--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Thu Jan 23 10:07:52 GMT 2020 codeml.models=0 1 2 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=MUSCLE tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir=/usr/bin/ input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb tcoffee.bin=t_coffee mrbayes.dir=/opt/mrbayes_3.2.2/src tcoffee.dir= tcoffee.minScore=3 input.fasta=/data/1res/cobT/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1412.61 -1416.05 2 -1412.63 -1415.45 -------------------------------------- TOTAL -1412.62 -1415.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891890 0.088934 0.377789 1.501303 0.855647 1299.25 1400.12 1.000 r(A<->C){all} 0.168538 0.019314 0.000047 0.448896 0.134764 175.29 191.04 1.001 r(A<->G){all} 0.161451 0.019034 0.000017 0.443057 0.126665 246.75 272.44 1.000 r(A<->T){all} 0.174918 0.021568 0.000166 0.475103 0.135909 115.91 168.54 1.000 r(C<->G){all} 0.167757 0.018430 0.000005 0.437410 0.136424 259.34 316.85 1.002 r(C<->T){all} 0.161345 0.018293 0.000140 0.435765 0.126625 222.28 271.95 1.000 r(G<->T){all} 0.165990 0.018943 0.000076 0.443619 0.132000 241.83 266.77 1.000 pi(A){all} 0.172726 0.000136 0.151693 0.196988 0.172161 1112.19 1236.40 1.000 pi(C){all} 0.306531 0.000190 0.279415 0.332588 0.306559 1197.76 1252.92 1.000 pi(G){all} 0.342898 0.000209 0.315749 0.371470 0.342793 1060.45 1280.73 1.000 pi(T){all} 0.177845 0.000138 0.154914 0.200253 0.177724 1373.62 1399.01 1.000 alpha{1,2} 0.443111 0.245939 0.000261 1.431847 0.264457 998.04 1135.57 1.000 alpha{3} 0.455976 0.232927 0.000133 1.417494 0.294483 1180.73 1241.25 1.000 pinvar{all} 0.998569 0.000003 0.995557 0.999999 0.999062 1171.63 1218.78 1.003 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -1370.747218 Model 2: PositiveSelection -1370.747464 Model 0: one-ratio -1370.74759 Model 7: beta -1370.747218 Model 8: beta&w>1 -1370.747416 Model 0 vs 1 7.4399999994057E-4 Model 2 vs 1 4.920000001220615E-4 Model 8 vs 7 3.959999999096908E-4
>C1 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C2 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C3 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C4 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C5 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C6 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=351 C1 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C2 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C3 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C4 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C5 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C6 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP ************************************************** C1 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C2 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C3 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C4 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C5 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C6 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ************************************************** C1 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C2 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C3 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C4 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C5 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C6 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA ************************************************** C1 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C2 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C3 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C4 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C5 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C6 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG ************************************************** C1 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C2 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C3 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C4 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C5 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C6 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA ************************************************** C1 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C2 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C3 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C4 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C5 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C6 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD ************************************************** C1 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C2 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C3 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C4 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C5 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C6 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP ************************************************** C1 S C2 S C3 S C4 S C5 S C6 S * PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 6 SEQUENCES [PROTEIN] Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 351 type PROTEIN Struct Unchecked Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 351 type PROTEIN Struct Unchecked Multi Core Mode: 96 processors: --- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [10530] Library Relaxation: Multi_proc [96] Relaxation Summary: [10530]--->[10530] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii # Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.520 Mb, Max= 30.922 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE] CLUSTAL W (1.83) multiple sequence alignment C1 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C2 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C3 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C4 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C5 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP C6 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP ************************************************** C1 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C2 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C3 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C4 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C5 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI C6 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ************************************************** C1 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C2 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C3 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C4 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C5 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA C6 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA ************************************************** C1 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C2 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C3 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C4 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C5 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG C6 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG ************************************************** C1 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C2 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C3 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C4 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C5 