1280.624) (-1284.545) (-1280.048) -- 0:00:33
496500 -- (-1282.154) (-1285.186) [-1282.645] (-1280.487) * (-1281.661) [-1280.400] (-1285.174) (-1279.940) -- 0:00:33
497000 -- [-1282.407] (-1282.174) (-1285.309) (-1279.883) * (-1278.602) [-1279.642] (-1282.156) (-1280.154) -- 0:00:33
497500 -- (-1281.924) (-1281.279) [-1284.862] (-1280.034) * (-1280.615) (-1279.742) (-1280.005) [-1280.430] -- 0:00:33
498000 -- [-1278.571] (-1282.072) (-1283.932) (-1279.301) * [-1281.112] (-1281.482) (-1280.347) (-1284.968) -- 0:00:33
498500 -- (-1280.434) (-1283.440) [-1280.649] (-1282.786) * [-1281.627] (-1278.647) (-1279.725) (-1279.479) -- 0:00:33
499000 -- (-1280.854) (-1281.878) (-1282.643) [-1280.475] * (-1282.570) (-1279.744) [-1283.967] (-1281.640) -- 0:00:33
499500 -- [-1281.470] (-1284.328) (-1282.806) (-1280.978) * (-1281.089) (-1280.647) (-1283.439) [-1282.455] -- 0:00:33
500000 -- [-1280.724] (-1281.143) (-1282.104) (-1281.555) * (-1282.371) (-1277.703) (-1280.403) [-1279.138] -- 0:00:33
Average standard deviation of split frequencies: 0.009039
500500 -- (-1281.700) (-1281.091) (-1284.632) [-1281.528] * [-1281.052] (-1280.854) (-1279.709) (-1280.459) -- 0:00:32
501000 -- (-1281.392) [-1279.522] (-1284.290) (-1280.985) * (-1280.905) [-1280.377] (-1279.802) (-1278.780) -- 0:00:32
501500 -- (-1281.625) (-1279.728) [-1283.045] (-1281.480) * (-1281.640) [-1281.966] (-1282.841) (-1280.124) -- 0:00:32
502000 -- [-1285.712] (-1281.010) (-1280.505) (-1282.654) * [-1280.797] (-1283.093) (-1281.918) (-1280.289) -- 0:00:32
502500 -- (-1280.985) [-1280.872] (-1281.369) (-1282.750) * (-1282.212) (-1283.120) (-1281.182) [-1286.956] -- 0:00:32
503000 -- (-1283.127) (-1280.978) [-1280.664] (-1282.438) * (-1279.778) [-1281.795] (-1280.875) (-1282.709) -- 0:00:32
503500 -- (-1281.492) (-1281.256) [-1280.107] (-1286.294) * (-1280.409) (-1283.581) [-1280.305] (-1282.179) -- 0:00:32
504000 -- [-1279.963] (-1282.917) (-1281.661) (-1285.567) * (-1281.246) (-1282.276) [-1280.738] (-1281.798) -- 0:00:32
504500 -- (-1284.207) [-1284.133] (-1282.345) (-1285.460) * (-1280.911) (-1285.079) [-1280.302] (-1282.543) -- 0:00:32
505000 -- (-1281.850) [-1283.196] (-1281.919) (-1282.393) * (-1279.047) (-1281.803) [-1280.242] (-1283.200) -- 0:00:32
Average standard deviation of split frequencies: 0.008882
505500 -- (-1282.897) (-1282.797) [-1280.308] (-1282.848) * [-1279.815] (-1281.447) (-1283.481) (-1283.533) -- 0:00:32
506000 -- (-1285.362) (-1283.121) [-1281.480] (-1283.376) * [-1277.745] (-1281.911) (-1281.714) (-1280.271) -- 0:00:32
506500 -- (-1280.338) (-1282.217) (-1282.783) [-1280.396] * [-1279.526] (-1280.717) (-1281.420) (-1281.585) -- 0:00:32
507000 -- [-1281.005] (-1283.263) (-1282.092) (-1280.256) * [-1280.836] (-1280.805) (-1280.067) (-1280.955) -- 0:00:33
507500 -- [-1280.128] (-1281.369) (-1280.281) (-1285.727) * (-1281.953) (-1282.377) (-1284.946) [-1281.091] -- 0:00:32
508000 -- (-1283.513) [-1281.429] (-1282.545) (-1286.847) * (-1279.489) [-1280.767] (-1281.885) (-1280.954) -- 0:00:32
508500 -- [-1283.837] (-1280.577) (-1281.398) (-1282.813) * (-1285.730) (-1279.899) [-1278.952] (-1282.721) -- 0:00:32
509000 -- (-1281.771) [-1279.514] (-1283.221) (-1280.201) * (-1282.209) (-1282.836) (-1282.843) [-1282.369] -- 0:00:32
509500 -- (-1282.073) [-1285.038] (-1281.723) (-1284.837) * (-1283.364) [-1282.644] (-1280.686) (-1281.921) -- 0:00:32
510000 -- [-1279.347] (-1282.333) (-1280.285) (-1283.241) * (-1280.201) (-1281.341) (-1280.819) [-1283.412] -- 0:00:32
Average standard deviation of split frequencies: 0.009047
510500 -- [-1280.749] (-1280.465) (-1281.458) (-1281.394) * (-1280.766) (-1280.966) (-1283.021) [-1281.722] -- 0:00:32
511000 -- [-1282.274] (-1280.862) (-1282.874) (-1281.431) * [-1280.103] (-1281.899) (-1281.830) (-1281.020) -- 0:00:32
511500 -- (-1282.560) (-1281.341) (-1281.078) [-1281.186] * (-1286.456) (-1281.571) [-1281.727] (-1279.617) -- 0:00:32
512000 -- (-1280.985) [-1281.417] (-1281.055) (-1282.748) * (-1282.095) (-1284.911) (-1285.804) [-1278.891] -- 0:00:32
512500 -- (-1282.221) (-1281.410) (-1280.624) [-1283.059] * [-1279.428] (-1283.406) (-1280.942) (-1279.845) -- 0:00:32
513000 -- (-1282.667) (-1280.462) (-1280.348) [-1283.055] * (-1280.973) (-1282.559) [-1281.351] (-1277.985) -- 0:00:32
513500 -- [-1278.367] (-1281.677) (-1280.608) (-1280.335) * (-1282.483) (-1283.201) (-1281.215) [-1279.653] -- 0:00:32
514000 -- (-1285.233) [-1281.676] (-1280.379) (-1279.127) * (-1282.299) [-1281.944] (-1282.072) (-1278.018) -- 0:00:32
514500 -- [-1280.808] (-1280.528) (-1279.719) (-1281.304) * [-1281.821] (-1283.916) (-1282.484) (-1277.727) -- 0:00:32
515000 -- (-1285.721) (-1282.019) [-1281.225] (-1280.137) * [-1282.244] (-1287.336) (-1280.643) (-1281.321) -- 0:00:32
Average standard deviation of split frequencies: 0.008770
515500 -- (-1286.068) [-1280.845] (-1278.771) (-1280.688) * (-1283.615) (-1279.558) (-1282.812) [-1279.859] -- 0:00:31
516000 -- (-1281.200) (-1278.826) (-1283.916) [-1279.370] * (-1280.306) (-1281.431) (-1284.226) [-1282.703] -- 0:00:31
516500 -- (-1282.251) (-1279.927) (-1281.034) [-1281.880] * [-1279.271] (-1281.416) (-1283.679) (-1280.607) -- 0:00:31
517000 -- (-1282.001) [-1281.073] (-1283.267) (-1291.127) * [-1278.192] (-1282.186) (-1280.021) (-1280.279) -- 0:00:31
517500 -- (-1281.663) (-1279.240) (-1280.043) [-1281.357] * (-1279.450) (-1282.723) (-1280.798) [-1282.519] -- 0:00:31
518000 -- [-1280.026] (-1280.109) (-1280.287) (-1281.431) * [-1279.401] (-1284.408) (-1282.124) (-1283.123) -- 0:00:31
518500 -- (-1283.646) (-1280.979) (-1280.968) [-1281.669] * (-1278.183) (-1282.432) (-1281.201) [-1282.321] -- 0:00:31
519000 -- (-1282.111) (-1278.963) [-1280.721] (-1282.540) * (-1278.985) (-1281.717) [-1280.253] (-1279.301) -- 0:00:31
519500 -- (-1282.055) [-1280.618] (-1280.653) (-1280.291) * (-1281.818) (-1281.054) (-1280.637) [-1280.987] -- 0:00:31
520000 -- (-1282.103) (-1279.158) (-1279.094) [-1282.255] * (-1282.065) (-1281.180) [-1282.745] (-1280.218) -- 0:00:31
Average standard deviation of split frequencies: 0.008571
520500 -- (-1281.165) [-1280.776] (-1278.164) (-1281.926) * (-1280.704) (-1281.784) (-1285.063) [-1280.506] -- 0:00:31
521000 -- (-1279.197) (-1279.172) [-1281.434] (-1281.685) * [-1279.878] (-1282.371) (-1281.801) (-1282.700) -- 0:00:31
521500 -- (-1279.551) (-1280.897) [-1281.634] (-1280.105) * (-1280.665) (-1283.134) (-1280.694) [-1280.784] -- 0:00:31
522000 -- (-1283.314) [-1280.444] (-1280.314) (-1283.737) * [-1280.806] (-1280.230) (-1282.200) (-1278.980) -- 0:00:32
522500 -- (-1280.088) (-1285.070) [-1283.580] (-1281.102) * (-1278.846) (-1282.168) [-1281.607] (-1281.027) -- 0:00:31
523000 -- (-1281.385) (-1280.369) (-1280.814) [-1281.679] * (-1283.221) (-1281.124) (-1281.235) [-1282.120] -- 0:00:31
523500 -- [-1279.483] (-1280.128) (-1278.948) (-1288.894) * (-1282.212) (-1282.490) [-1281.657] (-1283.631) -- 0:00:31
524000 -- (-1281.675) (-1278.866) [-1280.242] (-1285.271) * (-1280.295) [-1280.586] (-1278.958) (-1282.666) -- 0:00:31
524500 -- (-1278.730) (-1283.845) (-1280.359) [-1280.878] * (-1282.024) (-1281.016) [-1280.186] (-1286.186) -- 0:00:31
525000 -- [-1280.740] (-1282.315) (-1280.336) (-1278.706) * [-1281.762] (-1280.595) (-1281.820) (-1279.457) -- 0:00:31
Average standard deviation of split frequencies: 0.008723
525500 -- (-1283.905) (-1281.605) (-1281.273) [-1280.942] * (-1282.991) [-1281.002] (-1282.583) (-1281.822) -- 0:00:31
526000 -- (-1281.664) [-1281.200] (-1280.252) (-1281.067) * (-1280.852) (-1283.561) [-1278.331] (-1282.268) -- 0:00:31
526500 -- (-1282.989) [-1279.644] (-1280.335) (-1279.280) * (-1280.476) [-1279.716] (-1283.328) (-1281.567) -- 0:00:31
527000 -- (-1281.419) [-1279.540] (-1281.484) (-1280.280) * (-1280.000) (-1280.820) (-1279.740) [-1279.091] -- 0:00:31
527500 -- (-1280.318) (-1283.437) [-1279.772] (-1279.852) * (-1283.462) [-1282.832] (-1281.106) (-1282.905) -- 0:00:31
528000 -- (-1277.758) (-1280.769) [-1282.084] (-1281.167) * (-1280.442) [-1280.863] (-1283.821) (-1280.188) -- 0:00:31
528500 -- [-1280.809] (-1284.299) (-1279.722) (-1289.151) * (-1279.731) (-1279.923) [-1282.089] (-1280.414) -- 0:00:31
529000 -- [-1280.270] (-1281.152) (-1282.065) (-1283.191) * (-1279.564) (-1281.319) [-1278.825] (-1282.050) -- 0:00:31
529500 -- (-1280.367) (-1281.746) [-1280.358] (-1283.607) * (-1280.656) (-1281.916) (-1284.973) [-1283.568] -- 0:00:31
530000 -- (-1280.501) (-1280.495) (-1280.143) [-1284.941] * [-1280.712] (-1280.799) (-1281.681) (-1283.411) -- 0:00:31
Average standard deviation of split frequencies: 0.008054
530500 -- [-1280.291] (-1281.062) (-1281.248) (-1281.633) * (-1283.100) (-1282.693) [-1281.987] (-1283.681) -- 0:00:30
531000 -- (-1281.652) (-1279.449) (-1283.296) [-1281.575] * (-1281.569) (-1282.843) [-1282.606] (-1283.365) -- 0:00:30
531500 -- (-1280.506) [-1280.803] (-1285.512) (-1279.532) * (-1280.417) (-1280.417) [-1279.647] (-1285.285) -- 0:00:30
532000 -- (-1281.110) (-1282.270) [-1282.160] (-1279.199) * (-1279.968) [-1279.154] (-1280.598) (-1280.866) -- 0:00:30
532500 -- (-1281.507) [-1280.502] (-1278.440) (-1278.661) * (-1280.975) [-1278.887] (-1283.153) (-1282.904) -- 0:00:30
533000 -- (-1282.194) [-1281.031] (-1280.528) (-1279.876) * (-1280.035) (-1282.123) (-1280.926) [-1281.145] -- 0:00:30
533500 -- (-1281.017) [-1283.393] (-1281.517) (-1280.211) * (-1281.448) (-1282.442) [-1281.476] (-1281.291) -- 0:00:30
534000 -- [-1280.495] (-1281.149) (-1280.933) (-1283.557) * [-1278.606] (-1281.821) (-1281.363) (-1283.073) -- 0:00:30
534500 -- [-1281.029] (-1281.039) (-1284.664) (-1280.113) * [-1280.918] (-1280.207) (-1280.499) (-1280.151) -- 0:00:30
535000 -- [-1279.906] (-1280.746) (-1280.238) (-1283.570) * (-1279.496) [-1280.757] (-1281.993) (-1280.330) -- 0:00:30
Average standard deviation of split frequencies: 0.008971
535500 -- (-1279.684) (-1281.314) (-1280.021) [-1277.597] * [-1279.279] (-1292.636) (-1280.310) (-1279.634) -- 0:00:30
536000 -- [-1280.000] (-1287.648) (-1279.576) (-1279.219) * (-1279.894) (-1296.042) [-1281.750] (-1281.588) -- 0:00:30
536500 -- (-1281.826) [-1281.875] (-1278.459) (-1281.396) * (-1280.910) [-1279.505] (-1278.966) (-1285.959) -- 0:00:30
537000 -- [-1279.542] (-1279.898) (-1279.992) (-1281.035) * [-1280.349] (-1281.162) (-1279.434) (-1285.439) -- 0:00:31
537500 -- (-1281.341) [-1279.605] (-1283.385) (-1282.195) * (-1280.311) [-1280.417] (-1279.725) (-1280.116) -- 0:00:30
538000 -- (-1278.974) (-1280.662) (-1280.433) [-1282.642] * (-1280.526) (-1280.147) [-1280.315] (-1281.824) -- 0:00:30
538500 -- [-1280.614] (-1283.847) (-1278.314) (-1283.137) * [-1280.429] (-1282.786) (-1279.999) (-1280.088) -- 0:00:30
539000 -- (-1281.911) (-1283.021) [-1279.184] (-1285.641) * [-1283.916] (-1281.730) (-1280.846) (-1279.213) -- 0:00:30
539500 -- (-1281.603) [-1282.935] (-1279.329) (-1277.620) * (-1283.090) [-1279.972] (-1280.435) (-1281.995) -- 0:00:30
540000 -- (-1281.691) (-1280.880) (-1280.413) [-1280.852] * (-1280.257) (-1279.889) [-1283.205] (-1283.038) -- 0:00:30
Average standard deviation of split frequencies: 0.009591
540500 -- (-1278.782) (-1281.394) [-1279.324] (-1279.297) * (-1280.673) (-1281.115) (-1283.316) [-1280.349] -- 0:00:30
541000 -- (-1281.028) (-1282.136) (-1283.547) [-1280.795] * (-1279.807) [-1280.692] (-1283.797) (-1282.512) -- 0:00:30
541500 -- (-1280.691) [-1280.197] (-1280.318) (-1280.165) * [-1280.869] (-1281.054) (-1284.980) (-1284.941) -- 0:00:30
542000 -- [-1279.743] (-1280.200) (-1282.018) (-1280.161) * (-1280.657) (-1284.150) [-1283.474] (-1282.039) -- 0:00:30
542500 -- (-1281.220) (-1281.358) [-1279.703] (-1280.780) * [-1284.674] (-1279.024) (-1278.784) (-1285.159) -- 0:00:30
543000 -- [-1280.463] (-1281.330) (-1279.824) (-1279.362) * [-1280.986] (-1280.064) (-1281.333) (-1285.397) -- 0:00:30
543500 -- (-1282.505) [-1284.164] (-1281.802) (-1280.468) * (-1280.085) [-1279.709] (-1282.898) (-1284.690) -- 0:00:30
544000 -- (-1283.759) (-1277.429) [-1280.666] (-1281.111) * [-1279.398] (-1282.456) (-1280.875) (-1282.099) -- 0:00:30
544500 -- [-1283.085] (-1278.872) (-1283.283) (-1281.688) * (-1280.612) (-1282.063) (-1280.971) [-1282.364] -- 0:00:30
545000 -- (-1281.385) (-1280.204) (-1285.210) [-1282.395] * (-1281.731) [-1281.200] (-1280.863) (-1282.274) -- 0:00:30
Average standard deviation of split frequencies: 0.009152
545500 -- (-1280.786) (-1284.479) (-1281.588) [-1280.375] * (-1285.173) [-1278.106] (-1281.907) (-1282.020) -- 0:00:29
546000 -- [-1279.435] (-1280.773) (-1280.924) (-1282.077) * [-1285.003] (-1280.435) (-1280.794) (-1282.612) -- 0:00:29
546500 -- (-1286.763) (-1280.930) [-1281.947] (-1279.926) * [-1280.425] (-1282.355) (-1281.510) (-1278.015) -- 0:00:29
547000 -- (-1279.425) (-1280.231) (-1280.817) [-1281.012] * (-1280.081) (-1280.785) [-1281.167] (-1281.925) -- 0:00:29
547500 -- (-1280.305) [-1280.249] (-1277.891) (-1279.822) * [-1281.020] (-1284.430) (-1281.470) (-1280.521) -- 0:00:29
548000 -- (-1279.937) [-1280.124] (-1281.844) (-1280.897) * (-1279.329) (-1281.014) (-1279.619) [-1281.625] -- 0:00:29
548500 -- (-1280.824) (-1281.110) [-1288.297] (-1283.359) * (-1281.580) (-1279.987) [-1280.495] (-1286.380) -- 0:00:29
549000 -- (-1282.179) [-1285.574] (-1285.941) (-1280.648) * (-1280.542) (-1281.841) (-1281.674) [-1286.264] -- 0:00:29
549500 -- (-1280.743) [-1279.578] (-1283.321) (-1282.831) * (-1281.002) (-1281.215) (-1282.921) [-1282.158] -- 0:00:29
550000 -- (-1279.583) (-1280.102) [-1280.977] (-1283.310) * (-1283.370) (-1279.362) (-1280.704) [-1281.687] -- 0:00:29
Average standard deviation of split frequencies: 0.008789
550500 -- [-1280.537] (-1283.662) (-1280.723) (-1283.371) * (-1282.847) (-1280.639) [-1280.340] (-1280.377) -- 0:00:29
551000 -- [-1281.812] (-1285.870) (-1281.142) (-1281.381) * (-1280.647) [-1281.958] (-1281.123) (-1279.981) -- 0:00:29
551500 -- [-1281.375] (-1281.662) (-1281.983) (-1280.494) * [-1284.900] (-1284.665) (-1282.543) (-1282.538) -- 0:00:29
552000 -- (-1284.566) [-1284.615] (-1283.123) (-1283.418) * [-1281.281] (-1285.864) (-1280.392) (-1283.058) -- 0:00:30
552500 -- [-1281.835] (-1281.766) (-1282.598) (-1281.074) * (-1279.470) (-1280.108) (-1280.129) [-1284.895] -- 0:00:29
553000 -- (-1281.575) (-1280.835) (-1281.252) [-1285.505] * [-1281.955] (-1279.663) (-1283.944) (-1281.718) -- 0:00:29
553500 -- (-1288.491) (-1281.198) [-1280.563] (-1281.966) * (-1281.279) (-1281.143) (-1283.786) [-1281.289] -- 0:00:29
554000 -- [-1283.044] (-1281.038) (-1278.756) (-1283.676) * (-1286.747) (-1281.449) (-1280.369) [-1284.744] -- 0:00:29
554500 -- (-1280.916) [-1279.676] (-1283.034) (-1280.536) * (-1281.354) (-1281.376) [-1280.021] (-1282.273) -- 0:00:29
555000 -- (-1279.960) [-1283.804] (-1290.771) (-1280.144) * (-1282.396) (-1281.314) (-1280.833) [-1283.241] -- 0:00:29
Average standard deviation of split frequencies: 0.009326
555500 -- (-1281.534) (-1281.422) (-1283.057) [-1279.902] * [-1282.992] (-1282.882) (-1286.584) (-1279.440) -- 0:00:29
556000 -- (-1281.659) (-1284.860) [-1284.829] (-1280.882) * (-1280.613) (-1283.787) [-1282.857] (-1281.017) -- 0:00:29
556500 -- (-1283.720) (-1280.951) [-1281.197] (-1281.780) * [-1279.070] (-1281.088) (-1283.999) (-1281.061) -- 0:00:29
557000 -- (-1282.273) [-1279.799] (-1281.170) (-1281.122) * [-1278.704] (-1281.224) (-1281.004) (-1280.583) -- 0:00:29
557500 -- (-1281.257) [-1282.422] (-1283.897) (-1280.242) * (-1282.171) (-1280.512) [-1278.993] (-1281.735) -- 0:00:29
558000 -- (-1279.974) (-1284.944) (-1280.349) [-1280.253] * [-1281.339] (-1280.917) (-1282.077) (-1279.972) -- 0:00:29
558500 -- [-1281.595] (-1283.190) (-1281.324) (-1278.012) * [-1278.481] (-1280.966) (-1283.095) (-1279.751) -- 0:00:29
559000 -- (-1280.653) [-1279.593] (-1281.009) (-1280.383) * [-1280.263] (-1285.188) (-1282.975) (-1282.612) -- 0:00:29
559500 -- (-1282.487) [-1281.443] (-1281.928) (-1278.564) * (-1280.692) (-1281.266) (-1281.639) [-1281.255] -- 0:00:29
560000 -- (-1281.609) [-1279.423] (-1281.984) (-1279.033) * [-1279.554] (-1279.923) (-1280.561) (-1282.696) -- 0:00:29
Average standard deviation of split frequencies: 0.009417
560500 -- (-1281.537) (-1279.772) (-1281.931) [-1279.600] * [-1278.256] (-1280.154) (-1282.816) (-1280.238) -- 0:00:29
561000 -- (-1282.600) (-1279.475) (-1281.003) [-1280.185] * (-1283.438) (-1281.641) (-1282.374) [-1280.150] -- 0:00:28
561500 -- [-1282.504] (-1283.133) (-1280.861) (-1278.955) * [-1281.253] (-1280.934) (-1281.558) (-1280.073) -- 0:00:28
562000 -- [-1280.051] (-1280.179) (-1279.864) (-1280.443) * [-1278.221] (-1281.502) (-1279.960) (-1282.558) -- 0:00:28
562500 -- (-1282.815) [-1280.538] (-1282.830) (-1279.529) * (-1279.307) [-1283.770] (-1280.530) (-1281.476) -- 0:00:28
563000 -- (-1280.906) (-1281.146) [-1280.144] (-1280.283) * (-1279.538) [-1282.610] (-1278.128) (-1280.798) -- 0:00:28
563500 -- (-1279.272) [-1280.856] (-1282.921) (-1282.046) * (-1282.396) (-1279.849) (-1281.716) [-1280.580] -- 0:00:28
564000 -- (-1282.253) (-1282.209) [-1281.189] (-1278.573) * (-1281.320) (-1281.342) (-1285.337) [-1281.271] -- 0:00:28
564500 -- (-1281.065) [-1282.304] (-1283.926) (-1279.570) * (-1281.083) [-1280.095] (-1282.135) (-1283.587) -- 0:00:28
565000 -- (-1281.802) [-1284.155] (-1283.406) (-1280.084) * [-1281.142] (-1280.694) (-1279.970) (-1281.766) -- 0:00:28
Average standard deviation of split frequencies: 0.009106
565500 -- (-1281.551) (-1280.667) (-1281.812) [-1279.280] * [-1280.167] (-1281.940) (-1280.466) (-1284.945) -- 0:00:28
566000 -- (-1279.979) (-1286.320) (-1284.174) [-1282.582] * (-1281.223) (-1280.050) (-1280.370) [-1282.946] -- 0:00:28
566500 -- (-1283.342) (-1284.434) [-1280.534] (-1286.151) * (-1282.736) [-1282.473] (-1278.348) (-1281.674) -- 0:00:28
567000 -- (-1284.098) (-1281.761) [-1282.848] (-1282.810) * (-1281.583) (-1282.019) (-1279.916) [-1283.412] -- 0:00:29
567500 -- (-1285.369) (-1279.787) (-1283.110) [-1281.325] * (-1279.444) (-1286.695) [-1279.777] (-1281.201) -- 0:00:28
568000 -- [-1281.030] (-1280.579) (-1280.153) (-1281.101) * (-1278.941) (-1285.275) [-1278.169] (-1282.373) -- 0:00:28
568500 -- (-1282.431) [-1280.528] (-1281.124) (-1281.429) * (-1280.735) (-1281.811) (-1280.978) [-1281.261] -- 0:00:28
569000 -- [-1280.173] (-1281.423) (-1284.383) (-1283.186) * (-1280.890) [-1280.028] (-1282.114) (-1284.164) -- 0:00:28
569500 -- [-1277.144] (-1281.100) (-1284.945) (-1280.817) * [-1279.003] (-1281.583) (-1277.782) (-1285.820) -- 0:00:28
570000 -- (-1280.999) (-1281.807) (-1280.420) [-1280.903] * [-1281.364] (-1280.591) (-1285.806) (-1283.092) -- 0:00:28
Average standard deviation of split frequencies: 0.008921
570500 -- (-1281.323) (-1280.607) (-1279.524) [-1282.750] * (-1281.434) (-1280.066) [-1283.586] (-1281.952) -- 0:00:28
571000 -- (-1280.285) (-1280.293) (-1281.658) [-1281.134] * (-1281.473) [-1280.481] (-1278.105) (-1283.956) -- 0:00:28
571500 -- [-1279.150] (-1283.362) (-1281.583) (-1280.429) * [-1277.705] (-1279.728) (-1279.963) (-1283.636) -- 0:00:28
572000 -- (-1280.001) (-1282.949) (-1281.278) [-1278.692] * (-1279.249) (-1282.611) (-1288.282) [-1281.374] -- 0:00:28
572500 -- [-1284.803] (-1278.831) (-1280.333) (-1282.564) * [-1279.544] (-1280.917) (-1282.195) (-1281.381) -- 0:00:28
573000 -- (-1280.516) [-1284.063] (-1280.428) (-1281.615) * (-1278.165) (-1281.189) [-1278.603] (-1285.572) -- 0:00:28
573500 -- [-1281.192] (-1284.658) (-1283.456) (-1287.555) * [-1280.067] (-1280.790) (-1279.547) (-1284.215) -- 0:00:28
574000 -- (-1279.979) (-1280.952) (-1279.921) [-1283.619] * [-1278.897] (-1280.736) (-1280.702) (-1281.072) -- 0:00:28
574500 -- [-1279.281] (-1280.114) (-1279.726) (-1283.563) * (-1280.647) (-1278.283) (-1282.306) [-1280.528] -- 0:00:28
575000 -- [-1279.573] (-1282.658) (-1280.899) (-1283.674) * (-1281.765) (-1288.599) [-1279.979] (-1282.307) -- 0:00:28
Average standard deviation of split frequencies: 0.009439
575500 -- (-1282.052) (-1282.320) (-1280.978) [-1283.354] * (-1282.736) (-1281.458) [-1285.078] (-1280.060) -- 0:00:28
576000 -- (-1279.315) (-1281.737) (-1280.458) [-1279.399] * [-1281.125] (-1279.033) (-1280.604) (-1280.983) -- 0:00:27
576500 -- (-1280.774) (-1280.553) (-1282.256) [-1279.223] * (-1282.275) (-1278.990) [-1279.836] (-1281.233) -- 0:00:27
577000 -- (-1281.133) (-1282.548) (-1280.582) [-1283.749] * (-1283.302) (-1284.251) (-1279.553) [-1282.201] -- 0:00:27
577500 -- (-1278.647) [-1280.685] (-1281.964) (-1281.433) * (-1283.004) [-1280.175] (-1280.358) (-1282.851) -- 0:00:27
578000 -- (-1279.425) (-1280.053) (-1280.798) [-1284.554] * [-1281.505] (-1278.843) (-1279.122) (-1280.903) -- 0:00:27
578500 -- [-1280.196] (-1280.343) (-1280.963) (-1280.376) * (-1282.014) (-1279.749) (-1283.886) [-1280.875] -- 0:00:27
579000 -- (-1280.592) [-1279.065] (-1280.071) (-1282.588) * [-1281.493] (-1282.996) (-1280.314) (-1280.696) -- 0:00:27
579500 -- (-1282.151) (-1280.164) (-1281.189) [-1280.336] * (-1278.114) [-1282.061] (-1282.242) (-1281.515) -- 0:00:27
580000 -- [-1278.615] (-1280.043) (-1280.815) (-1280.637) * [-1278.022] (-1285.540) (-1280.658) (-1282.770) -- 0:00:27
Average standard deviation of split frequencies: 0.009147
580500 -- [-1281.107] (-1279.696) (-1281.378) (-1281.047) * (-1280.649) (-1281.160) [-1282.417] (-1282.571) -- 0:00:27
581000 -- (-1283.368) [-1281.174] (-1284.816) (-1282.066) * (-1280.392) (-1282.186) (-1281.117) [-1282.312] -- 0:00:27
581500 -- (-1283.111) (-1280.756) (-1282.573) [-1283.832] * (-1282.586) [-1281.502] (-1280.269) (-1278.865) -- 0:00:28
582000 -- (-1279.830) [-1280.597] (-1280.077) (-1279.676) * (-1281.906) (-1279.219) [-1279.765] (-1280.010) -- 0:00:28
582500 -- (-1284.751) (-1278.820) [-1279.521] (-1281.449) * (-1282.522) (-1279.625) (-1286.734) [-1279.310] -- 0:00:27
583000 -- (-1280.457) (-1281.192) (-1280.804) [-1285.693] * [-1278.584] (-1282.930) (-1280.510) (-1282.173) -- 0:00:27
583500 -- [-1280.274] (-1285.421) (-1283.324) (-1285.195) * (-1281.588) (-1279.882) [-1279.804] (-1281.965) -- 0:00:27
584000 -- [-1278.865] (-1282.034) (-1282.530) (-1283.799) * (-1283.272) (-1280.515) [-1282.961] (-1282.008) -- 0:00:27
584500 -- [-1279.490] (-1280.609) (-1280.526) (-1281.017) * (-1279.843) (-1279.489) (-1281.635) [-1279.603] -- 0:00:27
585000 -- (-1278.383) [-1279.253] (-1280.052) (-1281.351) * (-1279.258) [-1279.775] (-1282.138) (-1283.319) -- 0:00:27
Average standard deviation of split frequencies: 0.009063
585500 -- (-1281.263) [-1282.254] (-1283.593) (-1280.162) * (-1283.349) [-1278.598] (-1280.220) (-1284.658) -- 0:00:27
586000 -- (-1280.723) [-1283.174] (-1279.246) (-1283.262) * (-1283.829) [-1280.471] (-1279.259) (-1286.244) -- 0:00:27
586500 -- (-1278.447) [-1283.788] (-1281.716) (-1281.305) * (-1281.707) (-1279.867) [-1281.947] (-1281.216) -- 0:00:27
587000 -- [-1281.725] (-1287.683) (-1284.879) (-1284.665) * (-1283.457) [-1281.389] (-1281.208) (-1280.908) -- 0:00:27
587500 -- [-1280.812] (-1282.266) (-1279.710) (-1282.025) * (-1283.380) [-1281.833] (-1279.895) (-1282.684) -- 0:00:27
588000 -- (-1281.608) (-1282.547) (-1281.452) [-1279.491] * (-1284.372) (-1282.891) (-1281.085) [-1279.346] -- 0:00:27
588500 -- (-1283.340) (-1283.831) (-1286.343) [-1280.114] * (-1282.437) (-1282.976) [-1281.362] (-1284.281) -- 0:00:27
589000 -- (-1282.587) (-1284.462) (-1283.430) [-1279.591] * (-1283.942) [-1282.761] (-1282.317) (-1281.779) -- 0:00:27
589500 -- [-1279.313] (-1281.340) (-1283.497) (-1286.193) * (-1282.804) (-1279.898) (-1284.112) [-1281.919] -- 0:00:27
590000 -- (-1280.949) [-1284.511] (-1283.907) (-1285.768) * [-1279.625] (-1285.045) (-1281.319) (-1282.660) -- 0:00:27
Average standard deviation of split frequencies: 0.009471
590500 -- (-1279.595) (-1280.761) (-1280.378) [-1279.873] * (-1280.577) (-1281.217) (-1282.989) [-1282.160] -- 0:00:27
591000 -- [-1281.072] (-1280.731) (-1282.728) (-1284.024) * (-1279.513) (-1280.602) [-1280.082] (-1279.302) -- 0:00:26
591500 -- (-1281.312) (-1282.923) [-1282.135] (-1283.182) * (-1281.944) (-1280.434) [-1280.577] (-1280.349) -- 0:00:26
592000 -- (-1282.548) [-1281.556] (-1281.284) (-1279.576) * (-1283.646) [-1280.272] (-1280.106) (-1280.340) -- 0:00:26
592500 -- (-1282.948) (-1283.452) [-1280.165] (-1282.756) * [-1280.766] (-1282.846) (-1281.168) (-1285.263) -- 0:00:26
593000 -- (-1281.078) [-1279.907] (-1283.797) (-1282.637) * (-1289.553) [-1280.671] (-1281.728) (-1283.165) -- 0:00:26
593500 -- (-1281.275) (-1279.929) [-1281.827] (-1279.030) * (-1281.551) [-1282.121] (-1281.737) (-1286.653) -- 0:00:26
594000 -- (-1280.352) [-1281.692] (-1281.826) (-1280.018) * (-1279.901) (-1282.055) [-1283.638] (-1284.350) -- 0:00:26
594500 -- (-1279.427) (-1281.761) (-1281.162) [-1280.730] * (-1281.796) [-1280.789] (-1281.213) (-1280.930) -- 0:00:26
595000 -- [-1280.279] (-1278.476) (-1280.643) (-1281.263) * (-1281.745) [-1280.328] (-1282.681) (-1282.337) -- 0:00:26
Average standard deviation of split frequencies: 0.009544
595500 -- (-1282.395) [-1281.098] (-1282.312) (-1282.257) * (-1280.617) (-1284.617) (-1279.320) [-1281.106] -- 0:00:26
596000 -- (-1281.927) (-1281.075) [-1280.447] (-1280.748) * (-1280.489) (-1286.858) [-1280.756] (-1282.223) -- 0:00:26
596500 -- (-1280.533) (-1282.468) [-1281.886] (-1279.868) * [-1280.370] (-1284.013) (-1280.710) (-1280.754) -- 0:00:27
597000 -- (-1278.851) (-1285.500) (-1281.400) [-1279.479] * (-1281.118) (-1285.909) [-1282.103] (-1281.741) -- 0:00:27
597500 -- (-1280.405) (-1280.280) [-1282.307] (-1283.268) * (-1282.850) [-1281.119] (-1281.667) (-1283.417) -- 0:00:26
598000 -- (-1281.424) [-1283.542] (-1280.636) (-1282.301) * (-1280.053) (-1281.522) [-1281.111] (-1286.553) -- 0:00:26
598500 -- (-1279.856) [-1280.522] (-1283.915) (-1283.982) * (-1281.680) (-1280.647) [-1282.881] (-1280.472) -- 0:00:26
599000 -- (-1284.515) (-1280.566) [-1283.000] (-1282.150) * (-1281.191) (-1280.927) (-1283.302) [-1280.871] -- 0:00:26
599500 -- (-1281.020) (-1284.518) [-1277.931] (-1280.438) * (-1280.112) (-1280.824) (-1284.014) [-1278.588] -- 0:00:26
600000 -- (-1280.992) (-1283.998) (-1279.144) [-1280.343] * (-1280.877) (-1280.957) (-1284.541) [-1284.094] -- 0:00:26
Average standard deviation of split frequencies: 0.009261
600500 -- (-1282.285) (-1283.682) [-1280.611] (-1281.805) * [-1280.956] (-1284.230) (-1278.680) (-1283.127) -- 0:00:26
601000 -- (-1283.325) (-1280.750) [-1281.233] (-1283.551) * (-1280.089) (-1285.369) [-1283.487] (-1283.264) -- 0:00:26
601500 -- [-1283.974] (-1279.021) (-1281.916) (-1283.733) * (-1280.894) (-1285.729) (-1280.937) [-1282.247] -- 0:00:26
602000 -- (-1282.569) (-1284.521) (-1280.691) [-1281.440] * [-1282.019] (-1283.712) (-1280.124) (-1283.666) -- 0:00:26
602500 -- (-1287.710) (-1285.137) (-1281.510) [-1281.892] * [-1282.874] (-1281.262) (-1281.510) (-1284.688) -- 0:00:26
603000 -- [-1281.933] (-1282.189) (-1281.608) (-1283.903) * (-1282.119) [-1280.395] (-1281.451) (-1281.039) -- 0:00:26
603500 -- (-1281.864) (-1283.839) [-1280.720] (-1281.553) * (-1279.770) (-1280.849) (-1279.739) [-1281.874] -- 0:00:26
604000 -- (-1284.505) (-1281.510) (-1283.946) [-1279.985] * (-1280.948) (-1279.360) [-1278.764] (-1284.296) -- 0:00:26
604500 -- [-1282.350] (-1281.324) (-1280.723) (-1283.149) * (-1280.394) [-1282.494] (-1281.051) (-1287.616) -- 0:00:26
605000 -- (-1282.938) (-1279.801) [-1282.085] (-1280.878) * (-1282.268) (-1278.830) [-1282.205] (-1282.529) -- 0:00:26
Average standard deviation of split frequencies: 0.009024
605500 -- (-1281.075) (-1282.368) (-1281.486) [-1280.773] * (-1279.809) (-1279.836) (-1280.942) [-1281.571] -- 0:00:26
606000 -- (-1282.020) (-1280.381) [-1284.161] (-1283.597) * (-1281.460) (-1281.655) (-1279.787) [-1280.555] -- 0:00:26
606500 -- (-1283.800) (-1282.051) (-1282.426) [-1282.839] * (-1279.295) (-1283.473) [-1282.101] (-1279.899) -- 0:00:25
607000 -- (-1280.331) [-1282.107] (-1283.126) (-1281.441) * [-1280.301] (-1285.310) (-1282.677) (-1281.538) -- 0:00:25
607500 -- [-1280.925] (-1282.918) (-1280.636) (-1280.513) * (-1283.624) (-1284.560) [-1281.474] (-1281.901) -- 0:00:25
608000 -- (-1281.553) (-1282.965) (-1280.777) [-1284.430] * (-1280.671) (-1281.507) [-1280.277] (-1281.675) -- 0:00:25
608500 -- (-1281.682) [-1280.402] (-1281.107) (-1280.052) * (-1281.648) (-1281.691) (-1280.612) [-1283.937] -- 0:00:25
609000 -- [-1280.826] (-1284.159) (-1279.129) (-1280.251) * (-1281.729) (-1279.800) [-1280.931] (-1282.632) -- 0:00:25
609500 -- [-1279.279] (-1280.253) (-1280.548) (-1280.673) * (-1279.713) (-1281.786) (-1281.352) [-1280.262] -- 0:00:25
610000 -- (-1282.951) (-1283.226) [-1280.629] (-1286.309) * (-1283.259) (-1281.300) [-1281.525] (-1283.835) -- 0:00:25
Average standard deviation of split frequencies: 0.009263
610500 -- (-1280.424) (-1282.104) [-1279.787] (-1282.845) * (-1281.549) [-1281.520] (-1281.271) (-1282.543) -- 0:00:25
611000 -- [-1281.220] (-1280.656) (-1281.299) (-1281.078) * (-1283.568) [-1279.308] (-1281.037) (-1280.357) -- 0:00:25
611500 -- (-1279.177) [-1280.184] (-1284.095) (-1280.400) * (-1283.406) [-1280.808] (-1282.138) (-1283.169) -- 0:00:26
612000 -- (-1279.684) [-1280.463] (-1281.499) (-1278.591) * (-1279.378) (-1280.362) (-1280.563) [-1279.179] -- 0:00:25
612500 -- (-1280.027) [-1282.089] (-1279.013) (-1279.791) * (-1280.008) [-1280.062] (-1282.835) (-1280.499) -- 0:00:25
613000 -- (-1279.511) [-1279.710] (-1284.390) (-1280.659) * [-1278.989] (-1280.094) (-1282.654) (-1281.187) -- 0:00:25
613500 -- (-1280.731) (-1281.072) [-1285.330] (-1283.732) * [-1282.079] (-1286.522) (-1282.154) (-1280.265) -- 0:00:25
614000 -- [-1280.231] (-1283.873) (-1280.430) (-1283.085) * (-1279.033) [-1280.310] (-1278.414) (-1282.158) -- 0:00:25
614500 -- (-1280.826) [-1282.607] (-1281.260) (-1281.140) * (-1281.869) (-1279.857) (-1282.076) [-1282.690] -- 0:00:25
615000 -- (-1281.894) (-1280.657) [-1280.823] (-1280.508) * (-1280.820) [-1279.597] (-1280.088) (-1281.766) -- 0:00:25
Average standard deviation of split frequencies: 0.009489
615500 -- (-1280.485) (-1280.074) [-1281.284] (-1280.726) * (-1281.417) (-1279.790) [-1279.941] (-1280.616) -- 0:00:25
616000 -- [-1278.107] (-1282.444) (-1280.708) (-1281.493) * (-1279.859) (-1283.980) (-1281.939) [-1278.207] -- 0:00:25
616500 -- [-1282.314] (-1284.795) (-1281.972) (-1282.050) * (-1280.197) (-1280.497) [-1282.455] (-1279.513) -- 0:00:25
617000 -- (-1281.693) [-1280.546] (-1280.449) (-1277.376) * [-1279.887] (-1279.808) (-1282.949) (-1282.915) -- 0:00:25
617500 -- (-1284.937) [-1280.751] (-1282.141) (-1281.210) * (-1280.901) [-1279.393] (-1283.418) (-1286.217) -- 0:00:25
618000 -- (-1284.240) (-1280.967) (-1280.992) [-1279.957] * (-1280.329) (-1282.390) [-1282.916] (-1281.438) -- 0:00:25
618500 -- (-1282.740) (-1285.027) [-1280.338] (-1280.241) * (-1280.104) [-1281.983] (-1279.871) (-1281.109) -- 0:00:25
619000 -- (-1282.523) (-1280.096) (-1282.331) [-1280.269] * (-1283.549) [-1281.855] (-1284.645) (-1280.747) -- 0:00:25
619500 -- (-1281.790) (-1281.187) [-1282.385] (-1280.530) * [-1280.350] (-1280.928) (-1283.890) (-1282.592) -- 0:00:25
620000 -- (-1285.145) (-1282.320) (-1282.627) [-1282.218] * (-1280.201) [-1281.705] (-1279.558) (-1281.436) -- 0:00:25
Average standard deviation of split frequencies: 0.009621
620500 -- (-1289.248) (-1282.163) [-1282.801] (-1282.387) * (-1279.905) [-1285.182] (-1281.292) (-1282.671) -- 0:00:25
621000 -- (-1279.772) [-1280.808] (-1282.271) (-1279.529) * (-1280.525) (-1282.447) (-1280.343) [-1282.293] -- 0:00:25
621500 -- (-1281.542) [-1280.924] (-1278.814) (-1280.824) * (-1282.405) (-1281.372) [-1279.775] (-1281.480) -- 0:00:24
622000 -- (-1280.417) (-1282.679) (-1279.656) [-1280.288] * (-1280.179) (-1281.635) [-1281.313] (-1281.458) -- 0:00:24
622500 -- (-1279.598) (-1282.414) (-1280.419) [-1280.218] * (-1281.151) (-1279.856) (-1279.714) [-1282.885] -- 0:00:24
623000 -- (-1281.988) (-1279.085) [-1281.075] (-1282.232) * (-1282.177) (-1280.155) [-1280.665] (-1283.318) -- 0:00:24
623500 -- (-1285.629) (-1278.696) (-1285.025) [-1279.256] * (-1281.962) (-1281.349) [-1278.748] (-1281.316) -- 0:00:24
624000 -- (-1282.495) (-1285.762) [-1281.675] (-1280.398) * (-1280.970) (-1283.707) (-1278.848) [-1281.256] -- 0:00:24
624500 -- (-1280.749) (-1281.646) (-1281.332) [-1281.385] * (-1282.153) [-1280.118] (-1279.879) (-1281.977) -- 0:00:24
625000 -- (-1279.607) (-1283.078) (-1280.080) [-1281.644] * (-1283.416) [-1290.097] (-1282.472) (-1281.556) -- 0:00:24
Average standard deviation of split frequencies: 0.009037
625500 -- (-1282.312) (-1281.516) [-1280.461] (-1280.707) * (-1281.861) (-1283.625) (-1281.857) [-1279.371] -- 0:00:24
626000 -- (-1278.895) [-1281.800] (-1280.552) (-1279.446) * (-1281.194) [-1279.640] (-1282.926) (-1282.544) -- 0:00:24
626500 -- (-1279.697) (-1280.495) (-1279.143) [-1281.968] * (-1281.349) (-1280.723) [-1283.284] (-1283.193) -- 0:00:25
627000 -- (-1280.516) (-1280.723) [-1282.361] (-1281.522) * (-1284.058) [-1280.689] (-1281.884) (-1282.456) -- 0:00:24
627500 -- (-1280.240) (-1281.736) [-1281.112] (-1281.403) * (-1278.718) [-1282.547] (-1280.688) (-1280.604) -- 0:00:24
628000 -- (-1278.279) (-1281.377) [-1280.455] (-1281.440) * (-1278.247) [-1280.097] (-1281.313) (-1281.788) -- 0:00:24
628500 -- [-1281.927] (-1280.342) (-1281.501) (-1279.021) * (-1280.408) (-1280.873) (-1282.276) [-1282.814] -- 0:00:24
629000 -- (-1283.445) (-1279.598) (-1282.385) [-1279.094] * (-1284.438) [-1280.229] (-1281.245) (-1283.300) -- 0:00:24
629500 -- [-1283.372] (-1282.339) (-1281.570) (-1279.863) * [-1280.096] (-1281.155) (-1282.025) (-1279.774) -- 0:00:24
630000 -- (-1279.561) [-1286.744] (-1281.113) (-1280.303) * [-1281.420] (-1281.409) (-1287.653) (-1280.555) -- 0:00:24
Average standard deviation of split frequencies: 0.009318
630500 -- (-1280.699) [-1280.171] (-1277.925) (-1280.425) * (-1285.805) (-1280.504) (-1286.137) [-1280.383] -- 0:00:24
631000 -- (-1280.079) [-1278.999] (-1281.457) (-1281.557) * (-1284.181) (-1281.729) [-1282.294] (-1281.247) -- 0:00:24
631500 -- (-1280.029) (-1281.189) [-1281.502] (-1281.207) * [-1280.916] (-1279.980) (-1283.028) (-1280.247) -- 0:00:24
632000 -- (-1281.573) (-1283.634) [-1279.998] (-1281.983) * (-1282.026) [-1279.880] (-1282.375) (-1280.729) -- 0:00:24
632500 -- (-1280.611) (-1281.878) [-1280.858] (-1281.143) * (-1280.712) (-1281.056) [-1280.855] (-1284.644) -- 0:00:24
633000 -- (-1282.494) [-1283.229] (-1281.760) (-1280.666) * (-1282.258) (-1281.728) [-1280.903] (-1281.557) -- 0:00:24
633500 -- [-1283.016] (-1289.288) (-1279.867) (-1282.415) * (-1281.156) (-1281.637) (-1280.609) [-1280.274] -- 0:00:24
634000 -- (-1280.676) [-1282.065] (-1282.679) (-1280.126) * (-1281.296) (-1283.901) [-1280.741] (-1280.030) -- 0:00:24
634500 -- [-1282.780] (-1283.923) (-1279.754) (-1280.923) * (-1281.440) (-1282.506) (-1282.130) [-1280.296] -- 0:00:24
635000 -- [-1283.520] (-1282.190) (-1281.406) (-1279.966) * (-1280.773) (-1281.697) (-1280.801) [-1281.402] -- 0:00:24
Average standard deviation of split frequencies: 0.009092
635500 -- [-1279.850] (-1280.352) (-1279.642) (-1279.483) * (-1281.086) (-1282.949) (-1280.664) [-1283.379] -- 0:00:24
636000 -- (-1280.563) (-1281.974) [-1284.042] (-1281.124) * (-1281.494) (-1282.452) (-1283.165) [-1284.535] -- 0:00:24
636500 -- (-1280.308) (-1282.618) (-1281.018) [-1283.948] * (-1282.596) (-1278.377) (-1278.929) [-1286.222] -- 0:00:23
637000 -- (-1279.863) [-1279.728] (-1282.179) (-1282.185) * (-1279.300) (-1280.828) [-1280.373] (-1283.478) -- 0:00:23
637500 -- (-1279.408) (-1284.048) [-1283.013] (-1280.064) * (-1281.545) (-1280.672) (-1280.027) [-1281.663] -- 0:00:23
638000 -- (-1283.038) [-1280.120] (-1286.738) (-1283.601) * (-1279.594) (-1282.161) (-1280.041) [-1278.110] -- 0:00:23
638500 -- [-1281.052] (-1281.279) (-1282.815) (-1280.611) * (-1281.031) (-1283.217) [-1284.193] (-1282.685) -- 0:00:23
639000 -- (-1279.613) (-1283.822) [-1288.066] (-1280.830) * (-1281.613) [-1279.923] (-1281.689) (-1279.530) -- 0:00:23
639500 -- (-1283.442) (-1279.154) [-1280.817] (-1282.526) * (-1279.672) [-1280.644] (-1281.442) (-1281.904) -- 0:00:23
640000 -- (-1278.606) (-1282.100) [-1281.736] (-1280.950) * [-1281.372] (-1282.623) (-1281.009) (-1279.613) -- 0:00:23
Average standard deviation of split frequencies: 0.008928
640500 -- (-1285.872) (-1281.597) (-1279.190) [-1283.645] * (-1279.007) (-1282.994) [-1280.331] (-1282.661) -- 0:00:23
641000 -- [-1283.549] (-1278.351) (-1282.477) (-1282.977) * [-1281.537] (-1283.099) (-1280.913) (-1281.850) -- 0:00:23
641500 -- (-1285.382) [-1282.356] (-1281.569) (-1283.644) * (-1284.363) (-1283.929) (-1279.510) [-1281.174] -- 0:00:24
642000 -- [-1280.482] (-1280.453) (-1282.523) (-1285.183) * [-1283.721] (-1283.665) (-1282.178) (-1280.833) -- 0:00:23
642500 -- [-1279.837] (-1280.512) (-1286.682) (-1282.064) * (-1282.460) [-1281.578] (-1280.458) (-1278.945) -- 0:00:23
643000 -- (-1278.801) (-1280.270) (-1286.187) [-1279.714] * (-1282.365) (-1281.598) (-1280.471) [-1279.796] -- 0:00:23
643500 -- (-1282.744) (-1279.958) [-1281.921] (-1280.065) * [-1282.959] (-1280.573) (-1280.728) (-1279.535) -- 0:00:23
644000 -- [-1281.499] (-1281.665) (-1281.830) (-1279.734) * (-1280.574) [-1280.711] (-1280.795) (-1279.544) -- 0:00:23
644500 -- (-1284.249) [-1282.003] (-1282.433) (-1282.706) * (-1284.143) (-1280.439) (-1282.744) [-1283.257] -- 0:00:23
645000 -- (-1282.265) (-1280.801) (-1279.003) [-1279.659] * (-1286.790) [-1281.500] (-1281.251) (-1282.382) -- 0:00:23
Average standard deviation of split frequencies: 0.008951
645500 -- [-1279.904] (-1281.120) (-1279.190) (-1281.655) * [-1279.063] (-1282.375) (-1281.918) (-1281.674) -- 0:00:23
646000 -- (-1283.256) (-1282.209) [-1283.173] (-1279.339) * (-1280.199) [-1281.569] (-1281.149) (-1281.964) -- 0:00:23
646500 -- (-1281.136) (-1282.049) [-1282.138] (-1282.727) * (-1282.113) (-1282.196) [-1280.048] (-1282.035) -- 0:00:23
647000 -- (-1284.672) (-1280.564) [-1285.575] (-1280.562) * (-1282.468) (-1281.590) [-1279.828] (-1281.232) -- 0:00:23
647500 -- (-1281.682) [-1280.940] (-1284.664) (-1284.401) * [-1278.586] (-1282.997) (-1280.594) (-1282.161) -- 0:00:23
648000 -- (-1282.347) (-1280.542) [-1280.961] (-1281.412) * [-1280.517] (-1280.276) (-1282.662) (-1283.255) -- 0:00:23
648500 -- (-1283.948) (-1284.709) (-1281.171) [-1280.680] * (-1280.141) (-1283.762) [-1284.178] (-1281.072) -- 0:00:23
649000 -- (-1281.929) (-1280.995) [-1280.867] (-1280.314) * (-1283.907) (-1280.591) (-1282.360) [-1280.889] -- 0:00:23
649500 -- [-1280.063] (-1280.468) (-1280.715) (-1281.649) * [-1283.690] (-1279.518) (-1282.263) (-1280.665) -- 0:00:23
650000 -- [-1281.143] (-1278.754) (-1280.304) (-1280.575) * (-1283.281) [-1280.657] (-1279.886) (-1280.707) -- 0:00:23
Average standard deviation of split frequencies: 0.008791
650500 -- (-1281.540) [-1280.226] (-1281.394) (-1281.787) * (-1281.440) [-1280.196] (-1281.991) (-1283.234) -- 0:00:23
651000 -- [-1281.922] (-1281.505) (-1280.543) (-1284.453) * [-1280.202] (-1280.029) (-1282.570) (-1284.816) -- 0:00:23
651500 -- [-1280.180] (-1281.052) (-1278.088) (-1282.999) * (-1282.823) [-1280.270] (-1279.431) (-1280.239) -- 0:00:23
652000 -- [-1281.213] (-1280.518) (-1283.006) (-1283.556) * (-1280.297) (-1280.583) (-1281.549) [-1280.127] -- 0:00:22
652500 -- [-1282.799] (-1282.927) (-1282.342) (-1284.886) * (-1281.978) (-1280.975) [-1282.658] (-1279.892) -- 0:00:22
653000 -- (-1279.563) (-1285.541) [-1281.626] (-1280.747) * (-1279.191) (-1279.564) (-1281.804) [-1279.219] -- 0:00:22
653500 -- [-1279.018] (-1280.760) (-1280.312) (-1280.366) * (-1283.010) [-1281.929] (-1283.284) (-1283.792) -- 0:00:22
654000 -- (-1278.257) (-1282.108) [-1280.684] (-1278.095) * (-1283.202) (-1282.373) [-1282.135] (-1281.373) -- 0:00:22
654500 -- [-1280.287] (-1279.981) (-1281.453) (-1282.280) * (-1282.092) (-1282.423) [-1283.305] (-1286.502) -- 0:00:22
655000 -- (-1281.065) (-1280.289) [-1282.743] (-1281.683) * [-1284.534] (-1284.560) (-1282.288) (-1284.603) -- 0:00:22
Average standard deviation of split frequencies: 0.008240
655500 -- [-1282.169] (-1280.983) (-1280.836) (-1277.996) * (-1283.247) (-1282.026) (-1280.071) [-1282.406] -- 0:00:22
656000 -- (-1281.754) (-1279.193) (-1280.608) [-1280.564] * (-1290.933) (-1282.016) [-1281.147] (-1282.011) -- 0:00:22
656500 -- (-1280.426) (-1281.614) [-1282.614] (-1281.712) * (-1288.163) (-1280.461) [-1280.518] (-1280.147) -- 0:00:23
657000 -- (-1283.073) (-1280.969) (-1283.137) [-1279.246] * [-1283.972] (-1280.626) (-1282.790) (-1279.435) -- 0:00:22
657500 -- (-1282.957) (-1280.514) [-1281.799] (-1280.241) * [-1279.851] (-1279.640) (-1281.151) (-1278.612) -- 0:00:22
658000 -- [-1281.360] (-1280.500) (-1280.740) (-1282.515) * (-1281.088) (-1278.714) [-1282.457] (-1282.415) -- 0:00:22
658500 -- (-1279.144) (-1281.994) [-1282.859] (-1279.205) * (-1282.332) (-1280.869) [-1282.735] (-1281.956) -- 0:00:22
659000 -- (-1285.808) (-1280.937) [-1279.380] (-1279.937) * [-1281.657] (-1279.878) (-1285.758) (-1281.795) -- 0:00:22
659500 -- (-1280.986) (-1280.284) (-1279.016) [-1281.763] * (-1281.817) [-1281.066] (-1282.228) (-1282.920) -- 0:00:22
660000 -- (-1280.978) (-1282.170) (-1280.387) [-1280.447] * (-1282.463) [-1279.694] (-1280.616) (-1279.441) -- 0:00:22
Average standard deviation of split frequencies: 0.008372
660500 -- (-1281.941) [-1281.847] (-1280.477) (-1279.899) * [-1282.961] (-1281.367) (-1281.597) (-1286.669) -- 0:00:22
661000 -- [-1281.383] (-1281.227) (-1282.793) (-1281.599) * (-1282.269) (-1283.186) [-1281.827] (-1282.690) -- 0:00:22
661500 -- (-1281.727) [-1282.442] (-1281.425) (-1280.850) * (-1280.745) [-1282.907] (-1280.759) (-1280.947) -- 0:00:22
662000 -- (-1283.571) (-1281.138) (-1280.398) [-1280.376] * (-1280.307) (-1284.038) [-1282.747] (-1281.424) -- 0:00:22
662500 -- (-1282.577) [-1281.333] (-1279.964) (-1280.140) * (-1282.844) (-1283.870) (-1279.565) [-1280.522] -- 0:00:22
663000 -- (-1281.421) (-1285.737) (-1281.409) [-1278.316] * (-1283.596) [-1283.572] (-1283.395) (-1281.602) -- 0:00:22
663500 -- (-1279.817) (-1282.528) [-1280.823] (-1281.895) * (-1278.379) (-1281.717) [-1282.048] (-1280.867) -- 0:00:22
664000 -- [-1279.168] (-1281.278) (-1278.752) (-1281.671) * (-1278.999) (-1283.271) [-1285.847] (-1281.589) -- 0:00:22
664500 -- (-1279.382) [-1279.279] (-1279.086) (-1281.113) * (-1281.496) (-1283.534) [-1283.081] (-1281.404) -- 0:00:22
665000 -- (-1281.037) (-1280.766) (-1280.289) [-1279.949] * (-1282.519) (-1285.185) (-1287.466) [-1285.067] -- 0:00:22
Average standard deviation of split frequencies: 0.007644
665500 -- (-1283.954) [-1281.770] (-1282.382) (-1281.140) * (-1280.242) (-1280.541) [-1279.966] (-1282.502) -- 0:00:22
666000 -- [-1282.806] (-1281.976) (-1280.209) (-1279.677) * [-1280.710] (-1281.333) (-1283.551) (-1282.759) -- 0:00:22
666500 -- (-1282.679) (-1281.257) (-1279.588) [-1278.643] * (-1281.446) (-1283.455) (-1282.729) [-1286.663] -- 0:00:22
667000 -- (-1280.572) (-1280.521) [-1282.359] (-1281.820) * (-1280.806) (-1282.982) (-1280.453) [-1281.364] -- 0:00:21
667500 -- (-1288.718) [-1280.615] (-1283.844) (-1283.130) * [-1283.285] (-1283.639) (-1282.174) (-1279.982) -- 0:00:21
668000 -- (-1283.088) (-1280.951) (-1284.002) [-1280.321] * (-1283.398) (-1282.149) (-1282.654) [-1282.166] -- 0:00:21
668500 -- (-1282.317) (-1280.868) (-1281.421) [-1282.550] * (-1280.576) (-1280.937) [-1282.154] (-1285.108) -- 0:00:21
669000 -- [-1279.885] (-1282.266) (-1283.461) (-1280.431) * [-1283.800] (-1279.882) (-1282.752) (-1281.331) -- 0:00:21
669500 -- [-1278.826] (-1281.346) (-1285.615) (-1281.313) * (-1282.361) [-1282.316] (-1282.213) (-1281.150) -- 0:00:21
670000 -- (-1280.163) [-1280.969] (-1280.873) (-1280.998) * [-1279.680] (-1280.231) (-1281.476) (-1282.265) -- 0:00:21
Average standard deviation of split frequencies: 0.007404
670500 -- (-1280.342) [-1279.104] (-1283.360) (-1282.837) * (-1281.146) [-1281.118] (-1285.478) (-1282.622) -- 0:00:21
671000 -- (-1283.462) (-1282.813) [-1280.488] (-1282.124) * (-1281.272) (-1279.831) (-1284.282) [-1282.249] -- 0:00:21
671500 -- [-1281.076] (-1286.509) (-1279.532) (-1280.503) * (-1285.535) (-1279.905) (-1281.757) [-1281.878] -- 0:00:22
672000 -- (-1281.493) (-1284.083) [-1280.004] (-1280.247) * [-1280.348] (-1283.371) (-1281.940) (-1282.496) -- 0:00:21
672500 -- (-1283.211) (-1281.681) [-1280.596] (-1281.761) * (-1283.260) [-1281.621] (-1284.943) (-1283.531) -- 0:00:21
673000 -- (-1283.336) (-1287.618) [-1278.430] (-1280.445) * (-1282.598) (-1282.766) [-1281.071] (-1281.866) -- 0:00:21
673500 -- (-1283.631) [-1282.121] (-1283.803) (-1281.272) * (-1279.582) (-1280.441) (-1284.372) [-1280.659] -- 0:00:21
674000 -- [-1282.795] (-1284.484) (-1278.828) (-1281.072) * (-1280.496) (-1278.764) (-1282.565) [-1284.007] -- 0:00:21
674500 -- (-1282.847) [-1282.488] (-1280.939) (-1281.807) * (-1281.017) (-1279.213) [-1282.392] (-1282.291) -- 0:00:21
675000 -- (-1280.917) (-1283.767) (-1279.350) [-1279.097] * (-1284.977) (-1282.141) (-1283.825) [-1282.503] -- 0:00:21
Average standard deviation of split frequencies: 0.007299
675500 -- (-1281.173) [-1282.066] (-1283.052) (-1278.544) * (-1281.996) (-1283.259) [-1282.279] (-1281.749) -- 0:00:21
676000 -- (-1280.652) (-1284.836) [-1284.414] (-1280.100) * (-1285.607) (-1282.363) (-1281.810) [-1281.327] -- 0:00:21
676500 -- [-1281.226] (-1280.447) (-1283.089) (-1279.674) * (-1283.319) (-1283.380) [-1280.901] (-1284.395) -- 0:00:21
677000 -- (-1284.387) [-1279.094] (-1284.915) (-1282.074) * (-1280.201) (-1281.790) (-1281.953) [-1280.144] -- 0:00:21
677500 -- (-1283.760) (-1281.009) [-1282.229] (-1281.756) * (-1279.491) (-1282.237) [-1280.724] (-1280.477) -- 0:00:21
678000 -- (-1281.278) [-1281.845] (-1282.492) (-1280.430) * (-1285.236) (-1284.749) (-1281.067) [-1280.710] -- 0:00:21
678500 -- (-1281.413) [-1283.248] (-1283.652) (-1281.039) * [-1282.763] (-1281.738) (-1280.614) (-1284.595) -- 0:00:21
679000 -- [-1280.442] (-1280.797) (-1281.729) (-1280.108) * (-1280.821) [-1279.911] (-1281.076) (-1284.652) -- 0:00:21
679500 -- (-1281.628) [-1280.701] (-1282.118) (-1282.743) * [-1279.724] (-1281.132) (-1281.448) (-1285.121) -- 0:00:21
680000 -- [-1279.024] (-1281.519) (-1282.450) (-1279.016) * (-1282.571) [-1281.595] (-1281.205) (-1281.722) -- 0:00:21
Average standard deviation of split frequencies: 0.006649
680500 -- (-1281.380) (-1283.648) (-1281.088) [-1284.725] * [-1279.930] (-1280.355) (-1281.900) (-1285.943) -- 0:00:21
681000 -- (-1281.159) (-1282.553) (-1283.437) [-1282.863] * (-1279.880) (-1281.612) [-1278.657] (-1282.113) -- 0:00:21
681500 -- (-1280.501) (-1283.415) [-1278.705] (-1282.652) * [-1281.074] (-1278.610) (-1280.363) (-1279.734) -- 0:00:21
682000 -- (-1280.484) (-1280.898) (-1278.401) [-1284.909] * (-1280.443) [-1283.571] (-1280.172) (-1280.749) -- 0:00:20
682500 -- (-1279.842) [-1280.049] (-1281.024) (-1282.917) * (-1281.721) (-1280.262) [-1283.108] (-1281.731) -- 0:00:20
683000 -- [-1279.297] (-1281.798) (-1280.509) (-1283.986) * (-1282.598) (-1280.525) (-1279.547) [-1282.283] -- 0:00:20
683500 -- (-1280.415) (-1283.433) (-1280.386) [-1281.334] * (-1283.406) (-1279.066) (-1283.801) [-1285.998] -- 0:00:20
684000 -- (-1283.244) (-1284.825) (-1280.816) [-1278.853] * (-1280.242) [-1278.781] (-1282.704) (-1279.941) -- 0:00:20
684500 -- (-1287.605) (-1280.088) (-1281.558) [-1280.355] * [-1280.474] (-1280.651) (-1286.791) (-1283.864) -- 0:00:20
685000 -- [-1280.391] (-1280.429) (-1281.831) (-1279.875) * (-1278.137) [-1281.653] (-1283.080) (-1279.193) -- 0:00:20
Average standard deviation of split frequencies: 0.006872
685500 -- [-1280.082] (-1285.857) (-1280.066) (-1281.575) * (-1284.866) (-1285.288) (-1281.553) [-1278.584] -- 0:00:20
686000 -- (-1280.322) (-1285.537) (-1279.895) [-1281.662] * (-1281.378) (-1279.744) (-1283.121) [-1277.961] -- 0:00:20
686500 -- [-1281.313] (-1281.212) (-1283.249) (-1279.290) * [-1280.292] (-1282.415) (-1283.943) (-1280.240) -- 0:00:21
687000 -- (-1281.375) [-1280.628] (-1282.072) (-1281.080) * (-1280.146) [-1279.556] (-1283.646) (-1280.981) -- 0:00:20
687500 -- (-1283.100) (-1280.501) (-1282.022) [-1283.285] * (-1279.063) (-1284.074) [-1280.367] (-1280.155) -- 0:00:20
688000 -- (-1278.966) [-1280.053] (-1281.644) (-1282.824) * (-1279.147) (-1283.285) (-1280.262) [-1282.517] -- 0:00:20
688500 -- (-1278.140) (-1280.156) [-1284.326] (-1280.333) * (-1281.503) (-1280.767) [-1281.459] (-1280.738) -- 0:00:20
689000 -- (-1280.166) (-1284.944) [-1281.403] (-1282.757) * [-1280.108] (-1279.125) (-1278.824) (-1279.406) -- 0:00:20
689500 -- (-1288.043) [-1279.741] (-1281.582) (-1280.149) * (-1279.907) (-1283.036) [-1280.086] (-1281.692) -- 0:00:20
690000 -- (-1280.576) (-1282.222) [-1284.563] (-1281.071) * [-1279.195] (-1282.181) (-1280.461) (-1281.077) -- 0:00:20
Average standard deviation of split frequencies: 0.006962
690500 -- (-1282.808) (-1281.560) [-1283.125] (-1279.076) * (-1281.115) (-1283.935) (-1282.475) [-1280.282] -- 0:00:20
691000 -- [-1282.043] (-1280.084) (-1282.889) (-1281.172) * (-1280.195) (-1278.099) (-1282.005) [-1281.646] -- 0:00:20
691500 -- (-1281.787) (-1281.992) [-1279.952] (-1281.595) * [-1279.179] (-1277.210) (-1279.433) (-1282.841) -- 0:00:20
692000 -- (-1280.539) (-1282.422) [-1282.680] (-1279.504) * (-1280.799) (-1280.049) (-1282.519) [-1281.317] -- 0:00:20
692500 -- (-1279.931) (-1282.869) (-1281.115) [-1278.315] * (-1282.587) (-1281.584) [-1279.454] (-1281.145) -- 0:00:20
693000 -- (-1280.038) (-1283.611) [-1281.409] (-1279.982) * (-1280.173) (-1281.582) (-1279.989) [-1283.898] -- 0:00:20
693500 -- (-1281.441) (-1284.511) [-1279.705] (-1281.195) * [-1279.538] (-1281.617) (-1281.607) (-1281.537) -- 0:00:20
694000 -- (-1279.300) (-1284.615) [-1279.924] (-1279.332) * [-1279.897] (-1281.449) (-1283.295) (-1282.234) -- 0:00:20
694500 -- [-1281.376] (-1282.099) (-1279.653) (-1279.108) * [-1283.215] (-1279.727) (-1279.351) (-1280.102) -- 0:00:20
695000 -- (-1280.050) [-1282.772] (-1280.822) (-1284.020) * (-1281.885) (-1279.529) [-1280.486] (-1280.322) -- 0:00:20
Average standard deviation of split frequencies: 0.006818
695500 -- (-1280.842) [-1282.311] (-1282.858) (-1280.842) * (-1283.100) (-1282.170) [-1279.278] (-1283.050) -- 0:00:20
696000 -- [-1281.897] (-1282.469) (-1281.668) (-1279.613) * (-1284.320) (-1280.354) [-1283.082] (-1279.970) -- 0:00:20
696500 -- (-1282.203) (-1281.682) (-1283.052) [-1279.776] * (-1282.924) [-1280.189] (-1282.162) (-1284.479) -- 0:00:20
697000 -- (-1283.330) (-1282.988) (-1283.092) [-1279.440] * (-1281.531) [-1278.963] (-1286.275) (-1281.559) -- 0:00:19
697500 -- (-1281.198) (-1282.891) [-1280.720] (-1280.787) * [-1280.932] (-1282.951) (-1282.804) (-1284.685) -- 0:00:19
698000 -- (-1279.964) (-1280.811) [-1279.445] (-1281.345) * (-1282.921) (-1280.226) (-1281.308) [-1280.099] -- 0:00:19
698500 -- (-1279.314) (-1279.234) [-1281.021] (-1277.795) * (-1282.563) (-1281.759) (-1280.466) [-1280.372] -- 0:00:19
699000 -- (-1282.599) [-1280.915] (-1280.470) (-1283.357) * [-1284.979] (-1280.812) (-1282.152) (-1281.989) -- 0:00:19
699500 -- (-1280.681) (-1285.977) (-1280.785) [-1280.399] * (-1285.340) (-1279.012) (-1282.606) [-1282.509] -- 0:00:19
700000 -- [-1278.154] (-1282.523) (-1281.079) (-1280.397) * (-1282.708) (-1280.123) [-1282.793] (-1280.593) -- 0:00:19
Average standard deviation of split frequencies: 0.006459
700500 -- (-1281.432) [-1283.007] (-1279.781) (-1286.153) * (-1284.752) (-1281.230) [-1281.500] (-1280.531) -- 0:00:19
701000 -- [-1278.289] (-1281.229) (-1282.497) (-1281.058) * (-1280.293) [-1283.125] (-1281.092) (-1283.671) -- 0:00:19
701500 -- (-1282.605) (-1280.019) [-1284.361] (-1280.520) * [-1281.370] (-1281.496) (-1280.946) (-1283.122) -- 0:00:19
702000 -- (-1280.353) (-1280.626) (-1285.376) [-1280.962] * (-1282.834) [-1281.229] (-1281.858) (-1282.167) -- 0:00:19
702500 -- [-1281.553] (-1291.542) (-1286.454) (-1282.322) * (-1285.254) [-1281.904] (-1280.105) (-1285.050) -- 0:00:19
703000 -- [-1280.826] (-1284.320) (-1281.577) (-1280.275) * (-1287.980) (-1281.694) (-1280.588) [-1283.632] -- 0:00:19
703500 -- [-1284.485] (-1281.228) (-1281.789) (-1280.359) * (-1286.340) (-1280.173) [-1278.398] (-1281.943) -- 0:00:19
704000 -- (-1284.032) [-1278.951] (-1279.872) (-1280.194) * [-1280.747] (-1283.379) (-1278.177) (-1280.894) -- 0:00:19
704500 -- [-1283.334] (-1280.824) (-1280.357) (-1279.330) * [-1280.204] (-1279.879) (-1279.543) (-1280.732) -- 0:00:19
705000 -- (-1285.256) [-1283.678] (-1282.533) (-1281.119) * (-1280.551) [-1280.246] (-1279.903) (-1279.613) -- 0:00:19
Average standard deviation of split frequencies: 0.006366
705500 -- [-1280.303] (-1280.540) (-1281.778) (-1279.587) * (-1281.080) [-1281.930] (-1282.480) (-1281.795) -- 0:00:19
706000 -- (-1279.581) [-1286.931] (-1280.321) (-1280.331) * (-1280.776) (-1281.260) [-1280.723] (-1280.124) -- 0:00:19
706500 -- [-1279.187] (-1279.975) (-1282.111) (-1280.242) * (-1279.013) (-1281.013) (-1279.219) [-1285.212] -- 0:00:19
707000 -- (-1280.073) (-1281.353) [-1281.055] (-1281.471) * [-1282.720] (-1281.337) (-1280.430) (-1283.739) -- 0:00:19
707500 -- [-1279.832] (-1279.591) (-1280.723) (-1279.599) * (-1281.166) (-1283.474) (-1284.412) [-1283.945] -- 0:00:19
708000 -- [-1281.295] (-1282.806) (-1282.453) (-1281.546) * [-1278.496] (-1284.338) (-1280.799) (-1282.176) -- 0:00:19
708500 -- (-1280.652) [-1283.905] (-1280.772) (-1281.144) * [-1279.612] (-1278.488) (-1280.934) (-1280.979) -- 0:00:19
709000 -- (-1279.352) (-1284.401) (-1280.089) [-1280.597] * (-1280.848) (-1279.050) (-1282.185) [-1280.566] -- 0:00:19
709500 -- [-1282.953] (-1281.654) (-1280.306) (-1283.558) * (-1280.785) (-1279.993) [-1280.695] (-1278.722) -- 0:00:19
710000 -- [-1280.370] (-1281.228) (-1283.195) (-1283.134) * (-1280.313) (-1280.371) (-1277.865) [-1281.404] -- 0:00:19
Average standard deviation of split frequencies: 0.006810
710500 -- [-1280.352] (-1282.507) (-1282.316) (-1280.620) * (-1282.861) [-1278.982] (-1280.020) (-1282.209) -- 0:00:19
711000 -- [-1281.861] (-1282.801) (-1283.205) (-1280.871) * (-1278.681) (-1283.782) [-1280.637] (-1279.527) -- 0:00:19
711500 -- [-1279.996] (-1281.822) (-1280.489) (-1281.643) * (-1281.804) (-1280.721) [-1278.959] (-1283.818) -- 0:00:19
712000 -- [-1280.184] (-1280.923) (-1280.346) (-1285.639) * [-1280.666] (-1282.178) (-1279.515) (-1282.493) -- 0:00:19
712500 -- (-1280.271) [-1280.984] (-1280.205) (-1280.549) * (-1279.698) (-1282.091) [-1281.985] (-1283.703) -- 0:00:18
713000 -- [-1279.584] (-1280.727) (-1278.396) (-1281.585) * [-1281.113] (-1284.825) (-1280.887) (-1281.022) -- 0:00:18
713500 -- (-1281.604) (-1280.251) (-1279.339) [-1280.377] * [-1280.077] (-1281.272) (-1281.332) (-1278.117) -- 0:00:18
714000 -- (-1280.435) (-1277.947) [-1280.337] (-1280.916) * (-1285.907) (-1280.164) (-1283.696) [-1280.051] -- 0:00:18
714500 -- (-1279.942) [-1282.191] (-1279.850) (-1280.566) * (-1279.753) (-1279.307) (-1282.774) [-1277.753] -- 0:00:18
715000 -- (-1281.262) (-1283.202) (-1281.941) [-1280.639] * (-1281.644) (-1283.798) [-1279.325] (-1282.464) -- 0:00:18
Average standard deviation of split frequencies: 0.006716
715500 -- (-1281.167) (-1281.498) (-1280.132) [-1281.938] * [-1280.982] (-1283.878) (-1279.006) (-1279.320) -- 0:00:18
716000 -- (-1282.400) (-1286.395) [-1279.439] (-1285.098) * [-1280.610] (-1280.601) (-1280.512) (-1280.599) -- 0:00:18
716500 -- (-1283.530) [-1280.186] (-1282.092) (-1281.920) * [-1279.737] (-1280.100) (-1280.202) (-1280.121) -- 0:00:18
717000 -- [-1283.602] (-1279.785) (-1280.440) (-1284.642) * (-1282.625) (-1279.553) [-1281.229] (-1279.369) -- 0:00:18
717500 -- (-1280.947) (-1280.114) (-1280.188) [-1281.593] * (-1280.965) [-1281.375] (-1280.189) (-1281.220) -- 0:00:18
718000 -- [-1279.511] (-1284.106) (-1278.858) (-1280.741) * (-1280.015) (-1281.663) [-1283.823] (-1279.510) -- 0:00:18
718500 -- (-1281.666) (-1280.116) [-1279.198] (-1282.375) * [-1282.585] (-1288.305) (-1283.672) (-1284.115) -- 0:00:18
719000 -- (-1279.345) [-1281.498] (-1283.579) (-1281.814) * (-1280.786) (-1284.748) (-1283.845) [-1279.171] -- 0:00:18
719500 -- [-1279.516] (-1283.645) (-1284.904) (-1285.304) * (-1281.943) (-1280.592) (-1280.939) [-1279.910] -- 0:00:18
720000 -- [-1279.201] (-1287.645) (-1282.984) (-1280.823) * (-1280.928) (-1280.300) (-1281.722) [-1281.259] -- 0:00:18
Average standard deviation of split frequencies: 0.006498
720500 -- [-1280.685] (-1281.243) (-1280.737) (-1281.377) * [-1281.905] (-1280.193) (-1283.806) (-1286.101) -- 0:00:18
721000 -- (-1278.525) (-1279.968) [-1279.251] (-1282.307) * (-1281.610) (-1278.765) [-1278.933] (-1285.258) -- 0:00:18
721500 -- [-1280.330] (-1279.216) (-1283.358) (-1284.282) * (-1285.770) (-1281.744) [-1280.900] (-1283.106) -- 0:00:18
722000 -- (-1278.764) (-1283.135) [-1280.080] (-1280.353) * (-1283.986) (-1281.074) (-1281.997) [-1281.861] -- 0:00:18
722500 -- (-1282.239) [-1281.328] (-1281.810) (-1281.025) * [-1283.832] (-1282.745) (-1281.361) (-1281.002) -- 0:00:18
723000 -- (-1281.980) (-1283.474) (-1281.228) [-1279.793] * [-1281.539] (-1281.026) (-1282.617) (-1281.641) -- 0:00:18
723500 -- (-1282.067) (-1281.015) (-1281.079) [-1282.313] * (-1280.275) [-1281.911] (-1283.149) (-1281.739) -- 0:00:18
724000 -- (-1285.684) [-1280.052] (-1281.638) (-1281.146) * [-1282.098] (-1280.771) (-1288.621) (-1279.845) -- 0:00:18
724500 -- (-1282.684) [-1278.948] (-1285.267) (-1280.383) * (-1282.349) (-1282.482) [-1280.432] (-1279.501) -- 0:00:18
725000 -- (-1285.071) (-1280.534) (-1282.260) [-1281.183] * (-1281.248) (-1280.251) (-1287.600) [-1283.198] -- 0:00:18
Average standard deviation of split frequencies: 0.006493
725500 -- [-1282.630] (-1280.265) (-1277.529) (-1280.850) * (-1284.227) (-1280.876) [-1282.274] (-1282.295) -- 0:00:18
726000 -- (-1283.336) (-1281.067) [-1280.656] (-1280.996) * (-1280.450) [-1282.465] (-1287.923) (-1282.024) -- 0:00:18
726500 -- [-1279.749] (-1280.171) (-1283.207) (-1282.236) * (-1280.926) [-1282.306] (-1281.122) (-1278.876) -- 0:00:18
727000 -- [-1281.025] (-1281.211) (-1279.771) (-1283.721) * (-1282.710) (-1279.512) [-1279.106] (-1280.104) -- 0:00:18
727500 -- (-1280.760) (-1282.988) (-1281.358) [-1278.899] * (-1282.776) (-1282.723) [-1280.521] (-1279.392) -- 0:00:17
728000 -- (-1281.105) (-1282.437) [-1278.700] (-1283.302) * (-1282.174) (-1280.193) [-1282.044] (-1281.120) -- 0:00:17
728500 -- (-1282.120) [-1280.785] (-1279.063) (-1281.606) * [-1281.834] (-1281.944) (-1281.541) (-1279.687) -- 0:00:17
729000 -- (-1281.980) (-1282.484) (-1280.317) [-1283.851] * (-1281.032) (-1281.687) (-1284.326) [-1281.049] -- 0:00:17
729500 -- (-1281.005) [-1286.440] (-1280.152) (-1284.280) * (-1284.462) (-1280.262) [-1281.065] (-1280.036) -- 0:00:17
730000 -- (-1281.325) [-1283.343] (-1285.955) (-1281.471) * (-1281.172) (-1282.331) (-1283.529) [-1279.887] -- 0:00:17
Average standard deviation of split frequencies: 0.006581
730500 -- (-1280.700) [-1280.890] (-1281.039) (-1282.935) * [-1281.655] (-1284.869) (-1285.492) (-1282.247) -- 0:00:17
731000 -- [-1278.986] (-1280.471) (-1279.492) (-1281.780) * (-1281.511) (-1281.297) (-1282.394) [-1279.464] -- 0:00:17
731500 -- [-1280.599] (-1282.666) (-1281.359) (-1280.466) * (-1283.551) (-1280.611) [-1279.780] (-1278.732) -- 0:00:17
732000 -- [-1279.530] (-1281.301) (-1280.949) (-1280.880) * (-1282.118) (-1281.143) (-1280.263) [-1279.267] -- 0:00:17
732500 -- (-1281.657) [-1282.969] (-1281.215) (-1282.864) * (-1279.936) (-1284.007) (-1280.832) [-1280.791] -- 0:00:17
733000 -- (-1280.161) (-1282.672) (-1281.504) [-1280.378] * (-1282.735) (-1280.255) (-1280.934) [-1282.051] -- 0:00:17
733500 -- [-1279.311] (-1281.499) (-1281.407) (-1281.232) * (-1280.462) (-1288.328) (-1280.944) [-1279.991] -- 0:00:17
734000 -- (-1281.939) [-1278.362] (-1280.774) (-1282.388) * (-1281.234) [-1280.432] (-1280.691) (-1277.925) -- 0:00:17
734500 -- (-1280.098) (-1280.781) (-1279.916) [-1281.017] * (-1281.127) (-1282.840) (-1281.950) [-1279.122] -- 0:00:17
735000 -- (-1280.686) (-1279.968) [-1283.440] (-1284.206) * (-1279.409) [-1281.784] (-1281.023) (-1279.215) -- 0:00:17
Average standard deviation of split frequencies: 0.006490
735500 -- (-1280.376) (-1281.146) (-1281.504) [-1280.616] * [-1282.074] (-1281.001) (-1284.659) (-1282.364) -- 0:00:17
736000 -- (-1279.310) (-1280.122) [-1283.858] (-1282.742) * (-1282.018) [-1280.287] (-1279.990) (-1280.727) -- 0:00:17
736500 -- (-1279.882) (-1281.169) (-1282.531) [-1280.557] * (-1282.081) (-1280.708) [-1280.179] (-1281.830) -- 0:00:17
737000 -- (-1282.371) (-1280.680) (-1281.168) [-1279.740] * (-1279.923) [-1282.957] (-1283.300) (-1280.179) -- 0:00:17
737500 -- (-1282.582) (-1280.397) [-1279.594] (-1282.700) * [-1280.172] (-1281.403) (-1280.191) (-1282.025) -- 0:00:17
738000 -- (-1280.574) (-1282.732) (-1283.604) [-1284.774] * (-1280.037) (-1282.009) (-1281.250) [-1281.705] -- 0:00:17
738500 -- (-1279.425) [-1284.613] (-1280.544) (-1289.941) * (-1280.068) (-1285.081) (-1282.972) [-1283.784] -- 0:00:17
739000 -- (-1281.241) (-1280.429) [-1281.878] (-1280.068) * [-1279.533] (-1283.372) (-1280.674) (-1285.378) -- 0:00:17
739500 -- (-1283.676) (-1281.931) [-1283.237] (-1281.107) * (-1283.338) (-1281.501) (-1282.659) [-1281.274] -- 0:00:17
740000 -- (-1282.421) [-1279.855] (-1281.871) (-1280.317) * [-1279.860] (-1280.948) (-1281.750) (-1283.214) -- 0:00:17
Average standard deviation of split frequencies: 0.005940
740500 -- (-1279.884) [-1279.544] (-1280.389) (-1281.280) * (-1281.032) [-1279.075] (-1285.213) (-1281.056) -- 0:00:17
741000 -- (-1280.236) [-1280.250] (-1279.544) (-1283.151) * (-1278.689) (-1280.360) (-1281.582) [-1284.035] -- 0:00:17
741500 -- (-1283.837) (-1280.254) [-1283.067] (-1283.642) * [-1279.238] (-1281.332) (-1280.336) (-1286.333) -- 0:00:17
742000 -- [-1284.161] (-1281.377) (-1282.385) (-1280.578) * (-1279.460) [-1281.774] (-1279.891) (-1283.197) -- 0:00:17
742500 -- (-1281.149) (-1282.236) (-1279.669) [-1281.214] * (-1281.164) [-1278.236] (-1278.988) (-1283.866) -- 0:00:16
743000 -- (-1282.183) (-1284.398) (-1280.817) [-1279.671] * (-1281.492) (-1282.037) (-1278.374) [-1279.610] -- 0:00:16
743500 -- [-1281.547] (-1284.404) (-1281.007) (-1281.496) * (-1280.425) (-1281.501) (-1281.025) [-1282.620] -- 0:00:16
744000 -- (-1284.758) (-1284.151) [-1281.992] (-1281.565) * (-1279.300) [-1281.392] (-1281.520) (-1281.048) -- 0:00:16
744500 -- (-1279.607) (-1281.994) (-1279.045) [-1280.980] * (-1279.532) (-1280.188) [-1283.086] (-1280.170) -- 0:00:16
745000 -- [-1280.520] (-1281.172) (-1283.362) (-1280.052) * (-1281.218) (-1283.710) [-1282.785] (-1278.753) -- 0:00:16
Average standard deviation of split frequencies: 0.006108
745500 -- [-1280.344] (-1282.271) (-1283.129) (-1281.307) * [-1284.664] (-1281.193) (-1284.724) (-1281.426) -- 0:00:16
746000 -- (-1281.875) (-1279.709) (-1284.012) [-1283.017] * (-1283.356) (-1281.134) [-1284.717] (-1282.587) -- 0:00:16
746500 -- (-1280.877) (-1281.358) [-1282.021] (-1281.652) * (-1280.648) [-1279.233] (-1284.281) (-1281.852) -- 0:00:16
747000 -- (-1282.990) (-1279.403) [-1281.397] (-1284.846) * (-1281.385) (-1280.651) (-1280.420) [-1279.957] -- 0:00:16
747500 -- (-1283.232) (-1280.442) [-1282.188] (-1282.722) * (-1282.331) [-1279.582] (-1281.594) (-1279.295) -- 0:00:16
748000 -- (-1282.320) [-1281.037] (-1282.373) (-1282.034) * (-1281.943) [-1280.451] (-1277.232) (-1281.257) -- 0:00:16
748500 -- (-1285.287) (-1280.346) (-1285.248) [-1284.859] * (-1282.455) (-1279.569) (-1281.844) [-1279.431] -- 0:00:16
749000 -- (-1281.453) [-1280.587] (-1283.506) (-1279.909) * (-1281.482) (-1281.925) [-1280.825] (-1284.391) -- 0:00:16
749500 -- (-1279.768) (-1279.966) (-1280.468) [-1281.155] * (-1283.274) (-1281.196) [-1282.428] (-1283.448) -- 0:00:16
750000 -- [-1280.296] (-1279.329) (-1280.062) (-1283.025) * (-1280.139) (-1280.237) (-1283.005) [-1280.131] -- 0:00:16
Average standard deviation of split frequencies: 0.006698
750500 -- (-1283.753) [-1279.296] (-1281.253) (-1280.268) * [-1282.699] (-1281.361) (-1283.690) (-1282.268) -- 0:00:16
751000 -- (-1280.114) [-1278.212] (-1284.437) (-1280.074) * [-1281.010] (-1283.914) (-1285.630) (-1282.329) -- 0:00:16
751500 -- [-1279.819] (-1283.210) (-1281.076) (-1285.258) * [-1280.250] (-1282.880) (-1279.135) (-1281.388) -- 0:00:16
752000 -- (-1280.057) (-1281.519) [-1279.030] (-1288.202) * (-1281.410) (-1284.160) (-1279.186) [-1285.219] -- 0:00:16
752500 -- (-1278.441) (-1283.971) [-1284.105] (-1286.391) * (-1279.484) (-1281.280) (-1281.150) [-1283.728] -- 0:00:16
753000 -- (-1279.238) (-1280.244) [-1278.594] (-1285.961) * (-1280.662) [-1282.675] (-1280.695) (-1280.341) -- 0:00:16
753500 -- [-1279.857] (-1280.749) (-1282.161) (-1281.008) * (-1281.004) (-1281.065) (-1280.266) [-1281.057] -- 0:00:16
754000 -- (-1280.416) [-1280.330] (-1278.828) (-1281.520) * (-1280.868) [-1280.718] (-1279.762) (-1282.310) -- 0:00:16
754500 -- (-1281.849) [-1280.123] (-1281.243) (-1280.990) * (-1280.251) [-1279.639] (-1281.129) (-1281.906) -- 0:00:16
755000 -- (-1282.474) (-1280.347) (-1281.309) [-1281.776] * (-1280.006) [-1281.158] (-1280.945) (-1279.746) -- 0:00:16
Average standard deviation of split frequencies: 0.006360
755500 -- [-1278.909] (-1281.603) (-1279.646) (-1283.511) * (-1282.203) [-1283.299] (-1282.693) (-1282.113) -- 0:00:16
756000 -- (-1280.581) (-1280.823) [-1279.080] (-1281.328) * (-1283.709) (-1285.556) (-1282.488) [-1281.968] -- 0:00:16
756500 -- (-1282.213) [-1283.209] (-1280.923) (-1282.289) * (-1280.897) (-1280.879) (-1283.209) [-1280.058] -- 0:00:16
757000 -- (-1282.086) [-1279.907] (-1278.921) (-1282.693) * (-1281.332) (-1284.493) [-1280.939] (-1282.018) -- 0:00:16
757500 -- [-1282.014] (-1279.893) (-1280.488) (-1286.451) * (-1287.917) (-1286.936) [-1280.549] (-1281.874) -- 0:00:16
758000 -- (-1281.542) (-1281.027) [-1281.677] (-1282.794) * (-1282.261) [-1283.262] (-1285.864) (-1281.631) -- 0:00:15
758500 -- [-1283.161] (-1283.951) (-1281.189) (-1279.517) * (-1281.301) (-1289.241) [-1278.321] (-1280.953) -- 0:00:15
759000 -- [-1279.688] (-1281.874) (-1282.755) (-1281.655) * (-1280.615) (-1280.082) (-1280.378) [-1281.237] -- 0:00:15
759500 -- (-1282.376) (-1280.761) [-1283.404] (-1280.128) * [-1279.118] (-1283.426) (-1279.917) (-1280.529) -- 0:00:15
760000 -- (-1282.408) (-1282.214) [-1278.904] (-1278.764) * [-1281.972] (-1282.993) (-1280.051) (-1282.078) -- 0:00:15
Average standard deviation of split frequencies: 0.006776
760500 -- (-1292.316) [-1282.982] (-1280.379) (-1280.938) * [-1279.295] (-1280.534) (-1280.837) (-1285.370) -- 0:00:15
761000 -- (-1279.718) [-1281.311] (-1280.541) (-1281.424) * (-1283.530) (-1280.494) (-1282.480) [-1282.973] -- 0:00:15
761500 -- (-1283.253) (-1280.202) [-1278.990] (-1284.070) * (-1282.311) (-1279.844) (-1286.430) [-1280.355] -- 0:00:15
762000 -- [-1282.368] (-1280.119) (-1280.507) (-1282.974) * (-1283.128) (-1283.410) [-1279.229] (-1281.540) -- 0:00:15
762500 -- (-1283.513) [-1280.964] (-1284.391) (-1282.548) * (-1279.098) [-1281.846] (-1280.296) (-1283.394) -- 0:00:15
763000 -- (-1280.794) (-1281.269) [-1281.733] (-1284.866) * (-1280.339) [-1280.097] (-1280.608) (-1283.914) -- 0:00:15
763500 -- (-1280.586) (-1285.047) (-1281.315) [-1279.870] * (-1282.077) (-1281.523) (-1280.840) [-1283.054] -- 0:00:15
764000 -- (-1280.641) (-1284.729) [-1282.787] (-1284.203) * (-1279.623) [-1280.506] (-1279.739) (-1279.921) -- 0:00:15
764500 -- [-1281.067] (-1284.630) (-1282.438) (-1282.156) * [-1279.904] (-1282.272) (-1283.998) (-1281.992) -- 0:00:15
765000 -- (-1280.130) (-1279.201) [-1280.892] (-1280.827) * [-1282.781] (-1288.053) (-1284.475) (-1280.784) -- 0:00:15
Average standard deviation of split frequencies: 0.006687
765500 -- (-1281.272) [-1280.181] (-1280.617) (-1278.963) * (-1280.834) (-1282.703) (-1283.444) [-1281.415] -- 0:00:15
766000 -- (-1281.378) (-1281.229) [-1280.437] (-1277.323) * (-1281.785) (-1282.312) (-1287.356) [-1281.115] -- 0:00:15
766500 -- [-1279.646] (-1287.573) (-1280.876) (-1278.168) * [-1278.913] (-1285.142) (-1281.412) (-1283.091) -- 0:00:15
767000 -- (-1280.714) (-1280.734) (-1283.426) [-1280.198] * (-1280.579) (-1282.976) [-1281.905] (-1279.842) -- 0:00:15
767500 -- (-1281.107) (-1285.714) (-1282.390) [-1280.368] * (-1282.359) (-1279.201) (-1283.135) [-1281.084] -- 0:00:15
768000 -- [-1279.398] (-1280.860) (-1282.941) (-1281.890) * (-1280.045) (-1280.234) (-1280.981) [-1279.624] -- 0:00:15
768500 -- (-1281.762) (-1278.011) (-1280.835) [-1277.681] * [-1279.668] (-1280.455) (-1281.724) (-1281.316) -- 0:00:15
769000 -- (-1282.878) (-1283.499) (-1281.015) [-1279.682] * [-1281.669] (-1280.739) (-1278.907) (-1282.560) -- 0:00:15
769500 -- (-1283.168) (-1284.440) [-1280.561] (-1278.772) * (-1281.512) (-1280.215) (-1283.913) [-1280.268] -- 0:00:15
770000 -- (-1280.053) (-1279.674) [-1280.716] (-1281.323) * [-1280.728] (-1282.340) (-1284.684) (-1280.750) -- 0:00:15
Average standard deviation of split frequencies: 0.006647
770500 -- [-1282.422] (-1279.728) (-1283.093) (-1283.676) * (-1281.193) (-1283.047) [-1279.533] (-1281.032) -- 0:00:15
771000 -- [-1277.916] (-1284.944) (-1281.890) (-1282.183) * [-1280.803] (-1282.574) (-1279.256) (-1278.212) -- 0:00:15
771500 -- (-1284.326) [-1280.449] (-1280.940) (-1280.047) * (-1285.531) [-1284.297] (-1278.667) (-1280.223) -- 0:00:15
772000 -- [-1282.438] (-1281.477) (-1283.923) (-1281.441) * (-1279.391) (-1285.277) [-1280.805] (-1280.565) -- 0:00:15
772500 -- (-1282.276) [-1281.881] (-1284.098) (-1283.137) * (-1280.399) (-1280.496) (-1281.666) [-1280.797] -- 0:00:15
773000 -- [-1278.951] (-1281.530) (-1279.100) (-1280.461) * [-1279.914] (-1280.119) (-1281.834) (-1280.823) -- 0:00:14
773500 -- (-1279.619) (-1284.216) (-1279.108) [-1282.556] * (-1283.982) (-1280.472) [-1280.060] (-1283.148) -- 0:00:14
774000 -- (-1281.768) (-1280.409) (-1280.081) [-1285.531] * (-1279.172) (-1280.226) (-1282.235) [-1280.644] -- 0:00:14
774500 -- (-1284.600) (-1282.489) (-1279.576) [-1280.288] * (-1280.792) (-1280.663) [-1283.508] (-1281.102) -- 0:00:14
775000 -- (-1285.115) [-1280.522] (-1282.774) (-1282.027) * (-1282.334) [-1282.993] (-1281.077) (-1280.198) -- 0:00:14
Average standard deviation of split frequencies: 0.006763
775500 -- (-1283.663) [-1280.474] (-1281.017) (-1280.870) * (-1282.409) (-1281.350) (-1284.670) [-1280.813] -- 0:00:14
776000 -- [-1278.791] (-1282.966) (-1283.885) (-1281.300) * [-1279.494] (-1286.232) (-1280.897) (-1277.652) -- 0:00:14
776500 -- (-1281.819) [-1281.051] (-1281.074) (-1281.321) * (-1277.950) (-1281.361) (-1283.462) [-1279.050] -- 0:00:14
777000 -- [-1280.539] (-1280.463) (-1281.136) (-1281.957) * (-1277.910) (-1281.551) [-1282.426] (-1280.634) -- 0:00:14
777500 -- (-1280.354) (-1281.576) (-1283.483) [-1285.252] * (-1279.906) [-1282.759] (-1281.418) (-1281.428) -- 0:00:14
778000 -- (-1281.988) (-1280.434) [-1283.257] (-1281.838) * (-1280.483) (-1281.032) [-1279.897] (-1284.270) -- 0:00:14
778500 -- [-1284.122] (-1278.857) (-1278.932) (-1282.587) * (-1278.735) (-1283.812) (-1288.012) [-1280.179] -- 0:00:14
779000 -- [-1281.224] (-1278.340) (-1281.102) (-1281.440) * (-1279.454) (-1281.873) (-1282.776) [-1279.000] -- 0:00:14
779500 -- (-1280.682) (-1281.003) [-1282.629] (-1279.350) * [-1281.397] (-1282.961) (-1281.630) (-1280.936) -- 0:00:14
780000 -- (-1280.791) (-1283.000) (-1280.295) [-1281.328] * (-1284.186) (-1282.801) (-1281.127) [-1282.470] -- 0:00:14
Average standard deviation of split frequencies: 0.006642
780500 -- (-1282.379) (-1285.007) (-1281.655) [-1279.816] * (-1280.496) (-1283.365) [-1280.539] (-1281.125) -- 0:00:14
781000 -- [-1279.527] (-1285.950) (-1279.403) (-1281.507) * [-1280.125] (-1282.565) (-1280.724) (-1284.804) -- 0:00:14
781500 -- (-1282.722) (-1282.773) [-1279.214] (-1280.836) * [-1278.955] (-1279.317) (-1280.379) (-1280.243) -- 0:00:14
782000 -- (-1280.757) (-1281.110) [-1279.563] (-1286.036) * (-1280.165) (-1279.319) (-1282.230) [-1283.997] -- 0:00:14
782500 -- (-1279.574) (-1278.273) [-1282.502] (-1286.961) * (-1279.877) (-1283.109) (-1282.741) [-1280.647] -- 0:00:14
783000 -- (-1282.104) (-1282.028) [-1281.059] (-1282.775) * (-1280.847) (-1282.351) (-1282.463) [-1282.021] -- 0:00:14
783500 -- (-1285.183) (-1283.513) [-1281.456] (-1283.883) * [-1280.566] (-1278.928) (-1285.043) (-1281.003) -- 0:00:14
784000 -- (-1284.418) [-1278.412] (-1285.339) (-1281.926) * (-1283.162) (-1280.007) [-1281.089] (-1281.400) -- 0:00:14
784500 -- [-1280.330] (-1280.551) (-1282.344) (-1280.885) * (-1281.424) (-1280.211) (-1283.335) [-1282.568] -- 0:00:14
785000 -- (-1284.739) (-1278.461) (-1286.425) [-1281.086] * (-1281.001) [-1279.834] (-1284.934) (-1283.093) -- 0:00:14
Average standard deviation of split frequencies: 0.006957
785500 -- (-1282.852) (-1284.208) [-1284.009] (-1278.202) * [-1280.938] (-1281.618) (-1283.668) (-1283.658) -- 0:00:14
786000 -- (-1278.691) (-1286.646) (-1281.414) [-1280.232] * (-1281.815) [-1281.045] (-1281.446) (-1281.714) -- 0:00:14
786500 -- (-1281.826) (-1280.934) [-1279.726] (-1283.177) * [-1278.493] (-1280.687) (-1280.762) (-1281.885) -- 0:00:14
787000 -- (-1284.011) (-1280.234) (-1280.490) [-1280.354] * (-1281.219) (-1280.967) (-1281.428) [-1280.215] -- 0:00:14
787500 -- (-1283.102) [-1279.035] (-1280.863) (-1282.366) * [-1280.806] (-1280.918) (-1280.042) (-1278.990) -- 0:00:14
788000 -- (-1284.517) [-1283.654] (-1279.602) (-1283.126) * (-1281.862) (-1282.261) [-1283.752] (-1282.833) -- 0:00:13
788500 -- (-1282.108) (-1283.531) [-1281.207] (-1283.395) * (-1280.120) (-1283.272) (-1285.148) [-1279.977] -- 0:00:13
789000 -- [-1281.078] (-1285.391) (-1281.978) (-1280.694) * (-1282.604) (-1284.056) [-1280.395] (-1280.310) -- 0:00:13
789500 -- [-1283.387] (-1280.076) (-1280.361) (-1280.361) * [-1282.250] (-1284.701) (-1281.649) (-1280.105) -- 0:00:13
790000 -- (-1281.069) [-1281.982] (-1287.851) (-1280.357) * (-1278.964) [-1283.777] (-1281.330) (-1280.180) -- 0:00:13
Average standard deviation of split frequencies: 0.007035
790500 -- (-1281.048) (-1279.053) (-1280.184) [-1280.823] * (-1281.717) (-1283.167) [-1280.959] (-1280.180) -- 0:00:13
791000 -- (-1283.358) (-1283.966) (-1280.164) [-1280.606] * (-1281.030) [-1283.705] (-1281.190) (-1279.496) -- 0:00:13
791500 -- (-1278.936) (-1279.058) (-1284.186) [-1279.971] * [-1282.199] (-1282.146) (-1280.695) (-1280.242) -- 0:00:13
792000 -- (-1284.566) [-1279.301] (-1282.657) (-1279.888) * (-1280.097) (-1282.261) [-1278.652] (-1279.377) -- 0:00:13
792500 -- (-1284.398) (-1279.624) [-1286.121] (-1281.286) * (-1284.395) (-1279.414) (-1283.808) [-1281.574] -- 0:00:13
793000 -- (-1280.883) (-1284.189) [-1287.776] (-1282.623) * (-1279.756) (-1280.436) [-1282.421] (-1281.716) -- 0:00:13
793500 -- (-1279.968) (-1282.346) (-1283.295) [-1284.306] * [-1279.527] (-1284.488) (-1280.398) (-1285.570) -- 0:00:13
794000 -- (-1279.727) [-1282.140] (-1280.871) (-1281.820) * (-1279.610) (-1279.703) [-1279.851] (-1281.877) -- 0:00:13
794500 -- (-1280.614) (-1280.678) (-1280.577) [-1279.130] * (-1280.459) (-1279.984) (-1281.922) [-1281.512] -- 0:00:13
795000 -- (-1280.819) (-1282.762) [-1279.442] (-1280.940) * (-1281.920) (-1282.957) [-1281.451] (-1279.859) -- 0:00:13
Average standard deviation of split frequencies: 0.007107
795500 -- (-1280.246) [-1281.262] (-1281.785) (-1289.408) * [-1278.893] (-1280.209) (-1283.326) (-1280.141) -- 0:00:13
796000 -- [-1282.980] (-1280.468) (-1281.177) (-1284.789) * (-1279.654) (-1281.077) (-1280.878) [-1278.716] -- 0:00:13
796500 -- (-1281.669) (-1282.966) [-1283.328] (-1281.646) * (-1284.092) (-1281.223) [-1281.224] (-1280.496) -- 0:00:13
797000 -- (-1282.452) (-1279.537) (-1279.851) [-1281.918] * (-1279.117) [-1279.372] (-1280.282) (-1280.362) -- 0:00:13
797500 -- (-1283.857) [-1282.614] (-1280.060) (-1280.965) * (-1281.148) [-1281.766] (-1282.473) (-1281.535) -- 0:00:13
798000 -- (-1283.149) (-1281.555) (-1279.691) [-1282.078] * (-1281.277) [-1281.114] (-1282.760) (-1282.175) -- 0:00:13
798500 -- (-1281.717) [-1281.209] (-1281.121) (-1279.999) * (-1278.953) (-1282.558) (-1281.816) [-1279.987] -- 0:00:13
799000 -- (-1282.513) (-1281.948) [-1281.217] (-1278.568) * (-1280.593) (-1282.879) [-1282.954] (-1280.898) -- 0:00:13
799500 -- (-1279.755) [-1283.271] (-1281.593) (-1281.305) * (-1281.884) [-1281.340] (-1279.570) (-1281.211) -- 0:00:13
800000 -- (-1282.606) (-1282.997) (-1280.403) [-1281.693] * (-1280.741) (-1280.762) [-1279.885] (-1281.308) -- 0:00:13
Average standard deviation of split frequencies: 0.007301
800500 -- (-1280.595) (-1281.316) (-1281.617) [-1281.176] * [-1280.347] (-1281.167) (-1282.616) (-1280.475) -- 0:00:13
801000 -- (-1281.856) [-1279.233] (-1281.415) (-1284.669) * (-1280.886) (-1288.471) [-1281.490] (-1279.131) -- 0:00:13
801500 -- [-1280.642] (-1283.409) (-1280.072) (-1284.044) * [-1278.838] (-1286.447) (-1282.861) (-1280.363) -- 0:00:13
802000 -- (-1281.673) (-1282.470) [-1280.344] (-1283.249) * (-1284.474) (-1282.250) [-1287.443] (-1281.028) -- 0:00:13
802500 -- (-1281.597) [-1281.065] (-1279.863) (-1280.236) * (-1279.073) [-1280.281] (-1282.969) (-1280.366) -- 0:00:13
803000 -- [-1279.628] (-1281.632) (-1284.263) (-1280.552) * (-1280.310) [-1280.831] (-1280.736) (-1283.574) -- 0:00:13
803500 -- (-1281.289) [-1281.751] (-1280.349) (-1280.484) * [-1281.027] (-1285.966) (-1279.068) (-1281.381) -- 0:00:12
804000 -- [-1280.724] (-1279.961) (-1282.036) (-1280.677) * (-1281.108) [-1281.313] (-1279.752) (-1285.090) -- 0:00:12
804500 -- [-1280.613] (-1279.673) (-1281.585) (-1282.420) * (-1281.112) (-1280.617) (-1283.303) [-1280.965] -- 0:00:12
805000 -- [-1283.983] (-1281.118) (-1283.754) (-1281.249) * (-1281.070) [-1282.286] (-1284.680) (-1279.736) -- 0:00:12
Average standard deviation of split frequencies: 0.007135
805500 -- [-1282.413] (-1278.623) (-1281.454) (-1279.229) * (-1284.742) (-1281.203) (-1281.506) [-1283.097] -- 0:00:12
806000 -- [-1281.802] (-1279.942) (-1280.945) (-1283.661) * (-1280.040) [-1285.143] (-1281.046) (-1282.802) -- 0:00:12
806500 -- [-1281.452] (-1279.817) (-1280.087) (-1280.664) * (-1278.823) (-1282.452) [-1280.332] (-1278.932) -- 0:00:12
807000 -- (-1284.053) (-1281.193) (-1280.473) [-1279.593] * (-1282.525) (-1284.013) [-1280.350] (-1282.209) -- 0:00:12
807500 -- [-1283.122] (-1283.052) (-1280.787) (-1278.909) * [-1281.814] (-1282.304) (-1281.333) (-1280.545) -- 0:00:12
808000 -- (-1286.327) (-1280.665) (-1280.233) [-1281.399] * (-1278.813) (-1278.676) [-1279.780] (-1280.148) -- 0:00:12
808500 -- [-1282.198] (-1281.447) (-1279.881) (-1281.584) * (-1278.728) (-1281.734) (-1280.039) [-1279.672] -- 0:00:12
809000 -- (-1282.157) (-1279.741) [-1282.010] (-1283.945) * (-1285.243) [-1282.015] (-1282.205) (-1281.973) -- 0:00:12
809500 -- (-1279.700) (-1280.679) [-1280.182] (-1285.583) * (-1282.377) (-1284.737) [-1281.777] (-1279.058) -- 0:00:12
810000 -- (-1286.212) (-1281.453) (-1282.212) [-1280.645] * [-1280.257] (-1282.426) (-1282.247) (-1281.929) -- 0:00:12
Average standard deviation of split frequencies: 0.007172
810500 -- (-1278.726) (-1280.488) (-1281.774) [-1281.686] * (-1280.398) (-1281.212) (-1282.871) [-1280.172] -- 0:00:12
811000 -- (-1279.488) (-1281.677) [-1281.186] (-1279.460) * (-1281.611) (-1279.334) (-1278.396) [-1284.537] -- 0:00:12
811500 -- (-1278.829) [-1277.763] (-1280.091) (-1280.561) * (-1282.504) (-1284.531) [-1281.259] (-1283.981) -- 0:00:12
812000 -- [-1279.220] (-1283.446) (-1278.331) (-1282.576) * (-1280.399) (-1284.659) [-1282.686] (-1281.915) -- 0:00:12
812500 -- (-1283.412) (-1279.683) [-1280.721] (-1279.701) * [-1280.135] (-1286.014) (-1280.491) (-1282.155) -- 0:00:12
813000 -- [-1281.365] (-1282.500) (-1282.297) (-1279.579) * [-1280.568] (-1285.111) (-1279.450) (-1279.700) -- 0:00:12
813500 -- (-1281.656) (-1283.213) [-1283.424] (-1279.822) * (-1282.993) [-1281.699] (-1282.110) (-1282.016) -- 0:00:12
814000 -- [-1281.593] (-1284.703) (-1282.103) (-1281.839) * (-1283.589) (-1281.627) (-1285.386) [-1280.549] -- 0:00:12
814500 -- (-1280.655) [-1282.626] (-1280.162) (-1280.953) * (-1282.983) (-1279.296) (-1281.415) [-1281.362] -- 0:00:12
815000 -- (-1281.034) (-1281.934) (-1288.134) [-1280.624] * (-1282.393) (-1282.432) (-1280.440) [-1281.933] -- 0:00:12
Average standard deviation of split frequencies: 0.007433
815500 -- (-1279.833) (-1283.332) (-1282.566) [-1280.740] * [-1281.076] (-1280.510) (-1280.939) (-1281.656) -- 0:00:12
816000 -- (-1279.514) [-1282.075] (-1283.110) (-1281.084) * (-1283.076) (-1280.394) (-1280.726) [-1280.517] -- 0:00:12
816500 -- (-1280.145) (-1286.201) (-1281.289) [-1281.088] * [-1281.949] (-1279.918) (-1281.361) (-1282.411) -- 0:00:12
817000 -- [-1281.767] (-1281.825) (-1281.326) (-1281.296) * [-1281.718] (-1279.302) (-1279.153) (-1283.329) -- 0:00:12
817500 -- [-1279.271] (-1282.053) (-1280.270) (-1281.375) * (-1281.557) (-1282.095) (-1279.977) [-1282.060] -- 0:00:12
818000 -- (-1283.666) (-1282.802) (-1280.857) [-1280.842] * (-1284.543) [-1280.292] (-1279.599) (-1284.051) -- 0:00:12
818500 -- (-1282.721) [-1281.756] (-1280.453) (-1281.370) * [-1284.854] (-1281.678) (-1281.107) (-1282.998) -- 0:00:11
819000 -- (-1280.441) (-1285.211) [-1281.059] (-1279.929) * (-1284.911) (-1288.569) (-1281.956) [-1279.733] -- 0:00:11
819500 -- (-1280.021) (-1281.255) [-1281.388] (-1281.661) * (-1287.540) (-1281.183) [-1279.670] (-1280.154) -- 0:00:11
820000 -- [-1282.630] (-1281.432) (-1285.558) (-1280.661) * (-1280.123) [-1280.970] (-1280.055) (-1283.027) -- 0:00:11
Average standard deviation of split frequencies: 0.007621
820500 -- [-1278.706] (-1282.795) (-1279.828) (-1281.594) * (-1280.272) (-1282.803) [-1280.204] (-1284.018) -- 0:00:11
821000 -- (-1286.756) (-1282.107) (-1282.193) [-1285.135] * [-1279.000] (-1281.602) (-1281.420) (-1285.823) -- 0:00:11
821500 -- [-1281.000] (-1281.254) (-1281.730) (-1281.821) * (-1278.597) (-1282.994) [-1282.593] (-1283.563) -- 0:00:11
822000 -- [-1281.351] (-1283.963) (-1283.251) (-1280.648) * [-1280.524] (-1285.545) (-1282.045) (-1282.113) -- 0:00:11
822500 -- (-1280.440) [-1280.403] (-1280.351) (-1283.028) * [-1281.846] (-1281.835) (-1280.760) (-1282.696) -- 0:00:11
823000 -- (-1282.629) (-1278.575) (-1280.034) [-1281.012] * [-1284.385] (-1283.300) (-1285.396) (-1280.589) -- 0:00:11
823500 -- (-1284.472) [-1279.184] (-1280.335) (-1281.239) * (-1279.841) (-1281.318) [-1279.602] (-1281.436) -- 0:00:11
824000 -- (-1284.571) (-1278.756) (-1280.614) [-1282.627] * (-1281.157) (-1284.854) (-1279.975) [-1281.750] -- 0:00:11
824500 -- (-1282.101) [-1280.419] (-1280.146) (-1282.562) * (-1277.298) [-1279.596] (-1280.069) (-1281.440) -- 0:00:11
825000 -- [-1280.180] (-1280.815) (-1283.823) (-1286.974) * [-1283.092] (-1281.609) (-1280.989) (-1283.603) -- 0:00:11
Average standard deviation of split frequencies: 0.007686
825500 -- (-1282.323) (-1280.803) [-1284.664] (-1284.178) * [-1280.026] (-1282.915) (-1279.612) (-1281.801) -- 0:00:11
826000 -- [-1282.053] (-1279.956) (-1280.953) (-1281.148) * (-1285.526) (-1281.361) [-1280.397] (-1284.984) -- 0:00:11
826500 -- (-1281.509) [-1279.688] (-1281.853) (-1279.957) * (-1279.242) (-1284.959) (-1280.743) [-1282.661] -- 0:00:11
827000 -- (-1283.070) [-1281.590] (-1282.888) (-1281.167) * [-1285.105] (-1280.835) (-1279.899) (-1281.783) -- 0:00:11
827500 -- (-1281.046) (-1282.113) (-1283.066) [-1277.949] * [-1280.815] (-1281.583) (-1279.453) (-1277.682) -- 0:00:11
828000 -- (-1281.145) [-1281.938] (-1281.627) (-1283.362) * (-1280.889) [-1283.395] (-1281.184) (-1280.668) -- 0:00:11
828500 -- (-1279.454) [-1281.068] (-1280.157) (-1284.535) * (-1278.485) (-1281.928) [-1282.179] (-1281.896) -- 0:00:11
829000 -- [-1279.815] (-1281.712) (-1281.286) (-1281.996) * (-1281.285) [-1283.742] (-1280.655) (-1282.497) -- 0:00:11
829500 -- (-1280.857) (-1284.480) (-1280.005) [-1282.671] * [-1282.094] (-1281.145) (-1283.293) (-1279.214) -- 0:00:11
830000 -- [-1281.961] (-1283.202) (-1283.139) (-1284.159) * (-1280.489) (-1280.959) (-1282.339) [-1283.168] -- 0:00:11
Average standard deviation of split frequencies: 0.007453
830500 -- (-1281.818) [-1281.110] (-1278.839) (-1278.273) * (-1281.761) [-1280.394] (-1281.068) (-1279.512) -- 0:00:11
831000 -- (-1281.623) [-1278.778] (-1282.825) (-1279.826) * [-1281.414] (-1280.200) (-1279.934) (-1278.753) -- 0:00:11
831500 -- (-1281.567) [-1280.643] (-1281.015) (-1280.403) * (-1280.525) (-1281.387) (-1285.694) [-1279.443] -- 0:00:11
832000 -- [-1280.765] (-1280.647) (-1279.671) (-1278.744) * (-1281.758) (-1282.461) (-1283.834) [-1280.242] -- 0:00:11
832500 -- (-1280.216) [-1281.442] (-1280.757) (-1279.423) * (-1281.503) (-1281.089) (-1280.076) [-1279.853] -- 0:00:11
833000 -- (-1282.738) [-1281.546] (-1281.907) (-1284.015) * (-1290.104) (-1278.821) (-1281.080) [-1280.957] -- 0:00:11
833500 -- [-1280.616] (-1281.684) (-1281.085) (-1282.575) * (-1282.127) (-1281.518) (-1282.201) [-1281.369] -- 0:00:10
834000 -- (-1283.059) (-1278.865) [-1281.227] (-1280.342) * [-1282.235] (-1280.833) (-1282.268) (-1282.888) -- 0:00:10
834500 -- (-1280.404) (-1281.540) [-1281.101] (-1280.367) * [-1284.068] (-1278.745) (-1281.986) (-1287.921) -- 0:00:10
835000 -- [-1280.902] (-1279.421) (-1282.422) (-1279.798) * (-1280.690) (-1280.175) (-1284.714) [-1281.697] -- 0:00:10
Average standard deviation of split frequencies: 0.007594
835500 -- [-1282.280] (-1280.599) (-1283.584) (-1282.504) * (-1280.887) (-1281.071) [-1284.395] (-1284.894) -- 0:00:10
836000 -- [-1282.049] (-1287.705) (-1283.646) (-1284.297) * [-1278.831] (-1282.225) (-1279.415) (-1277.555) -- 0:00:10
836500 -- (-1280.972) (-1282.161) (-1282.613) [-1280.185] * (-1279.735) (-1281.601) (-1281.442) [-1279.937] -- 0:00:10
837000 -- (-1280.276) (-1281.662) (-1279.664) [-1281.145] * (-1279.247) (-1281.895) (-1279.129) [-1282.414] -- 0:00:10
837500 -- [-1279.853] (-1282.858) (-1280.896) (-1280.529) * (-1281.149) [-1280.509] (-1281.070) (-1280.628) -- 0:00:10
838000 -- (-1282.649) (-1279.623) (-1282.238) [-1279.067] * [-1279.452] (-1281.626) (-1279.611) (-1279.371) -- 0:00:10
838500 -- (-1282.598) (-1280.854) [-1282.872] (-1281.203) * (-1283.393) [-1278.874] (-1280.929) (-1284.500) -- 0:00:10
839000 -- (-1286.738) (-1280.514) (-1283.674) [-1278.950] * (-1281.844) (-1279.671) [-1278.960] (-1280.581) -- 0:00:10
839500 -- (-1284.078) (-1279.910) (-1283.219) [-1279.885] * (-1280.144) (-1282.666) [-1278.872] (-1279.918) -- 0:00:10
840000 -- (-1284.638) (-1281.311) [-1280.546] (-1280.307) * [-1280.220] (-1282.797) (-1281.242) (-1281.267) -- 0:00:10
Average standard deviation of split frequencies: 0.007551
840500 -- (-1282.542) (-1281.435) (-1281.178) [-1282.226] * (-1280.542) (-1280.036) [-1279.727] (-1282.650) -- 0:00:10
841000 -- (-1281.795) (-1279.950) [-1282.843] (-1281.213) * (-1282.118) (-1279.924) (-1280.317) [-1279.665] -- 0:00:10
841500 -- [-1282.671] (-1280.819) (-1278.881) (-1280.394) * [-1278.467] (-1281.747) (-1281.049) (-1281.038) -- 0:00:10
842000 -- (-1282.030) (-1281.793) [-1280.552] (-1278.458) * (-1280.184) (-1280.634) [-1279.528] (-1281.300) -- 0:00:10
842500 -- (-1281.317) (-1282.473) (-1290.331) [-1282.336] * [-1278.516] (-1281.550) (-1281.986) (-1280.145) -- 0:00:10
843000 -- [-1285.945] (-1282.511) (-1287.084) (-1280.495) * [-1279.189] (-1282.965) (-1281.135) (-1282.900) -- 0:00:10
843500 -- (-1280.590) (-1284.187) [-1284.304] (-1281.819) * [-1278.441] (-1284.317) (-1281.158) (-1282.736) -- 0:00:10
844000 -- (-1280.761) (-1281.505) [-1281.651] (-1282.126) * (-1280.211) [-1281.807] (-1280.975) (-1281.328) -- 0:00:10
844500 -- (-1282.095) [-1281.953] (-1285.913) (-1282.752) * (-1282.694) (-1283.335) (-1281.433) [-1285.130] -- 0:00:10
845000 -- [-1282.450] (-1282.449) (-1284.656) (-1288.568) * (-1280.456) (-1280.554) [-1280.169] (-1278.916) -- 0:00:10
Average standard deviation of split frequencies: 0.007058
845500 -- (-1283.512) (-1281.890) (-1280.422) [-1280.562] * [-1278.646] (-1280.413) (-1282.722) (-1281.423) -- 0:00:10
846000 -- (-1279.979) (-1283.730) [-1281.291] (-1281.797) * (-1281.169) (-1279.368) [-1283.789] (-1287.844) -- 0:00:10
846500 -- (-1282.408) (-1282.742) (-1282.211) [-1280.859] * (-1280.820) (-1285.362) (-1282.056) [-1281.650] -- 0:00:10
847000 -- [-1281.202] (-1281.295) (-1284.217) (-1283.175) * (-1279.656) (-1280.047) (-1283.393) [-1279.398] -- 0:00:10
847500 -- [-1283.893] (-1281.179) (-1282.201) (-1282.440) * (-1282.963) (-1281.011) (-1280.237) [-1278.409] -- 0:00:10
848000 -- (-1281.943) [-1280.427] (-1281.871) (-1281.224) * [-1287.126] (-1280.614) (-1281.093) (-1280.395) -- 0:00:10
848500 -- (-1281.969) (-1281.385) (-1280.571) [-1279.931] * [-1281.562] (-1286.050) (-1281.135) (-1280.571) -- 0:00:09
849000 -- (-1280.219) (-1286.150) (-1281.634) [-1279.238] * (-1279.756) (-1281.549) [-1279.009] (-1279.594) -- 0:00:09
849500 -- [-1279.903] (-1284.083) (-1279.595) (-1280.125) * [-1281.182] (-1280.753) (-1285.607) (-1283.879) -- 0:00:09
850000 -- [-1280.911] (-1281.632) (-1281.901) (-1283.371) * [-1283.288] (-1283.861) (-1278.826) (-1282.108) -- 0:00:09
Average standard deviation of split frequencies: 0.007463
850500 -- (-1281.638) (-1279.066) [-1278.646] (-1280.416) * (-1278.685) (-1278.981) (-1282.719) [-1283.904] -- 0:00:09
851000 -- (-1283.206) [-1278.126] (-1279.497) (-1283.184) * (-1283.935) [-1279.437] (-1280.795) (-1284.496) -- 0:00:09
851500 -- [-1282.019] (-1279.336) (-1281.783) (-1279.193) * (-1280.865) [-1280.236] (-1281.159) (-1279.178) -- 0:00:09
852000 -- [-1282.514] (-1279.371) (-1279.636) (-1280.411) * [-1281.459] (-1283.333) (-1284.055) (-1280.933) -- 0:00:09
852500 -- (-1280.289) (-1277.823) (-1281.755) [-1281.199] * [-1280.861] (-1280.943) (-1280.483) (-1281.623) -- 0:00:09
853000 -- (-1281.693) [-1278.461] (-1283.414) (-1281.342) * [-1281.980] (-1284.549) (-1283.454) (-1280.560) -- 0:00:09
853500 -- [-1286.153] (-1279.235) (-1281.364) (-1281.367) * (-1279.074) (-1278.921) [-1279.757] (-1283.332) -- 0:00:09
854000 -- (-1279.135) (-1280.353) [-1279.451] (-1281.283) * (-1280.771) (-1284.686) [-1280.364] (-1281.313) -- 0:00:09
854500 -- [-1282.936] (-1279.292) (-1281.345) (-1282.060) * (-1282.966) (-1282.432) (-1281.224) [-1280.373] -- 0:00:09
855000 -- (-1284.606) (-1279.706) [-1281.914] (-1283.497) * (-1282.750) [-1280.859] (-1280.511) (-1281.989) -- 0:00:09
Average standard deviation of split frequencies: 0.007673
855500 -- (-1280.275) [-1279.282] (-1281.467) (-1283.275) * (-1281.273) (-1280.667) [-1279.549] (-1281.730) -- 0:00:09
856000 -- (-1281.138) (-1281.200) [-1285.054] (-1279.851) * [-1280.890] (-1281.221) (-1279.825) (-1288.145) -- 0:00:09
856500 -- (-1279.990) (-1284.313) (-1279.732) [-1279.828] * (-1283.589) (-1278.117) [-1279.938] (-1285.531) -- 0:00:09
857000 -- (-1280.573) (-1281.199) (-1281.508) [-1280.182] * [-1278.134] (-1280.752) (-1281.245) (-1280.803) -- 0:00:09
857500 -- (-1283.444) [-1280.737] (-1283.226) (-1280.388) * (-1279.973) [-1280.890] (-1279.370) (-1282.567) -- 0:00:09
858000 -- (-1278.374) [-1279.659] (-1282.655) (-1281.345) * (-1281.828) [-1280.910] (-1282.402) (-1280.278) -- 0:00:09
858500 -- (-1280.012) [-1279.479] (-1280.591) (-1281.243) * (-1283.364) (-1281.368) [-1282.369] (-1286.453) -- 0:00:09
859000 -- (-1279.712) (-1279.758) [-1281.077] (-1280.811) * (-1284.010) (-1282.558) (-1281.795) [-1284.395] -- 0:00:09
859500 -- (-1281.590) [-1277.881] (-1280.648) (-1279.486) * (-1282.909) [-1281.112] (-1279.755) (-1282.146) -- 0:00:09
860000 -- [-1283.085] (-1281.375) (-1281.727) (-1280.435) * [-1282.847] (-1282.429) (-1282.655) (-1284.458) -- 0:00:09
Average standard deviation of split frequencies: 0.007778
860500 -- (-1280.059) [-1282.736] (-1280.255) (-1280.006) * (-1281.604) (-1285.038) (-1280.414) [-1281.469] -- 0:00:09
861000 -- [-1281.990] (-1285.291) (-1280.933) (-1282.396) * (-1280.077) (-1287.082) [-1284.782] (-1283.233) -- 0:00:09
861500 -- (-1281.507) [-1283.228] (-1281.189) (-1281.449) * (-1281.659) (-1280.320) (-1281.386) [-1279.078] -- 0:00:09
862000 -- (-1281.903) (-1283.334) [-1281.980] (-1282.975) * (-1280.306) [-1279.677] (-1281.857) (-1281.490) -- 0:00:09
862500 -- (-1282.605) (-1283.946) [-1282.810] (-1282.630) * (-1283.008) (-1279.026) (-1280.949) [-1279.759] -- 0:00:09
863000 -- (-1284.426) [-1280.583] (-1282.666) (-1280.985) * (-1281.635) [-1282.557] (-1280.421) (-1281.794) -- 0:00:09
863500 -- (-1284.787) (-1280.855) [-1281.099] (-1280.329) * (-1283.171) (-1280.471) (-1286.914) [-1284.445] -- 0:00:09
864000 -- (-1287.321) (-1280.634) (-1278.899) [-1280.705] * (-1282.435) [-1280.822] (-1285.615) (-1285.673) -- 0:00:08
864500 -- (-1286.841) (-1283.084) [-1285.653] (-1281.995) * (-1281.877) (-1281.610) (-1283.192) [-1280.469] -- 0:00:08
865000 -- (-1282.906) (-1283.217) [-1278.576] (-1282.264) * (-1280.632) (-1283.521) (-1280.776) [-1281.695] -- 0:00:08
Average standard deviation of split frequencies: 0.007875
865500 -- [-1278.507] (-1283.789) (-1283.414) (-1282.373) * (-1279.802) (-1284.026) [-1278.835] (-1281.663) -- 0:00:08
866000 -- (-1280.213) (-1279.216) [-1278.520] (-1283.980) * [-1278.556] (-1282.395) (-1285.727) (-1282.881) -- 0:00:08
866500 -- (-1278.950) (-1286.469) (-1277.705) [-1279.439] * (-1280.242) (-1281.443) [-1280.074] (-1282.753) -- 0:00:08
867000 -- (-1283.359) (-1287.537) [-1283.035] (-1281.797) * [-1282.720] (-1280.159) (-1280.616) (-1284.104) -- 0:00:08
867500 -- [-1280.828] (-1280.023) (-1281.264) (-1283.846) * (-1281.498) (-1284.969) [-1281.734] (-1282.370) -- 0:00:08
868000 -- (-1279.346) (-1281.552) [-1281.371] (-1286.654) * (-1279.965) [-1281.974] (-1285.601) (-1280.825) -- 0:00:08
868500 -- (-1281.012) [-1282.556] (-1279.400) (-1281.908) * (-1279.835) (-1280.844) (-1282.002) [-1281.707] -- 0:00:08
869000 -- [-1282.502] (-1280.736) (-1281.326) (-1280.926) * (-1280.290) (-1280.340) (-1281.883) [-1280.502] -- 0:00:08
869500 -- (-1280.165) (-1282.050) (-1281.237) [-1283.924] * [-1280.753] (-1279.937) (-1284.210) (-1282.006) -- 0:00:08
870000 -- (-1280.045) [-1281.209] (-1282.808) (-1283.471) * [-1281.310] (-1281.187) (-1283.550) (-1283.748) -- 0:00:08
Average standard deviation of split frequencies: 0.007544
870500 -- [-1279.489] (-1279.638) (-1281.753) (-1281.209) * (-1280.829) (-1281.384) (-1281.013) [-1283.325] -- 0:00:08
871000 -- (-1281.443) (-1284.293) [-1279.485] (-1280.441) * (-1282.184) (-1280.218) [-1279.275] (-1281.459) -- 0:00:08
871500 -- (-1282.221) (-1282.323) [-1280.927] (-1280.199) * (-1281.852) [-1280.409] (-1281.416) (-1283.480) -- 0:00:08
872000 -- [-1282.333] (-1283.484) (-1282.870) (-1280.253) * (-1287.136) [-1282.287] (-1288.333) (-1283.400) -- 0:00:08
872500 -- (-1284.250) (-1283.144) (-1284.651) [-1279.033] * [-1280.320] (-1283.722) (-1288.457) (-1282.078) -- 0:00:08
873000 -- (-1280.934) (-1283.705) (-1281.393) [-1281.926] * [-1282.391] (-1282.748) (-1281.912) (-1283.852) -- 0:00:08
873500 -- (-1280.428) [-1281.599] (-1277.480) (-1279.469) * (-1282.028) [-1280.848] (-1280.053) (-1279.633) -- 0:00:08
874000 -- (-1282.097) (-1287.432) (-1278.542) [-1279.320] * (-1281.747) (-1279.348) [-1284.755] (-1283.211) -- 0:00:08
874500 -- (-1281.526) [-1279.613] (-1280.725) (-1282.232) * [-1281.262] (-1282.379) (-1282.558) (-1282.666) -- 0:00:08
875000 -- (-1279.811) (-1281.176) (-1280.206) [-1280.828] * (-1280.635) (-1281.911) [-1280.314] (-1284.824) -- 0:00:08
Average standard deviation of split frequencies: 0.007606
875500 -- (-1279.711) [-1281.155] (-1281.123) (-1280.676) * (-1283.187) [-1281.573] (-1282.039) (-1278.825) -- 0:00:08
876000 -- (-1285.679) (-1278.802) [-1281.355] (-1280.482) * (-1284.784) (-1280.526) [-1279.330] (-1279.877) -- 0:00:08
876500 -- (-1280.661) [-1279.562] (-1281.813) (-1279.814) * (-1287.757) [-1280.045] (-1279.420) (-1280.343) -- 0:00:08
877000 -- [-1279.195] (-1280.539) (-1284.151) (-1281.590) * (-1286.653) (-1286.391) [-1282.462] (-1281.992) -- 0:00:08
877500 -- (-1281.257) [-1281.101] (-1284.067) (-1278.541) * (-1281.946) [-1281.136] (-1282.344) (-1281.457) -- 0:00:08
878000 -- (-1282.762) (-1280.949) (-1280.792) [-1279.698] * (-1281.300) [-1279.544] (-1277.778) (-1279.374) -- 0:00:08
878500 -- (-1284.982) (-1282.983) [-1284.787] (-1279.941) * (-1279.206) (-1284.926) (-1280.200) [-1284.348] -- 0:00:08
879000 -- [-1284.075] (-1281.808) (-1282.573) (-1280.845) * (-1280.870) (-1280.897) (-1280.767) [-1280.842] -- 0:00:07
879500 -- (-1283.070) (-1285.118) (-1284.564) [-1281.195] * (-1285.913) (-1286.961) (-1279.546) [-1278.902] -- 0:00:07
880000 -- (-1282.985) [-1282.387] (-1281.655) (-1280.568) * [-1280.665] (-1280.854) (-1281.705) (-1281.802) -- 0:00:07
Average standard deviation of split frequencies: 0.007530
880500 -- (-1284.690) (-1284.391) (-1280.470) [-1279.700] * (-1281.523) [-1279.856] (-1281.180) (-1282.107) -- 0:00:07
881000 -- (-1284.691) [-1281.660] (-1284.040) (-1281.354) * (-1281.498) (-1280.850) [-1279.825] (-1280.515) -- 0:00:07
881500 -- (-1283.200) (-1285.052) [-1282.613] (-1281.391) * (-1281.679) (-1280.900) [-1280.603] (-1282.111) -- 0:00:07
882000 -- (-1285.539) (-1282.283) (-1282.463) [-1280.605] * (-1280.986) [-1280.737] (-1280.567) (-1278.356) -- 0:00:07
882500 -- [-1282.198] (-1283.032) (-1281.399) (-1280.909) * (-1280.785) (-1283.871) [-1279.328] (-1281.252) -- 0:00:07
883000 -- (-1282.035) (-1279.660) [-1280.992] (-1281.906) * (-1282.489) [-1281.612] (-1283.167) (-1278.620) -- 0:00:07
883500 -- (-1280.993) (-1281.993) (-1280.440) [-1281.249] * (-1281.797) (-1279.150) [-1279.756] (-1279.166) -- 0:00:07
884000 -- (-1281.455) (-1283.080) (-1280.255) [-1279.800] * (-1282.228) [-1282.931] (-1282.011) (-1283.374) -- 0:00:07
884500 -- (-1281.349) (-1280.981) (-1283.209) [-1282.370] * [-1286.099] (-1283.253) (-1282.549) (-1278.645) -- 0:00:07
885000 -- (-1280.516) [-1280.308] (-1280.428) (-1279.370) * (-1284.438) (-1282.508) [-1279.621] (-1279.994) -- 0:00:07
Average standard deviation of split frequencies: 0.007484
885500 -- (-1282.167) [-1283.776] (-1283.420) (-1280.044) * (-1281.748) [-1283.117] (-1280.696) (-1281.974) -- 0:00:07
886000 -- [-1281.339] (-1281.234) (-1280.321) (-1281.605) * (-1283.926) (-1280.105) [-1284.036] (-1284.807) -- 0:00:07
886500 -- (-1287.152) (-1282.650) [-1280.170] (-1280.979) * (-1281.592) [-1280.205] (-1284.274) (-1284.836) -- 0:00:07
887000 -- (-1282.074) (-1283.231) (-1282.611) [-1281.595] * (-1281.804) (-1279.223) [-1283.949] (-1284.303) -- 0:00:07
887500 -- (-1281.189) [-1283.196] (-1281.588) (-1279.792) * [-1281.185] (-1280.896) (-1280.559) (-1281.780) -- 0:00:07
888000 -- (-1280.847) (-1282.833) (-1280.634) [-1280.076] * [-1282.278] (-1279.451) (-1280.300) (-1281.669) -- 0:00:07
888500 -- (-1284.027) [-1279.661] (-1279.559) (-1280.003) * [-1281.870] (-1282.181) (-1281.836) (-1281.610) -- 0:00:07
889000 -- [-1282.303] (-1281.841) (-1282.201) (-1282.107) * (-1284.276) (-1281.471) (-1281.574) [-1281.365] -- 0:00:07
889500 -- (-1282.786) (-1281.560) (-1284.148) [-1282.521] * (-1284.492) (-1280.354) (-1281.380) [-1281.515] -- 0:00:07
890000 -- [-1284.029] (-1285.005) (-1283.721) (-1283.838) * (-1282.410) [-1280.225] (-1280.573) (-1281.000) -- 0:00:07
Average standard deviation of split frequencies: 0.007622
890500 -- (-1281.116) (-1280.925) [-1282.526] (-1281.343) * (-1281.317) [-1278.515] (-1282.079) (-1283.351) -- 0:00:07
891000 -- (-1281.457) (-1287.192) (-1280.658) [-1280.277] * [-1281.858] (-1281.902) (-1281.662) (-1280.430) -- 0:00:07
891500 -- (-1285.039) (-1281.845) (-1282.075) [-1278.162] * (-1281.335) (-1281.525) (-1283.289) [-1280.150] -- 0:00:07
892000 -- (-1282.277) (-1285.016) (-1281.958) [-1280.638] * (-1282.851) [-1281.385] (-1282.457) (-1280.045) -- 0:00:07
892500 -- [-1280.402] (-1280.738) (-1281.133) (-1286.186) * [-1281.991] (-1283.790) (-1284.864) (-1280.746) -- 0:00:07
893000 -- (-1280.999) (-1281.576) (-1280.658) [-1282.091] * (-1281.182) (-1281.476) [-1279.538] (-1283.073) -- 0:00:07
893500 -- (-1280.080) [-1282.005] (-1281.319) (-1281.946) * (-1278.926) (-1279.792) (-1278.133) [-1282.058] -- 0:00:07
894000 -- (-1280.959) (-1281.436) [-1282.622] (-1281.512) * [-1280.170] (-1280.052) (-1281.428) (-1283.454) -- 0:00:06
894500 -- (-1281.569) [-1281.300] (-1281.797) (-1286.938) * (-1282.316) [-1280.485] (-1280.991) (-1280.158) -- 0:00:06
895000 -- (-1281.479) [-1279.685] (-1281.769) (-1282.593) * (-1281.247) (-1280.202) [-1279.316] (-1284.162) -- 0:00:06
Average standard deviation of split frequencies: 0.007576
895500 -- [-1280.308] (-1283.532) (-1284.006) (-1281.104) * (-1280.843) (-1280.841) [-1279.847] (-1281.559) -- 0:00:06
896000 -- (-1280.095) (-1281.720) (-1279.132) [-1282.052] * (-1283.805) (-1280.656) (-1281.416) [-1282.066] -- 0:00:06
896500 -- (-1282.615) (-1281.331) [-1280.449] (-1287.226) * (-1283.384) (-1282.442) [-1284.644] (-1281.406) -- 0:00:06
897000 -- [-1282.418] (-1281.166) (-1279.764) (-1282.224) * (-1280.815) (-1280.223) [-1282.110] (-1282.084) -- 0:00:06
897500 -- [-1283.234] (-1279.791) (-1280.370) (-1282.395) * (-1280.478) [-1278.542] (-1279.321) (-1283.262) -- 0:00:06
898000 -- [-1284.069] (-1282.100) (-1281.382) (-1283.332) * [-1279.912] (-1278.448) (-1280.527) (-1280.014) -- 0:00:06
898500 -- (-1284.086) (-1281.565) (-1284.835) [-1279.910] * (-1282.906) (-1281.365) (-1279.966) [-1282.204] -- 0:00:06
899000 -- [-1282.015] (-1279.509) (-1283.399) (-1283.339) * (-1282.011) [-1282.303] (-1281.699) (-1283.172) -- 0:00:06
899500 -- (-1281.485) [-1281.104] (-1280.771) (-1282.160) * (-1283.993) [-1282.628] (-1281.581) (-1282.221) -- 0:00:06
900000 -- (-1281.260) (-1279.127) [-1279.350] (-1283.603) * (-1281.491) (-1284.147) (-1280.196) [-1280.860] -- 0:00:06
Average standard deviation of split frequencies: 0.007746
900500 -- [-1280.367] (-1280.715) (-1281.046) (-1281.381) * [-1281.080] (-1280.113) (-1282.981) (-1281.972) -- 0:00:06
901000 -- (-1283.404) (-1281.474) [-1283.350] (-1284.329) * (-1283.145) (-1280.926) [-1280.906] (-1282.268) -- 0:00:06
901500 -- (-1281.069) (-1282.557) [-1282.461] (-1285.224) * (-1283.905) (-1280.508) [-1281.803] (-1282.184) -- 0:00:06
902000 -- (-1287.235) (-1286.360) (-1282.113) [-1281.485] * (-1284.345) (-1280.746) [-1279.063] (-1282.963) -- 0:00:06
902500 -- (-1281.295) (-1280.403) [-1281.321] (-1284.101) * (-1283.205) (-1282.116) [-1280.185] (-1283.190) -- 0:00:06
903000 -- [-1281.015] (-1279.148) (-1280.119) (-1282.686) * (-1284.566) (-1282.368) (-1282.566) [-1283.331] -- 0:00:06
903500 -- [-1280.616] (-1280.853) (-1284.362) (-1282.954) * (-1282.692) (-1282.304) [-1279.702] (-1281.683) -- 0:00:06
904000 -- (-1281.212) (-1281.283) [-1282.619] (-1283.244) * (-1280.454) (-1281.420) [-1280.050] (-1280.558) -- 0:00:06
904500 -- (-1280.969) (-1280.592) [-1281.083] (-1280.475) * (-1280.303) (-1282.872) [-1280.568] (-1280.820) -- 0:00:06
905000 -- (-1279.862) [-1282.127] (-1280.524) (-1281.453) * (-1280.740) [-1280.756] (-1280.964) (-1280.456) -- 0:00:06
Average standard deviation of split frequencies: 0.007701
905500 -- (-1279.969) (-1279.062) (-1282.950) [-1279.499] * (-1280.952) (-1281.409) (-1282.516) [-1281.641] -- 0:00:06
906000 -- (-1279.728) [-1280.362] (-1281.854) (-1281.447) * (-1280.255) (-1281.315) [-1280.995] (-1280.526) -- 0:00:06
906500 -- (-1281.073) [-1280.490] (-1279.873) (-1281.442) * [-1281.317] (-1284.987) (-1284.799) (-1282.041) -- 0:00:06
907000 -- (-1283.435) (-1281.071) [-1280.679] (-1281.140) * (-1280.555) [-1281.358] (-1278.066) (-1280.763) -- 0:00:06
907500 -- [-1279.393] (-1280.201) (-1280.545) (-1283.977) * (-1281.303) (-1283.141) [-1281.033] (-1280.357) -- 0:00:06
908000 -- [-1281.498] (-1281.528) (-1287.229) (-1288.605) * (-1281.877) (-1284.831) (-1278.931) [-1279.569] -- 0:00:06
908500 -- (-1281.879) (-1281.613) (-1281.702) [-1283.838] * [-1280.824] (-1283.103) (-1281.053) (-1283.231) -- 0:00:06
909000 -- [-1280.620] (-1282.038) (-1284.861) (-1282.148) * (-1280.103) (-1284.832) (-1281.059) [-1280.910] -- 0:00:06
909500 -- (-1279.040) (-1282.166) (-1281.444) [-1283.486] * (-1285.128) [-1280.050] (-1279.580) (-1279.814) -- 0:00:05
910000 -- (-1279.222) (-1283.185) [-1280.661] (-1283.274) * [-1283.164] (-1281.030) (-1279.319) (-1282.085) -- 0:00:05
Average standard deviation of split frequencies: 0.007523
910500 -- (-1279.906) [-1282.416] (-1278.223) (-1279.653) * (-1283.422) (-1280.377) (-1281.683) [-1279.755] -- 0:00:05
911000 -- (-1278.607) (-1280.487) (-1284.078) [-1282.267] * (-1280.114) (-1278.826) [-1280.768] (-1280.476) -- 0:00:05
911500 -- [-1280.556] (-1280.656) (-1280.306) (-1282.759) * (-1282.719) (-1280.004) [-1281.883] (-1283.708) -- 0:00:05
912000 -- [-1279.929] (-1280.074) (-1282.898) (-1282.861) * [-1279.992] (-1281.878) (-1281.451) (-1281.866) -- 0:00:05
912500 -- (-1280.600) (-1282.084) [-1279.452] (-1280.393) * [-1282.520] (-1281.479) (-1284.013) (-1285.436) -- 0:00:05
913000 -- (-1281.178) (-1281.333) [-1279.519] (-1277.569) * [-1280.210] (-1281.907) (-1289.355) (-1279.850) -- 0:00:05
913500 -- (-1283.426) [-1280.104] (-1280.121) (-1279.868) * (-1280.706) [-1280.851] (-1290.658) (-1280.326) -- 0:00:05
914000 -- [-1282.321] (-1277.773) (-1280.143) (-1283.613) * (-1285.535) [-1280.045] (-1288.193) (-1281.991) -- 0:00:05
914500 -- (-1281.084) (-1282.176) (-1280.201) [-1281.340] * (-1283.693) [-1282.625] (-1283.434) (-1280.898) -- 0:00:05
915000 -- (-1281.353) (-1281.278) [-1279.786] (-1278.402) * (-1283.726) (-1282.559) [-1284.111] (-1281.955) -- 0:00:05
Average standard deviation of split frequencies: 0.007617
915500 -- [-1281.135] (-1279.785) (-1279.086) (-1279.467) * [-1280.881] (-1279.628) (-1282.824) (-1281.066) -- 0:00:05
916000 -- (-1288.985) (-1283.237) (-1282.021) [-1280.462] * (-1280.140) [-1279.555] (-1281.433) (-1281.015) -- 0:00:05
916500 -- (-1285.024) (-1284.167) (-1283.420) [-1279.580] * (-1283.517) [-1280.781] (-1281.514) (-1282.760) -- 0:00:05
917000 -- (-1285.327) [-1279.758] (-1281.490) (-1282.750) * (-1281.247) (-1280.310) (-1281.282) [-1279.428] -- 0:00:05
917500 -- (-1282.263) [-1282.090] (-1282.712) (-1283.166) * (-1284.189) [-1281.433] (-1280.075) (-1279.497) -- 0:00:05
918000 -- (-1282.820) [-1279.339] (-1286.402) (-1282.454) * [-1282.597] (-1282.404) (-1284.962) (-1281.875) -- 0:00:05
918500 -- (-1279.420) (-1280.614) [-1283.774] (-1281.323) * [-1282.075] (-1283.277) (-1282.275) (-1281.528) -- 0:00:05
919000 -- [-1278.992] (-1281.203) (-1282.942) (-1281.056) * [-1281.958] (-1284.166) (-1279.872) (-1282.517) -- 0:00:05
919500 -- (-1281.599) (-1281.833) [-1282.061] (-1280.174) * (-1281.290) [-1281.147] (-1280.883) (-1287.045) -- 0:00:05
920000 -- [-1282.772] (-1280.215) (-1279.647) (-1282.286) * [-1279.413] (-1282.073) (-1281.667) (-1282.399) -- 0:00:05
Average standard deviation of split frequencies: 0.007339
920500 -- (-1285.391) (-1279.852) (-1282.907) [-1280.891] * [-1281.146] (-1280.555) (-1282.937) (-1285.554) -- 0:00:05
921000 -- (-1281.152) (-1280.682) (-1279.936) [-1279.832] * [-1279.699] (-1281.797) (-1279.271) (-1286.332) -- 0:00:05
921500 -- [-1284.049] (-1279.356) (-1281.997) (-1279.918) * (-1282.046) [-1284.471] (-1283.732) (-1285.275) -- 0:00:05
922000 -- [-1282.992] (-1281.625) (-1282.172) (-1279.161) * (-1279.941) [-1282.180] (-1281.115) (-1287.236) -- 0:00:05
922500 -- (-1282.762) (-1282.097) [-1278.197] (-1285.086) * [-1282.177] (-1282.644) (-1281.732) (-1285.815) -- 0:00:05
923000 -- [-1279.270] (-1284.663) (-1279.469) (-1279.597) * [-1280.728] (-1281.306) (-1281.665) (-1282.052) -- 0:00:05
923500 -- (-1281.729) [-1289.117] (-1279.773) (-1280.747) * [-1280.789] (-1281.433) (-1281.987) (-1279.431) -- 0:00:05
924000 -- (-1283.093) (-1289.442) (-1280.951) [-1279.943] * (-1283.176) (-1281.527) (-1281.164) [-1280.952] -- 0:00:05
924500 -- [-1280.018] (-1285.253) (-1284.466) (-1285.288) * (-1281.482) [-1278.919] (-1281.809) (-1279.867) -- 0:00:04
925000 -- (-1280.708) [-1282.935] (-1284.795) (-1280.567) * (-1283.452) (-1278.835) (-1283.470) [-1280.445] -- 0:00:04
Average standard deviation of split frequencies: 0.007161
925500 -- (-1281.996) (-1280.144) [-1281.869] (-1280.148) * (-1281.555) (-1281.631) (-1282.096) [-1287.071] -- 0:00:04
926000 -- (-1282.587) (-1280.836) [-1277.666] (-1281.352) * (-1281.939) (-1280.732) [-1281.419] (-1280.974) -- 0:00:04
926500 -- (-1280.144) (-1282.381) [-1279.948] (-1280.756) * [-1281.293] (-1279.729) (-1282.097) (-1282.045) -- 0:00:04
927000 -- (-1280.563) (-1279.493) (-1280.827) [-1282.302] * (-1283.502) (-1279.833) [-1282.394] (-1281.481) -- 0:00:04
927500 -- [-1282.206] (-1280.099) (-1278.730) (-1279.765) * (-1287.078) [-1281.417] (-1284.682) (-1282.086) -- 0:00:04
928000 -- (-1280.832) (-1281.651) [-1281.369] (-1280.674) * (-1279.787) (-1281.389) (-1279.638) [-1282.268] -- 0:00:04
928500 -- (-1282.089) (-1281.602) [-1278.189] (-1278.859) * (-1282.090) (-1287.195) (-1283.677) [-1280.552] -- 0:00:04
929000 -- (-1280.291) (-1280.549) [-1280.172] (-1277.847) * [-1281.549] (-1284.420) (-1281.082) (-1280.779) -- 0:00:04
929500 -- (-1281.129) [-1280.241] (-1280.187) (-1283.934) * (-1281.370) [-1286.663] (-1281.842) (-1280.347) -- 0:00:04
930000 -- (-1281.948) (-1281.082) (-1283.574) [-1285.325] * (-1280.481) (-1281.835) [-1281.082] (-1279.024) -- 0:00:04
Average standard deviation of split frequencies: 0.006652
930500 -- (-1283.647) [-1279.564] (-1278.637) (-1286.716) * (-1280.043) [-1283.057] (-1282.830) (-1278.896) -- 0:00:04
931000 -- (-1281.688) (-1280.291) [-1281.226] (-1281.484) * (-1278.381) (-1283.183) (-1283.933) [-1280.777] -- 0:00:04
931500 -- (-1281.545) (-1279.293) (-1281.934) [-1280.238] * (-1280.436) (-1281.737) (-1279.948) [-1281.485] -- 0:00:04
932000 -- (-1292.461) (-1280.006) (-1282.892) [-1279.833] * [-1280.372] (-1284.246) (-1281.120) (-1278.944) -- 0:00:04
932500 -- (-1282.671) [-1278.165] (-1283.476) (-1278.952) * (-1282.610) (-1279.561) [-1281.758] (-1283.432) -- 0:00:04
933000 -- (-1281.576) (-1279.800) (-1280.634) [-1280.177] * (-1281.915) (-1280.813) [-1279.901] (-1283.687) -- 0:00:04
933500 -- (-1280.878) (-1281.525) (-1279.764) [-1278.869] * (-1284.269) (-1282.181) (-1280.787) [-1282.830] -- 0:00:04
934000 -- (-1282.178) (-1281.635) [-1279.509] (-1282.096) * (-1287.405) (-1283.333) [-1279.362] (-1279.312) -- 0:00:04
934500 -- (-1279.120) [-1278.651] (-1282.340) (-1281.625) * (-1280.781) [-1282.803] (-1282.889) (-1279.694) -- 0:00:04
935000 -- (-1280.441) (-1280.052) (-1281.526) [-1281.763] * (-1280.490) (-1280.814) (-1281.510) [-1278.931] -- 0:00:04
Average standard deviation of split frequencies: 0.006413
935500 -- (-1279.742) (-1281.754) (-1281.534) [-1280.224] * [-1281.815] (-1284.845) (-1282.146) (-1281.921) -- 0:00:04
936000 -- [-1280.367] (-1282.061) (-1279.479) (-1283.020) * (-1279.717) (-1283.209) (-1284.158) [-1281.858] -- 0:00:04
936500 -- [-1278.580] (-1283.619) (-1282.508) (-1281.488) * (-1280.712) (-1281.855) [-1281.850] (-1283.779) -- 0:00:04
937000 -- (-1279.533) (-1282.219) (-1284.051) [-1280.539] * (-1282.810) [-1281.633] (-1282.195) (-1283.148) -- 0:00:04
937500 -- (-1282.050) (-1282.975) (-1280.050) [-1281.679] * (-1280.207) [-1279.557] (-1279.322) (-1283.272) -- 0:00:04
938000 -- (-1281.113) (-1283.421) [-1278.722] (-1283.372) * (-1281.089) (-1279.077) [-1281.394] (-1281.027) -- 0:00:04
938500 -- (-1282.976) [-1280.979] (-1281.223) (-1280.960) * [-1281.403] (-1281.848) (-1283.194) (-1279.336) -- 0:00:04
939000 -- (-1282.243) (-1279.101) [-1282.768] (-1283.134) * (-1281.236) (-1285.866) (-1280.749) [-1279.800] -- 0:00:04
939500 -- (-1281.182) (-1281.474) (-1280.343) [-1281.632] * (-1281.283) (-1281.730) (-1282.236) [-1282.287] -- 0:00:03
940000 -- (-1283.872) (-1281.500) (-1281.896) [-1283.855] * (-1280.982) (-1281.870) [-1283.339] (-1282.947) -- 0:00:03
Average standard deviation of split frequencies: 0.006749
940500 -- (-1281.039) (-1281.539) (-1280.593) [-1282.388] * (-1281.975) [-1285.950] (-1283.054) (-1281.062) -- 0:00:03
941000 -- [-1280.616] (-1281.056) (-1286.962) (-1285.130) * (-1280.124) (-1284.635) [-1279.991] (-1282.920) -- 0:00:03
941500 -- [-1280.848] (-1282.706) (-1279.135) (-1282.565) * [-1278.756] (-1282.033) (-1281.409) (-1281.648) -- 0:00:03
942000 -- [-1280.356] (-1278.957) (-1281.004) (-1284.405) * (-1280.960) (-1288.197) (-1285.162) [-1280.824] -- 0:00:03
942500 -- (-1279.315) [-1280.382] (-1284.131) (-1278.958) * (-1283.646) (-1284.726) (-1283.506) [-1281.073] -- 0:00:03
943000 -- (-1281.857) (-1282.955) [-1283.965] (-1285.227) * (-1281.197) [-1281.936] (-1281.793) (-1280.802) -- 0:00:03
943500 -- (-1286.449) (-1283.546) [-1278.768] (-1283.389) * (-1281.558) (-1280.766) (-1285.099) [-1284.073] -- 0:00:03
944000 -- (-1281.282) [-1287.682] (-1284.808) (-1283.230) * (-1280.849) (-1278.404) [-1281.451] (-1288.004) -- 0:00:03
944500 -- (-1279.205) (-1286.361) (-1279.180) [-1280.927] * [-1281.785] (-1282.645) (-1282.522) (-1290.888) -- 0:00:03
945000 -- (-1287.883) (-1282.465) (-1281.490) [-1281.224] * [-1282.298] (-1283.410) (-1282.810) (-1282.104) -- 0:00:03
Average standard deviation of split frequencies: 0.007043
945500 -- (-1284.157) (-1278.839) [-1283.453] (-1282.893) * (-1279.752) (-1279.475) [-1280.817] (-1280.966) -- 0:00:03
946000 -- (-1288.958) (-1281.624) [-1278.343] (-1283.445) * (-1281.845) (-1282.079) [-1280.543] (-1281.111) -- 0:00:03
946500 -- (-1280.744) [-1280.247] (-1286.870) (-1284.659) * (-1281.714) [-1283.698] (-1281.389) (-1285.361) -- 0:00:03
947000 -- [-1281.017] (-1282.387) (-1283.973) (-1282.226) * (-1279.768) [-1280.785] (-1282.695) (-1282.918) -- 0:00:03
947500 -- (-1283.309) (-1284.945) [-1279.389] (-1286.143) * (-1282.366) (-1281.998) [-1282.282] (-1280.291) -- 0:00:03
948000 -- (-1280.824) (-1283.178) [-1286.165] (-1284.717) * (-1283.480) (-1278.351) [-1281.989] (-1280.857) -- 0:00:03
948500 -- (-1280.136) [-1281.948] (-1282.680) (-1281.306) * (-1281.711) [-1280.731] (-1280.445) (-1280.616) -- 0:00:03
949000 -- (-1281.309) (-1281.537) (-1283.037) [-1280.257] * (-1278.484) (-1280.727) [-1279.599] (-1283.775) -- 0:00:03
949500 -- (-1280.244) (-1280.448) [-1283.258] (-1284.042) * (-1281.466) (-1280.119) (-1281.259) [-1280.066] -- 0:00:03
950000 -- (-1281.083) (-1279.269) [-1280.087] (-1282.299) * (-1281.225) [-1280.578] (-1280.496) (-1280.954) -- 0:00:03
Average standard deviation of split frequencies: 0.006975
950500 -- (-1283.923) (-1279.358) (-1280.611) [-1281.153] * [-1278.745] (-1280.997) (-1281.605) (-1282.942) -- 0:00:03
951000 -- (-1283.026) (-1278.675) (-1280.129) [-1279.931] * (-1278.851) [-1278.313] (-1278.903) (-1281.456) -- 0:00:03
951500 -- (-1281.750) (-1284.024) (-1281.750) [-1279.551] * (-1280.814) [-1278.893] (-1280.486) (-1283.146) -- 0:00:03
952000 -- (-1281.403) (-1282.379) [-1281.177] (-1284.037) * (-1279.202) (-1288.378) (-1281.666) [-1281.814] -- 0:00:03
952500 -- (-1280.743) (-1281.500) (-1282.393) [-1281.940] * (-1283.700) [-1287.143] (-1285.567) (-1282.203) -- 0:00:03
953000 -- (-1279.930) [-1278.257] (-1279.754) (-1282.400) * (-1280.980) [-1285.320] (-1279.354) (-1280.105) -- 0:00:03
953500 -- [-1279.121] (-1278.801) (-1281.159) (-1281.504) * (-1284.518) (-1281.990) [-1279.406] (-1282.589) -- 0:00:03
954000 -- (-1282.153) (-1279.830) [-1281.761] (-1282.932) * (-1282.379) (-1281.228) (-1280.279) [-1280.631] -- 0:00:03
954500 -- (-1281.805) [-1279.186] (-1281.145) (-1286.637) * (-1285.512) (-1282.081) [-1280.675] (-1280.247) -- 0:00:03
955000 -- (-1283.395) (-1280.542) [-1284.169] (-1280.652) * (-1281.094) (-1279.189) [-1277.596] (-1279.163) -- 0:00:02
Average standard deviation of split frequencies: 0.006838
955500 -- (-1281.546) (-1283.463) (-1281.916) [-1280.543] * [-1286.158] (-1285.696) (-1280.358) (-1281.270) -- 0:00:02
956000 -- (-1280.199) (-1280.301) [-1281.133] (-1284.252) * (-1283.602) (-1280.457) [-1279.954] (-1282.933) -- 0:00:02
956500 -- (-1280.357) (-1282.709) [-1280.980] (-1284.121) * (-1284.616) [-1283.052] (-1281.559) (-1280.876) -- 0:00:02
957000 -- (-1283.948) (-1280.901) (-1280.938) [-1280.927] * (-1283.336) (-1280.140) (-1288.551) [-1280.724] -- 0:00:02
957500 -- (-1279.707) [-1279.816] (-1284.250) (-1278.886) * (-1280.326) (-1278.985) [-1285.008] (-1280.275) -- 0:00:02
958000 -- [-1281.171] (-1285.153) (-1281.984) (-1280.247) * (-1281.794) [-1281.284] (-1282.133) (-1283.103) -- 0:00:02
958500 -- (-1284.559) [-1282.200] (-1282.380) (-1280.811) * (-1281.297) [-1279.827] (-1283.048) (-1281.480) -- 0:00:02
959000 -- (-1278.403) [-1280.629] (-1282.254) (-1285.577) * (-1282.299) [-1280.087] (-1280.617) (-1280.582) -- 0:00:02
959500 -- [-1280.007] (-1285.422) (-1279.518) (-1284.215) * (-1285.515) [-1279.352] (-1280.696) (-1280.522) -- 0:00:02
960000 -- (-1279.816) [-1281.309] (-1282.299) (-1282.698) * (-1279.783) [-1282.516] (-1281.197) (-1278.130) -- 0:00:02
Average standard deviation of split frequencies: 0.006674
960500 -- (-1280.319) (-1282.230) (-1279.232) [-1283.985] * (-1280.198) (-1282.986) (-1280.548) [-1281.867] -- 0:00:02
961000 -- (-1281.854) [-1284.193] (-1279.029) (-1282.465) * (-1281.874) (-1281.430) (-1280.673) [-1280.079] -- 0:00:02
961500 -- (-1280.064) (-1284.562) (-1281.286) [-1282.241] * (-1280.412) (-1281.269) [-1281.992] (-1277.988) -- 0:00:02
962000 -- [-1281.359] (-1282.737) (-1282.466) (-1279.364) * (-1280.933) (-1281.285) (-1286.903) [-1279.162] -- 0:00:02
962500 -- (-1280.273) [-1283.368] (-1281.055) (-1281.607) * (-1281.882) [-1280.629] (-1283.114) (-1280.628) -- 0:00:02
963000 -- (-1281.070) (-1281.820) [-1279.194] (-1281.651) * (-1282.684) [-1279.315] (-1283.217) (-1282.987) -- 0:00:02
963500 -- [-1280.389] (-1283.433) (-1279.586) (-1281.877) * (-1280.350) (-1280.007) (-1280.051) [-1284.233] -- 0:00:02
964000 -- [-1279.972] (-1281.269) (-1281.716) (-1282.654) * (-1281.488) [-1280.113] (-1279.642) (-1284.459) -- 0:00:02
964500 -- (-1287.795) [-1280.711] (-1284.058) (-1279.696) * [-1280.240] (-1281.906) (-1279.862) (-1284.482) -- 0:00:02
965000 -- (-1280.613) (-1280.213) (-1279.843) [-1283.389] * (-1284.897) (-1279.243) [-1282.482] (-1285.784) -- 0:00:02
Average standard deviation of split frequencies: 0.006767
965500 -- [-1279.110] (-1280.348) (-1282.362) (-1283.420) * (-1280.392) (-1281.499) [-1279.114] (-1283.665) -- 0:00:02
966000 -- (-1282.239) (-1279.673) (-1281.444) [-1282.961] * (-1281.290) [-1281.709] (-1280.860) (-1278.310) -- 0:00:02
966500 -- (-1289.144) (-1280.266) [-1285.066] (-1281.226) * (-1282.098) [-1279.993] (-1281.039) (-1279.939) -- 0:00:02
967000 -- (-1280.814) (-1284.793) (-1282.392) [-1279.721] * [-1281.333] (-1278.932) (-1282.109) (-1280.868) -- 0:00:02
967500 -- (-1280.380) [-1281.469] (-1280.894) (-1281.098) * [-1281.212] (-1282.866) (-1278.807) (-1281.331) -- 0:00:02
968000 -- (-1281.350) [-1282.583] (-1285.377) (-1281.765) * [-1281.504] (-1280.464) (-1280.600) (-1281.512) -- 0:00:02
968500 -- [-1282.647] (-1282.057) (-1281.125) (-1283.372) * [-1282.825] (-1278.738) (-1278.712) (-1281.326) -- 0:00:02
969000 -- (-1285.334) [-1280.953] (-1280.431) (-1281.100) * (-1278.184) (-1280.913) [-1280.945] (-1281.881) -- 0:00:02
969500 -- (-1283.162) [-1280.892] (-1282.040) (-1279.585) * [-1280.543] (-1279.347) (-1281.353) (-1281.783) -- 0:00:02
970000 -- (-1282.782) (-1280.490) [-1281.785] (-1279.756) * (-1279.162) [-1281.738] (-1280.285) (-1282.777) -- 0:00:01
Average standard deviation of split frequencies: 0.006605
970500 -- [-1281.246] (-1286.202) (-1280.430) (-1279.594) * (-1281.369) (-1281.123) [-1280.548] (-1282.514) -- 0:00:01
971000 -- (-1283.454) [-1281.220] (-1279.940) (-1280.774) * (-1286.970) [-1280.695] (-1281.428) (-1280.489) -- 0:00:01
971500 -- (-1280.302) [-1283.059] (-1282.119) (-1280.090) * (-1282.900) (-1281.640) [-1281.750] (-1280.974) -- 0:00:01
972000 -- (-1280.712) (-1281.811) [-1284.059] (-1279.845) * (-1282.716) (-1279.697) [-1282.312] (-1280.226) -- 0:00:01
972500 -- [-1281.566] (-1284.226) (-1282.683) (-1279.833) * (-1281.450) (-1281.545) (-1283.055) [-1283.521] -- 0:00:01
973000 -- [-1279.913] (-1280.640) (-1282.131) (-1282.006) * (-1279.463) [-1281.523] (-1282.167) (-1283.460) -- 0:00:01
973500 -- (-1281.614) (-1280.511) (-1281.146) [-1279.577] * (-1281.923) (-1283.299) (-1280.567) [-1282.226] -- 0:00:01
974000 -- (-1283.376) (-1280.511) [-1281.614] (-1283.327) * (-1281.621) (-1281.769) [-1280.868] (-1281.279) -- 0:00:01
974500 -- (-1284.057) (-1279.841) (-1280.708) [-1281.106] * (-1281.875) [-1281.667] (-1280.570) (-1282.734) -- 0:00:01
975000 -- [-1284.051] (-1287.010) (-1278.740) (-1279.052) * [-1280.090] (-1281.639) (-1285.430) (-1281.462) -- 0:00:01
Average standard deviation of split frequencies: 0.006730
975500 -- (-1281.279) (-1279.906) [-1280.644] (-1279.394) * (-1280.416) (-1282.117) [-1281.442] (-1281.106) -- 0:00:01
976000 -- (-1280.443) (-1281.122) [-1278.660] (-1280.079) * (-1279.616) [-1283.039] (-1286.605) (-1281.556) -- 0:00:01
976500 -- (-1282.102) [-1281.682] (-1279.063) (-1281.274) * (-1282.691) [-1281.019] (-1286.160) (-1283.028) -- 0:00:01
977000 -- (-1277.214) (-1284.397) [-1278.797] (-1280.775) * (-1280.622) [-1281.307] (-1281.441) (-1281.693) -- 0:00:01
977500 -- (-1281.726) (-1283.879) [-1280.741] (-1281.051) * (-1282.618) (-1284.583) [-1279.909] (-1283.287) -- 0:00:01
978000 -- (-1283.075) [-1280.475] (-1281.898) (-1281.786) * [-1282.031] (-1286.361) (-1281.968) (-1280.448) -- 0:00:01
978500 -- (-1283.299) [-1281.413] (-1281.322) (-1282.368) * (-1280.518) [-1278.879] (-1281.798) (-1279.121) -- 0:00:01
979000 -- [-1281.167] (-1283.085) (-1279.643) (-1283.192) * (-1281.728) (-1284.641) (-1284.473) [-1279.603] -- 0:00:01
979500 -- (-1282.036) (-1283.175) [-1282.983] (-1279.664) * (-1280.634) [-1281.684] (-1281.471) (-1280.497) -- 0:00:01
980000 -- (-1284.575) [-1283.513] (-1279.960) (-1281.695) * (-1280.321) (-1280.351) (-1280.235) [-1280.996] -- 0:00:01
Average standard deviation of split frequencies: 0.006794
980500 -- (-1281.706) [-1280.577] (-1282.101) (-1278.957) * (-1284.318) [-1281.088] (-1281.033) (-1278.918) -- 0:00:01
981000 -- [-1279.856] (-1283.237) (-1280.242) (-1283.978) * [-1279.601] (-1281.143) (-1288.228) (-1281.548) -- 0:00:01
981500 -- (-1281.550) (-1280.396) [-1276.234] (-1281.128) * (-1281.301) [-1283.442] (-1282.152) (-1280.231) -- 0:00:01
982000 -- [-1281.194] (-1279.529) (-1279.929) (-1282.078) * (-1280.091) [-1281.185] (-1282.468) (-1279.255) -- 0:00:01
982500 -- (-1281.794) (-1282.699) (-1284.612) [-1280.705] * (-1281.236) (-1282.208) [-1281.062] (-1281.853) -- 0:00:01
983000 -- (-1282.813) (-1280.945) [-1283.347] (-1284.575) * (-1282.060) (-1283.289) (-1283.068) [-1278.539] -- 0:00:01
983500 -- (-1279.351) [-1281.868] (-1280.557) (-1280.863) * (-1281.372) (-1279.227) [-1282.141] (-1281.672) -- 0:00:01
984000 -- [-1279.278] (-1285.061) (-1281.145) (-1281.890) * (-1282.546) (-1280.943) [-1286.541] (-1281.064) -- 0:00:01
984500 -- (-1280.242) (-1281.010) (-1283.476) [-1284.331] * (-1281.935) (-1282.228) [-1282.541] (-1278.219) -- 0:00:01
985000 -- [-1279.630] (-1284.257) (-1281.020) (-1283.456) * (-1281.529) [-1279.384] (-1287.206) (-1283.672) -- 0:00:00
Average standard deviation of split frequencies: 0.006725
985500 -- [-1281.761] (-1281.510) (-1282.178) (-1283.026) * (-1282.233) (-1279.292) (-1290.642) [-1281.526] -- 0:00:00
986000 -- (-1280.254) [-1280.703] (-1280.784) (-1279.953) * [-1284.011] (-1280.760) (-1285.005) (-1282.642) -- 0:00:00
986500 -- (-1280.503) (-1283.179) (-1279.266) [-1281.590] * (-1285.112) [-1277.891] (-1280.550) (-1283.161) -- 0:00:00
987000 -- (-1281.307) (-1283.357) [-1280.699] (-1282.236) * (-1280.483) [-1279.182] (-1286.595) (-1284.089) -- 0:00:00
987500 -- [-1281.538] (-1281.232) (-1280.151) (-1282.339) * (-1281.628) (-1283.641) [-1279.919] (-1280.505) -- 0:00:00
988000 -- (-1286.217) (-1281.744) (-1280.940) [-1281.301] * [-1280.798] (-1284.919) (-1279.164) (-1281.518) -- 0:00:00
988500 -- (-1283.848) [-1282.326] (-1280.563) (-1281.960) * (-1280.436) (-1280.076) (-1279.646) [-1283.713] -- 0:00:00
989000 -- (-1284.401) (-1281.445) (-1279.201) [-1281.392] * (-1280.902) [-1281.553] (-1280.285) (-1282.171) -- 0:00:00
989500 -- [-1284.416] (-1281.835) (-1280.889) (-1280.446) * (-1280.761) (-1280.971) [-1278.995] (-1282.661) -- 0:00:00
990000 -- (-1283.000) (-1281.821) [-1283.834] (-1280.730) * (-1281.177) [-1281.930] (-1281.273) (-1281.576) -- 0:00:00
Average standard deviation of split frequencies: 0.006820
990500 -- (-1282.183) (-1282.675) (-1279.676) [-1280.231] * (-1281.332) (-1283.480) (-1279.126) [-1282.688] -- 0:00:00
991000 -- (-1281.002) (-1280.955) (-1280.909) [-1281.519] * (-1281.935) (-1281.835) (-1281.950) [-1282.156] -- 0:00:00
991500 -- (-1283.762) [-1279.067] (-1279.583) (-1281.365) * (-1283.675) (-1279.496) (-1281.124) [-1280.658] -- 0:00:00
992000 -- (-1281.300) (-1279.607) [-1280.022] (-1285.440) * (-1281.543) [-1280.848] (-1279.845) (-1281.156) -- 0:00:00
992500 -- (-1281.654) (-1281.224) (-1279.677) [-1282.981] * [-1281.297] (-1279.027) (-1280.729) (-1283.975) -- 0:00:00
993000 -- (-1283.597) (-1280.822) (-1281.853) [-1281.418] * (-1281.342) (-1282.463) [-1280.015] (-1279.246) -- 0:00:00
993500 -- (-1283.099) [-1280.803] (-1279.975) (-1280.969) * (-1282.527) (-1284.471) (-1279.069) [-1279.815] -- 0:00:00
994000 -- (-1281.029) (-1280.987) [-1279.667] (-1281.693) * [-1281.366] (-1281.601) (-1280.487) (-1284.119) -- 0:00:00
994500 -- (-1280.563) [-1282.457] (-1281.270) (-1282.074) * (-1282.558) [-1279.786] (-1282.337) (-1281.132) -- 0:00:00
995000 -- [-1282.294] (-1280.826) (-1290.947) (-1280.326) * (-1279.956) [-1282.156] (-1280.964) (-1281.310) -- 0:00:00
Average standard deviation of split frequencies: 0.007289
995500 -- (-1281.969) (-1279.999) (-1285.940) [-1286.222] * (-1279.482) (-1281.934) (-1284.218) [-1279.678] -- 0:00:00
996000 -- [-1281.890] (-1287.280) (-1279.643) (-1281.652) * (-1288.402) (-1280.968) (-1281.970) [-1282.214] -- 0:00:00
996500 -- (-1283.406) (-1280.068) [-1282.413] (-1281.295) * (-1290.221) [-1279.137] (-1282.465) (-1280.658) -- 0:00:00
997000 -- (-1281.458) (-1282.995) [-1280.136] (-1282.507) * (-1291.355) (-1279.053) (-1281.819) [-1279.765] -- 0:00:00
997500 -- [-1279.453] (-1284.037) (-1279.600) (-1281.901) * (-1284.409) [-1281.995] (-1281.371) (-1279.753) -- 0:00:00
998000 -- (-1281.430) (-1284.495) [-1281.040] (-1280.539) * (-1281.396) [-1283.536] (-1283.394) (-1281.470) -- 0:00:00
998500 -- (-1281.433) (-1283.204) [-1281.808] (-1280.132) * [-1279.674] (-1283.313) (-1280.444) (-1280.538) -- 0:00:00
999000 -- (-1279.282) (-1283.398) (-1283.074) [-1279.752] * (-1280.328) [-1279.338] (-1279.583) (-1280.596) -- 0:00:00
999500 -- (-1279.332) [-1279.086] (-1280.990) (-1280.800) * (-1283.519) (-1279.972) (-1280.262) [-1280.889] -- 0:00:00
1000000 -- (-1278.873) (-1280.580) (-1282.277) [-1280.430] * (-1281.248) (-1287.330) [-1281.462] (-1278.327) -- 0:00:00
Average standard deviation of split frequencies: 0.006941
Analysis completed in 1 mins 6 seconds
Analysis used 65.70 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1276.06
Likelihood of best state for "cold" chain of run 2 was -1276.39
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 66 %) Dirichlet(Revmat{all})
98.6 % ( 98 %) Slider(Revmat{all})
26.4 % ( 24 %) Dirichlet(Pi{all})
27.8 % ( 29 %) Slider(Pi{all})
70.1 % ( 46 %) Multiplier(Alpha{1,2})
79.1 % ( 55 %) Multiplier(Alpha{3})
25.0 % ( 24 %) Slider(Pinvar{all})
97.4 % ( 98 %) ExtSPR(Tau{all},V{all})
68.9 % ( 71 %) ExtTBR(Tau{all},V{all})
98.3 % ( 99 %) NNI(Tau{all},V{all})
88.3 % ( 88 %) ParsSPR(Tau{all},V{all})
28.1 % ( 29 %) Multiplier(V{all})
95.2 % ( 96 %) Nodeslider(V{all})
30.3 % ( 33 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 70 %) Dirichlet(Revmat{all})
98.7 % ( 98 %) Slider(Revmat{all})
26.3 % ( 29 %) Dirichlet(Pi{all})
27.7 % ( 32 %) Slider(Pi{all})
69.2 % ( 39 %) Multiplier(Alpha{1,2})
79.2 % ( 54 %) Multiplier(Alpha{3})
23.7 % ( 29 %) Slider(Pinvar{all})
97.4 % ( 97 %) ExtSPR(Tau{all},V{all})
69.2 % ( 74 %) ExtTBR(Tau{all},V{all})
98.3 % ( 99 %) NNI(Tau{all},V{all})
87.9 % ( 88 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
95.3 % ( 94 %) Nodeslider(V{all})
30.5 % ( 30 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 166886 0.81 0.66
3 | 166177 166348 0.83
4 | 167430 165925 167234
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.63 0.49
2 | 167004 0.82 0.66
3 | 166525 166264 0.83
4 | 166861 166278 167068
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1279.95
| 1 |
| 2 |
| 2 1 |
| 1 |
| 2 1 2 1 1 |
|2 1 1 2 2 1 2 1 22 12 2 |
|1*21 2 2 2 22 1 2 22 22 2 1 1 12|
| 1 111 1 1 2 12 1 1 1 2 12 12 21 * 2 1 * 2 |
| * 121 2 2 * 1 1 2 1 2 1 2* 12 2 |
| 2 1 *1 1 1 * 1 2 1 1 2 1 1|
| 2 2 2 1 |
| 2 *1 1 2 2 |
| |
| 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1282.30
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1280.10 -1283.68
2 -1280.14 -1284.05
--------------------------------------
TOTAL -1280.12 -1283.88
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.882749 0.089222 0.343689 1.471499 0.845139 1286.68 1393.84 1.001
r(A<->C){all} 0.150650 0.015962 0.000022 0.404352 0.118976 151.31 226.27 1.001
r(A<->G){all} 0.167648 0.018918 0.000129 0.437405 0.137407 234.49 274.82 1.000
r(A<->T){all} 0.169900 0.019530 0.000030 0.450623 0.135921 130.93 226.74 1.001
r(C<->G){all} 0.205723 0.024122 0.000080 0.510045 0.176688 245.11 273.29 1.001
r(C<->T){all} 0.142803 0.016435 0.000194 0.405742 0.108022 276.99 304.20 1.001
r(G<->T){all} 0.163276 0.017725 0.000001 0.432396 0.129234 94.99 159.12 1.005
pi(A){all} 0.229624 0.000182 0.202943 0.256032 0.229656 1243.50 1358.33 1.000
pi(C){all} 0.309855 0.000231 0.278608 0.337476 0.310013 1349.04 1425.02 1.000
pi(G){all} 0.271533 0.000219 0.241570 0.299326 0.271405 1259.28 1339.94 1.000
pi(T){all} 0.188988 0.000168 0.164053 0.214614 0.188988 1329.65 1399.49 1.000
alpha{1,2} 0.334402 0.159946 0.000322 1.096130 0.202481 977.70 1016.00 1.000
alpha{3} 0.407502 0.228123 0.000288 1.314421 0.239961 1202.59 1254.49 1.000
pinvar{all} 0.996406 0.000009 0.990722 0.999911 0.997233 1117.40 1225.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..****
8 -- ....**
9 -- .**.**
10 -- ...**.
11 -- ..*..*
12 -- .***.*
13 -- .*...*
14 -- .*.*..
15 -- .*..*.
16 -- ...*.*
17 -- ..**..
18 -- ..*.*.
19 -- .*.***
20 -- .****.
21 -- .**...
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 476 0.158561 0.002827 0.156562 0.160560 2
8 463 0.154231 0.000471 0.153897 0.154564 2
9 450 0.149900 0.001884 0.148568 0.151233 2
10 435 0.144903 0.002355 0.143238 0.146569 2
11 434 0.144570 0.017901 0.131912 0.157229 2
12 433 0.144237 0.007066 0.139241 0.149234 2
13 433 0.144237 0.010835 0.136576 0.151899 2
14 428 0.142572 0.006595 0.137908 0.147235 2
15 426 0.141905 0.008480 0.135909 0.147901 2
16 426 0.141905 0.000942 0.141239 0.142572 2
17 426 0.141905 0.007537 0.136576 0.147235 2
18 425 0.141572 0.013662 0.131912 0.151233 2
19 412 0.137242 0.004711 0.133911 0.140573 2
20 405 0.134910 0.018373 0.121919 0.147901 2
21 393 0.130913 0.000471 0.130580 0.131246 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/cmaA2/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.090482 0.008908 0.000004 0.281042 0.061160 1.000 2
length{all}[2] 0.092542 0.008592 0.000025 0.277868 0.064283 1.000 2
length{all}[3] 0.092341 0.008940 0.000019 0.277269 0.063608 1.001 2
length{all}[4] 0.095050 0.009366 0.000044 0.283266 0.066760 1.000 2
length{all}[5] 0.092739 0.008948 0.000082 0.280405 0.063771 1.000 2
length{all}[6] 0.133943 0.014414 0.000041 0.368197 0.099613 1.001 2
length{all}[7] 0.108808 0.011316 0.000019 0.314831 0.080777 0.998 2
length{all}[8] 0.091072 0.009168 0.000252 0.285348 0.065093 1.001 2
length{all}[9] 0.092355 0.009275 0.000036 0.260428 0.064564 0.998 2
length{all}[10] 0.095641 0.009017 0.000040 0.284073 0.066013 1.007 2
length{all}[11] 0.094793 0.009613 0.000038 0.274357 0.066560 1.008 2
length{all}[12] 0.098146 0.008615 0.000078 0.289262 0.072174 1.002 2
length{all}[13] 0.098351 0.010354 0.000226 0.322272 0.059947 1.001 2
length{all}[14] 0.090211 0.009311 0.000050 0.280430 0.060972 0.998 2
length{all}[15] 0.092853 0.008077 0.000058 0.283304 0.068006 1.001 2
length{all}[16] 0.095397 0.008840 0.000478 0.285836 0.069344 1.000 2
length{all}[17] 0.101549 0.010020 0.000258 0.296851 0.071227 0.998 2
length{all}[18] 0.091426 0.008365 0.000030 0.277944 0.061600 0.998 2
length{all}[19] 0.100895 0.010878 0.000369 0.334248 0.065258 1.000 2
length{all}[20] 0.097160 0.008635 0.000122 0.276257 0.066879 0.999 2
length{all}[21] 0.092516 0.010203 0.000016 0.306748 0.055496 1.010 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006941
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------- C1 (1)
|
|---------------------------------------------- C2 (2)
|
|---------------------------------------------- C3 (3)
+
|------------------------------------------------ C4 (4)
|
|---------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|-------------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 44 trees
90 % credible set contains 90 trees
95 % credible set contains 97 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 924
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 58 patterns at 308 / 308 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 58 patterns at 308 / 308 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
56608 bytes for conP
5104 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.036681 0.061197 0.016833 0.073205 0.043489 0.066968 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -1304.339259
Iterating by ming2
Initial: fx= 1304.339259
x= 0.03668 0.06120 0.01683 0.07321 0.04349 0.06697 0.30000 1.30000
1 h-m-p 0.0000 0.0001 733.5580 ++ 1274.509194 m 0.0001 13 | 1/8
2 h-m-p 0.0000 0.0000 4069688.6224 ++ 1245.042823 m 0.0000 24 | 2/8
3 h-m-p 0.0000 0.0000 316.2765 ++ 1238.275557 m 0.0000 35 | 3/8
4 h-m-p 0.0000 0.0000 12299.7699 ++ 1225.807713 m 0.0000 46 | 4/8
5 h-m-p 0.0000 0.0000 379.9858 ++ 1221.737796 m 0.0000 57 | 5/8
6 h-m-p 0.0011 0.1419 2.0518 +++CYYCYYCCC 1217.940954 8 0.1208 84 | 5/8
7 h-m-p 0.1928 0.9638 0.3838 ++ 1217.789030 m 0.9638 95 | 6/8
8 h-m-p 0.1376 3.4385 0.5658 YC 1217.783111 1 0.3219 110 | 6/8
9 h-m-p 0.3459 8.0000 0.5265 ++YCCC 1217.742629 3 3.8380 130 | 6/8
10 h-m-p 1.6000 8.0000 0.4281 CCC 1217.729352 2 2.0005 147 | 6/8
11 h-m-p 1.5579 8.0000 0.5497 ++ 1217.714497 m 8.0000 160 | 6/8
12 h-m-p 1.6000 8.0000 1.4251 CC 1217.709237 1 1.9186 175 | 6/8
13 h-m-p 1.6000 8.0000 1.5492 +C 1217.703834 0 6.2622 187 | 6/8
14 h-m-p 1.6000 8.0000 2.8839 CC 1217.701374 1 2.0300 200 | 6/8
15 h-m-p 1.6000 8.0000 3.6469 +Y 1217.698916 0 6.9364 212 | 6/8
16 h-m-p 1.6000 8.0000 6.8713 CC 1217.697924 1 1.8680 225 | 6/8
17 h-m-p 1.5395 8.0000 8.3376 ++ 1217.696846 m 8.0000 236 | 6/8
18 h-m-p 1.6000 8.0000 16.5368 C 1217.696457 0 1.7517 247 | 6/8
19 h-m-p 1.4699 8.0000 19.7070 ++ 1217.695996 m 8.0000 258 | 6/8
20 h-m-p 1.6000 8.0000 47.7080 C 1217.695854 0 2.1089 269 | 6/8
21 h-m-p 1.6000 8.0000 51.2821 +Y 1217.695716 0 5.0351 281 | 6/8
22 h-m-p 0.6443 3.2215 99.7558 +C 1217.695637 0 2.4900 293 | 6/8
23 h-m-p 0.1103 0.5516 132.2990 ++ 1217.695621 m 0.5516 304 | 7/8
24 h-m-p 0.3690 8.0000 0.0000 +Y 1217.695616 0 1.0300 316 | 7/8
25 h-m-p 1.6000 8.0000 0.0000 -------C 1217.695616 0 0.0000 335
Out..
lnL = -1217.695616
336 lfun, 336 eigenQcodon, 2016 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.021638 0.011337 0.089175 0.080430 0.022975 0.080177 0.000100 0.847057 0.169602
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 20.848923
np = 9
lnL0 = -1298.346386
Iterating by ming2
Initial: fx= 1298.346386
x= 0.02164 0.01134 0.08918 0.08043 0.02297 0.08018 0.00011 0.84706 0.16960
1 h-m-p 0.0000 0.0000 631.9297 ++ 1297.999463 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0000 1074.5536 ++ 1279.395666 m 0.0000 26 | 2/9
3 h-m-p 0.0000 0.0001 291.3553 ++ 1268.901253 m 0.0001 38 | 3/9
4 h-m-p 0.0000 0.0000 1284.9869 ++ 1267.808733 m 0.0000 50 | 4/9
5 h-m-p 0.0000 0.0003 403.2883 +++ 1233.347548 m 0.0003 63 | 5/9
6 h-m-p 0.0000 0.0000 849.9211 ++ 1230.010286 m 0.0000 75 | 6/9
7 h-m-p 0.0001 0.0004 163.4050 +YCYYCYYCCC 1218.431996 9 0.0003 102 | 6/9
8 h-m-p 0.2382 2.5749 0.2281 +YYYYC 1218.156279 4 0.9158 119 | 6/9
9 h-m-p 0.0937 0.4683 1.5184 CYC 1218.015280 2 0.0724 137 | 6/9
10 h-m-p 1.6000 8.0000 0.0662 ++ 1217.862020 m 8.0000 149 | 6/9
11 h-m-p 0.0941 0.4705 0.1559 ++ 1217.846522 m 0.4705 164 | 7/9
12 h-m-p 0.0755 0.3776 0.0163 ++ 1217.843837 m 0.3776 179 | 8/9
13 h-m-p 0.5610 8.0000 0.0002 YC 1217.841818 1 1.1135 194 | 8/9
14 h-m-p 1.6000 8.0000 0.0000 Y 1217.841818 0 1.2546 207 | 8/9
15 h-m-p 1.6000 8.0000 0.0000 ------C 1217.841818 0 0.0001 226
Out..
lnL = -1217.841818
227 lfun, 681 eigenQcodon, 2724 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.076547 0.041050 0.099744 0.069820 0.012654 0.086117 0.000100 1.259568 0.540078 0.294494 1148.955886
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 0.063924
np = 11
lnL0 = -1260.111129
Iterating by ming2
Initial: fx= 1260.111129
x= 0.07655 0.04105 0.09974 0.06982 0.01265 0.08612 0.00011 1.25957 0.54008 0.29449 951.42857
1 h-m-p 0.0000 0.0000 91.1170 ++ 1260.086766 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0065 34.7640 +++++ 1253.513757 m 0.0065 33 | 2/11
3 h-m-p 0.0005 0.0025 28.5666 ++ 1247.037692 m 0.0025 47 | 3/11
4 h-m-p 0.0038 0.0406 17.2763 +YCYYYYCYCC 1237.401877 10 0.0376 76 | 3/11
5 h-m-p 0.0004 0.0018 513.0370 ++ 1221.889432 m 0.0018 90 | 4/11
6 h-m-p 0.0000 0.0000 6338989.3130 ++ 1220.851052 m 0.0000 104 | 5/11
7 h-m-p 0.0000 0.0000 9221.2005 ++ 1219.600230 m 0.0000 118 | 6/11
8 h-m-p 0.0383 0.1913 3.1954 +YYYYYYCCCC 1217.702826 10 0.1568 146 | 6/11
9 h-m-p 1.6000 8.0000 0.0130 -Y 1217.702810 0 0.1603 161 | 6/11
10 h-m-p 0.1224 8.0000 0.0171 ++++ 1217.701726 m 8.0000 182 | 6/11
11 h-m-p 0.2228 8.0000 0.6124 +YC 1217.698109 1 1.8073 203 | 6/11
12 h-m-p 1.6000 8.0000 0.2088 CC 1217.697212 1 1.2568 224 | 6/11
13 h-m-p 0.7945 8.0000 0.3302 +C 1217.696523 0 2.8707 244 | 6/11
14 h-m-p 1.6000 8.0000 0.2635 YY 1217.696293 1 2.5810 264 | 6/11
15 h-m-p 1.6000 8.0000 0.2542 Y 1217.696258 0 1.1253 283 | 6/11
16 h-m-p 1.6000 8.0000 0.0717 C 1217.696256 0 1.6000 302 | 6/11
17 h-m-p 1.6000 8.0000 0.0004 C 1217.696255 0 2.0221 321 | 6/11
18 h-m-p 0.6615 8.0000 0.0011 ++ 1217.696255 m 8.0000 340 | 6/11
19 h-m-p 0.6597 8.0000 0.0138 +Y 1217.696248 0 4.4948 360 | 6/11
20 h-m-p 1.6000 8.0000 0.0253 ++ 1217.696169 m 8.0000 379 | 6/11
21 h-m-p 0.1519 1.7682 1.3340 ++ 1217.695809 m 1.7682 398 | 7/11
22 h-m-p 1.6000 8.0000 0.1590 C 1217.695712 0 1.4278 412 | 7/11
23 h-m-p 0.5075 8.0000 0.4473 ++ 1217.695652 m 8.0000 430 | 7/11
24 h-m-p 1.6000 8.0000 0.0180 Y 1217.695631 0 1.1779 448 | 7/11
25 h-m-p 0.0753 8.0000 0.2814 ++++ 1217.695625 m 8.0000 468 | 7/11
26 h-m-p 1.6000 8.0000 0.5781 Y 1217.695625 0 3.5021 486 | 7/11
27 h-m-p 1.6000 8.0000 0.3624 C 1217.695624 0 1.4501 504 | 7/11
28 h-m-p 1.0247 8.0000 0.5129 +Y 1217.695624 0 5.8199 523 | 7/11
29 h-m-p 1.6000 8.0000 0.4115 C 1217.695624 0 1.8617 541 | 7/11
30 h-m-p 1.6000 8.0000 0.1683 C 1217.695624 0 0.4584 559 | 7/11
31 h-m-p 0.1308 8.0000 0.5898 +Y 1217.695624 0 0.4384 578 | 7/11
32 h-m-p 0.5227 8.0000 0.4948 C 1217.695624 0 0.6195 596 | 7/11
33 h-m-p 0.1432 8.0000 2.1404 Y 1217.695624 0 0.2650 614 | 7/11
34 h-m-p 1.4034 8.0000 0.4041 Y 1217.695624 0 0.8920 628 | 7/11
35 h-m-p 1.6000 8.0000 0.0988 ++ 1217.695624 m 8.0000 646 | 7/11
36 h-m-p 1.6000 8.0000 0.3912 ++ 1217.695624 m 8.0000 664 | 7/11
37 h-m-p 0.1642 6.3682 19.0574 +++ 1217.695624 m 6.3682 683 | 7/11
38 h-m-p -0.0000 -0.0000 137.1759
h-m-p: -0.00000000e+00 -0.00000000e+00 1.37175908e+02 1217.695624
.. | 7/11
39 h-m-p 0.0160 8.0000 0.0016 --Y 1217.695624 0 0.0002 710 | 7/11
40 h-m-p 0.7867 8.0000 0.0000 -----C 1217.695624 0 0.0003 733
Out..
lnL = -1217.695624
734 lfun, 2936 eigenQcodon, 13212 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1222.636174 S = -1221.197292 -2.367452
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:05
did 20 / 58 patterns 0:05
did 30 / 58 patterns 0:05
did 40 / 58 patterns 0:05
did 50 / 58 patterns 0:05
did 58 / 58 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.045365 0.025143 0.050600 0.024586 0.081402 0.091545 0.000100 0.618705 1.543562
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 21.412115
np = 9
lnL0 = -1302.653339
Iterating by ming2
Initial: fx= 1302.653339
x= 0.04536 0.02514 0.05060 0.02459 0.08140 0.09155 0.00011 0.61871 1.54356
1 h-m-p 0.0000 0.0000 638.1719 ++ 1302.309773 m 0.0000 14 | 1/9
2 h-m-p 0.0000 0.0021 108.7177 ++++ 1287.970387 m 0.0021 28 | 1/9
3 h-m-p 0.0002 0.0008 522.6011 +CYYYCCCCC 1253.709934 8 0.0007 55 | 1/9
4 h-m-p 0.0004 0.0021 12.6965 -----------.. | 1/9
5 h-m-p 0.0000 0.0000 13216.1776 YCYYCYCCC 1250.706526 8 0.0000 100 | 1/9
6 h-m-p 0.0000 0.0000 622.5641 ++ 1245.391843 m 0.0000 112 | 2/9
7 h-m-p 0.0000 0.0000 21346.8424 ++ 1244.859646 m 0.0000 124 | 3/9
8 h-m-p 0.0000 0.0001 330.4393 ++ 1230.454931 m 0.0001 136 | 4/9
9 h-m-p 0.0000 0.0001 94.9578 ++ 1227.978506 m 0.0001 148 | 5/9
10 h-m-p 0.0000 0.0001 275.2057 ++ 1220.179859 m 0.0001 160 | 6/9
11 h-m-p 0.0064 1.9721 0.7872 +++++ 1217.872887 m 1.9721 175 | 7/9
12 h-m-p 1.6000 8.0000 0.0004 ++ 1217.866169 m 8.0000 190 | 7/9
13 h-m-p 0.1147 3.7734 0.0246 +CCC 1217.847580 2 0.6262 209 | 7/9
14 h-m-p 1.6000 8.0000 0.0005 ++ 1217.846525 m 8.0000 223 | 7/9
15 h-m-p 0.2814 8.0000 0.0140 +YCYC 1217.842459 3 2.4399 242 | 7/9
16 h-m-p 1.6000 8.0000 0.0024 C 1217.842222 0 1.7157 256 | 7/9
17 h-m-p 1.3087 8.0000 0.0032 ++ 1217.841956 m 8.0000 270 | 7/9
18 h-m-p 1.6000 8.0000 0.0087 +Y 1217.841873 0 5.1910 285 | 7/9
19 h-m-p 1.6000 8.0000 0.0070 C 1217.841847 0 1.4544 299 | 7/9
20 h-m-p 1.3006 8.0000 0.0079 ++ 1217.841828 m 8.0000 313 | 7/9
21 h-m-p 1.6000 8.0000 0.0172 C 1217.841824 0 2.3282 327 | 7/9
22 h-m-p 1.6000 8.0000 0.0175 Y 1217.841821 0 3.6184 341 | 7/9
23 h-m-p 1.6000 8.0000 0.0243 C 1217.841819 0 2.5231 355 | 7/9
24 h-m-p 1.6000 8.0000 0.0339 +Y 1217.841818 0 4.3814 370 | 7/9
25 h-m-p 1.6000 8.0000 0.0400 C 1217.841817 0 1.8495 384 | 7/9
26 h-m-p 1.2529 8.0000 0.0591 ++ 1217.841817 m 8.0000 398 | 7/9
27 h-m-p 1.6000 8.0000 0.1004 Y 1217.841817 0 3.6215 412 | 7/9
28 h-m-p 1.6000 8.0000 0.1919
QuantileBeta(0.85, 2.73632, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 3.04340, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
Y 1217.841817 0 4.4932 427
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37049, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37024, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.37037, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
29 h-m-p 1.6000 8.0000 0.1447
QuantileBeta(0.85, 2.60186, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.29635, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
Y 1217.841817 0 1.2673 441
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55386, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55360, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 2.55373, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
30 h-m-p 0.4885 8.0000 0.3754
QuantileBeta(0.85, 2.73709, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.28718, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 5.48751, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841817 0 1.7336 456
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20461, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20432, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 3.20446, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
31 h-m-p 1.2114 8.0000 0.5372
QuantileBeta(0.85, 3.85520, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 5.80740, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
+ 1217.841816 m 8.0000 470
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50193, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50146, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.50169, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
32 h-m-p 1.6000 8.0000 0.4772
QuantileBeta(0.85, 8.26528, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.69259, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841816 0 0.4837 484
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73276, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73228, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 7.73252, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
33 h-m-p 0.0190 7.5152 12.1444
QuantileBeta(0.85, 7.96335, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.65585, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841816 0 0.0266 498
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05534, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.05533, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
34 h-m-p 1.6000 8.0000 0.0054
QuantileBeta(0.85, 8.06395, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.08981, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 8.09842, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
Y 1217.841816 0 4.5338 511
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.08000, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07951, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.07975, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
35 h-m-p 0.1631 8.0000 0.1497
QuantileBeta(0.85, 8.10418, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.17744, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 8.47048, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841816 0 0.9963 526
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22914, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22865, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.22890, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
36 h-m-p 0.1225 8.0000 1.2172
QuantileBeta(0.85, 8.37804, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.82546, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841816 0 0.1607 540
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
37 h-m-p 1.6000 8.0000 0.0340
QuantileBeta(0.85, 8.37016, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.41095, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42115, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42370, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42434, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42450, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42454, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
Y 1217.841816 0 0.0001 558
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42480, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
38 h-m-p 0.0160 8.0000 0.0913
QuantileBeta(0.85, 8.42601, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42491, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42464, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42457, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
C 1217.841816 0 0.0001 575
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42480, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
39 h-m-p 0.0160 8.0000 0.0005
QuantileBeta(0.85, 8.42456, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
-
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
N 1217.841816 0 0.0000 593
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42480, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42430, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
| 7/9
40 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
+
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
N 1217.841816 0 0.0640 608
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
Out..
lnL = -1217.841816
609 lfun, 6699 eigenQcodon, 36540 P(t)
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
QuantileBeta(0.85, 8.42455, 0.00500) = 1.000000e+00 2000 rounds
Time used: 0:15
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 1
0.040580 0.066877 0.069924 0.107509 0.090046 0.010310 0.000100 0.900000 0.494307 1.494847 999.000000
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 0.102429
np = 11
lnL0 = -1248.086060
Iterating by ming2
Initial: fx= 1248.086060
x= 0.04058 0.06688 0.06992 0.10751 0.09005 0.01031 0.00011 0.90000 0.49431 1.49485 951.42857
1 h-m-p 0.0000 0.0000 259.5192 ++ 1247.875410 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0000 5240.1487 +YYYYCYYYYY 1226.371743 10 0.0000 41 | 1/11
3 h-m-p 0.0009 0.0044 19.0228 +YCCC 1225.828821 3 0.0028 61 | 1/11
4 h-m-p 0.0143 0.0713 3.1624 +YYYC 1224.998200 3 0.0551 79 | 1/11
5 h-m-p 0.0027 0.0137 5.7367 ++ 1224.702326 m 0.0137 93 | 2/11
6 h-m-p 0.0008 0.0041 7.1286 ++ 1224.027314 m 0.0041 107 | 3/11
7 h-m-p 0.0015 0.0076 10.3568 ++ 1223.012784 m 0.0076 121 | 4/11
8 h-m-p 0.0026 0.0132 15.5777 ++ 1222.384868 m 0.0132 135 | 4/11
9 h-m-p 0.0000 0.0000 30.7363
h-m-p: 3.41071890e-20 1.70535945e-19 3.07363047e+01 1222.384868
.. | 4/11
10 h-m-p 0.0000 0.0001 570.3326 YYYYC 1221.282364 4 0.0000 164 | 5/11
11 h-m-p 0.0000 0.0001 151.7941 ++ 1219.500732 m 0.0001 178 | 6/11
12 h-m-p 0.0000 0.0001 127.3223 ++ 1218.579051 m 0.0001 192 | 7/11
13 h-m-p 0.0060 0.0427 0.2253 CYCCC 1218.538193 4 0.0087 213 | 7/11
14 h-m-p 0.6329 7.5630 0.0031 +YCYYYCC 1217.746320 6 6.2010 241 | 7/11
15 h-m-p 1.6000 8.0000 0.0008 YYC 1217.740038 2 1.4551 261 | 7/11
16 h-m-p 0.0835 8.0000 0.0131 +CYC 1217.719613 2 0.2853 283 | 7/11
17 h-m-p 1.6000 8.0000 0.0013 CCC 1217.711879 2 1.9791 305 | 7/11
18 h-m-p 1.6000 8.0000 0.0015 ++ 1217.702382 m 8.0000 323 | 7/11
19 h-m-p 1.6000 8.0000 0.0039 YC 1217.701182 1 0.7978 342 | 7/11
20 h-m-p 1.2044 8.0000 0.0026 ++ 1217.698528 m 8.0000 360 | 7/11
21 h-m-p 1.6000 8.0000 0.0060 C 1217.697910 0 1.6000 378 | 7/11
22 h-m-p 0.8908 8.0000 0.0109 +YC 1217.697055 1 3.0000 398 | 7/11
23 h-m-p 1.6000 8.0000 0.0102 YC 1217.696566 1 3.5682 417 | 7/11
24 h-m-p 1.6000 8.0000 0.0225 CC 1217.696254 1 2.0286 437 | 7/11
25 h-m-p 1.6000 8.0000 0.0214 ++ 1217.695910 m 8.0000 455 | 7/11
26 h-m-p 1.6000 8.0000 0.0542 C 1217.695797 0 1.3187 473 | 7/11
27 h-m-p 1.6000 8.0000 0.0422 ++ 1217.695664 m 8.0000 491 | 7/11
28 h-m-p 0.3674 1.8370 0.1331 ++ 1217.695624 m 1.8370 509 | 8/11
29 h-m-p 1.6000 8.0000 0.0012 C 1217.695624 0 2.3922 527 | 8/11
30 h-m-p 1.6000 8.0000 0.0008 ---C 1217.695624 0 0.0063 547
Out..
lnL = -1217.695624
548 lfun, 6576 eigenQcodon, 36168 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -1222.373696 S = -1221.195902 -1.981268
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 58 patterns 0:24
did 20 / 58 patterns 0:24
did 30 / 58 patterns 0:24
did 40 / 58 patterns 0:25
did 50 / 58 patterns 0:25
did 58 / 58 patterns 0:25
Time used: 0:25
CodeML output code: -1