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA C6 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA ************************************************** C1 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C2 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C3 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C4 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C5 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD C6 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD ************************************************** C1 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C2 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C3 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C4 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C5 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP C6 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP ************************************************** C1 S C2 S C3 S C4 S C5 S C6 S * FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE] input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 AVG 0 C1 * 100.00 AVG 1 C2 * 100.00 AVG 2 C3 * 100.00 AVG 3 C4 * 100.00 AVG 4 C5 * 100.00 AVG 5 C6 * 100.00 TOT TOT * 100.00 CLUSTAL W (1.83) multiple sequence alignment C1 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC C2 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC C3 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC C4 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC C5 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC C6 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC ************************************************** C1 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC C2 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC C3 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC C4 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC C5 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC C6 CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC ************************************************** C1 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA C2 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA C3 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA C4 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA C5 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA C6 TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA ************************************************** C1 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT C2 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT C3 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT C4 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT C5 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT C6 CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT ************************************************** C1 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG C2 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG C3 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG C4 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG C5 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG C6 CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG ************************************************** C1 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC C2 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC C3 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC C4 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC C5 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC C6 TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC ************************************************** C1 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT C2 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT C3 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT C4 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT C5 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT C6 GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT ************************************************** C1 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG C2 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG C3 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG C4 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG C5 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG C6 GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG ************************************************** C1 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC C2 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC C3 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC C4 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC C5 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC C6 CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC ************************************************** C1 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT C2 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT C3 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT C4 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT C5 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT C6 GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT ************************************************** C1 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG C2 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG C3 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG C4 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG C5 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG C6 CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG ************************************************** C1 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG C2 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG C3 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG C4 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG C5 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG C6 CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ************************************************** C1 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT C2 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT C3 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT C4 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT C5 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT C6 ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ************************************************** C1 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT C2 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT C3 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT C4 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT C5 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT C6 ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT ************************************************** C1 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG C2 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG C3 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG C4 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG C5 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG C6 GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG ************************************************** C1 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC C2 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC C3 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC C4 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC C5 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC C6 GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ************************************************** C1 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG C2 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG C3 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG C4 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG C5 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG C6 ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG ************************************************** C1 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC C2 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC C3 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC C4 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC C5 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC C6 GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC ************************************************** C1 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC C2 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC C3 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC C4 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC C5 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC C6 TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC ************************************************** C1 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA C2 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA C3 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA C4 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA C5 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA C6 TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA ************************************************** C1 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA C2 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA C3 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA C4 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA C5 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA C6 TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA ************************************************** C1 TCG C2 TCG C3 TCG C4 TCG C5 TCG C6 TCG *** >C1 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C2 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C3 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C4 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C5 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C6 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >C1 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C2 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C3 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C4 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C5 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >C6 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 6 taxa and 1053 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1579773994 Setting output file names to "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 943887139 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 8977532113 Seed = 140645408 Swapseed = 1579773994 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 4 unique site patterns Division 2 has 4 unique site patterns Division 3 has 4 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -2356.664480 -- -24.965149 Chain 2 -- -2356.664480 -- -24.965149 Chain 3 -- -2356.664344 -- -24.965149 Chain 4 -- -2356.664480 -- -24.965149 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -2356.664344 -- -24.965149 Chain 2 -- -2356.664344 -- -24.965149 Chain 3 -- -2356.664480 -- -24.965149 Chain 4 -- -2356.664344 -- -24.965149 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-2356.664] (-2356.664) (-2356.664) (-2356.664) * [-2356.664] (-2356.664) (-2356.664) (-2356.664) 500 -- (-1443.097) [-1421.425] (-1432.448) (-1468.342) * (-1419.400) [-1422.682] (-1438.217) (-1425.694) -- 0:00:00 1000 -- (-1436.889) [-1426.020] (-1421.307) (-1428.686) * (-1421.665) (-1427.405) [-1429.572] (-1428.030) -- 0:00:00 1500 -- (-1430.159) (-1423.973) [-1426.391] (-1425.029) * (-1424.670) (-1418.173) (-1419.813) [-1414.413] -- 0:00:00 2000 -- (-1426.289) (-1419.202) (-1427.730) [-1418.138] * (-1421.013) [-1416.498] (-1415.764) (-1425.247) -- 0:00:00 2500 -- [-1422.814] (-1423.555) (-1417.505) (-1421.041) * (-1420.238) (-1426.423) [-1421.778] (-1421.669) -- 0:00:00 3000 -- [-1422.332] (-1419.641) (-1419.841) (-1424.327) * [-1422.319] (-1425.297) (-1427.601) (-1423.862) -- 0:00:00 3500 -- (-1422.405) [-1417.877] (-1422.679) (-1423.692) * [-1420.026] (-1425.614) (-1421.835) (-1427.280) -- 0:00:00 4000 -- (-1426.438) (-1423.508) [-1422.062] (-1426.019) * [-1422.114] (-1425.182) (-1421.516) (-1418.592) -- 0:00:00 4500 -- (-1419.962) [-1424.516] (-1427.567) (-1425.647) * (-1421.856) (-1421.414) [-1425.782] (-1425.965) -- 0:00:00 5000 -- (-1420.614) [-1422.935] (-1421.951) (-1436.498) * (-1420.556) [-1416.898] (-1420.304) (-1430.567) -- 0:00:00 Average standard deviation of split frequencies: 0.095647 5500 -- (-1430.665) [-1420.190] (-1423.407) (-1427.216) * (-1421.939) (-1424.290) (-1421.788) [-1417.786] -- 0:00:00 6000 -- (-1430.018) (-1426.318) (-1424.821) [-1420.956] * [-1418.683] (-1427.805) (-1422.703) (-1419.151) -- 0:00:00 6500 -- (-1423.547) (-1416.938) (-1417.872) [-1418.678] * (-1419.190) (-1428.188) (-1422.243) [-1419.168] -- 0:00:00 7000 -- (-1418.831) [-1414.678] (-1420.499) (-1422.995) * [-1420.962] (-1419.985) (-1431.732) (-1426.970) -- 0:02:21 7500 -- (-1427.539) (-1421.357) (-1424.546) [-1420.191] * (-1415.671) (-1419.509) (-1422.655) [-1417.827] -- 0:02:12 8000 -- (-1419.624) (-1421.334) (-1423.908) [-1423.810] * [-1422.501] (-1420.577) (-1418.655) (-1425.327) -- 0:02:04 8500 -- (-1422.606) [-1420.040] (-1420.351) (-1420.393) * (-1418.294) (-1429.936) [-1421.712] (-1419.600) -- 0:01:56 9000 -- (-1431.539) (-1419.050) [-1422.055] (-1422.823) * (-1429.537) (-1423.289) [-1420.979] (-1426.521) -- 0:01:50 9500 -- (-1418.754) (-1423.250) (-1420.853) [-1418.906] * (-1422.336) (-1423.046) (-1432.434) [-1417.176] -- 0:01:44 10000 -- (-1420.990) (-1427.693) (-1426.740) [-1422.217] * (-1419.575) [-1419.253] (-1426.421) (-1419.632) -- 0:01:39 Average standard deviation of split frequencies: 0.084371 10500 -- (-1419.646) [-1418.689] (-1428.421) (-1421.603) * (-1425.600) (-1428.478) [-1423.006] (-1420.592) -- 0:01:34 11000 -- (-1420.353) (-1419.848) [-1421.266] (-1419.391) * [-1421.569] (-1419.761) (-1426.393) (-1421.326) -- 0:01:29 11500 -- (-1421.499) [-1417.581] (-1427.226) (-1423.552) * (-1430.436) (-1425.245) (-1417.046) [-1418.608] -- 0:01:25 12000 -- (-1420.931) (-1427.432) [-1420.184] (-1421.764) * [-1423.613] (-1424.757) (-1420.114) (-1426.508) -- 0:01:22 12500 -- [-1421.956] (-1428.587) (-1420.018) (-1426.337) * (-1423.131) (-1419.497) (-1415.022) [-1431.405] -- 0:01:19 13000 -- [-1416.222] (-1421.437) (-1423.219) (-1425.709) * (-1423.332) (-1417.224) (-1415.093) [-1419.617] -- 0:01:15 13500 -- (-1414.291) [-1423.474] (-1429.525) (-1425.458) * (-1418.344) [-1417.171] (-1411.346) (-1433.264) -- 0:01:13 14000 -- [-1414.072] (-1430.977) (-1419.742) (-1430.229) * (-1423.617) (-1421.446) (-1417.262) [-1423.370] -- 0:01:10 14500 -- [-1413.619] (-1426.883) (-1422.100) (-1420.521) * (-1418.803) [-1419.145] (-1412.213) (-1426.215) -- 0:01:07 15000 -- (-1412.819) [-1417.109] (-1422.445) (-1423.563) * (-1428.416) [-1423.069] (-1412.213) (-1430.675) -- 0:01:05 Average standard deviation of split frequencies: 0.055979 15500 -- (-1412.303) (-1419.943) (-1417.899) [-1421.346] * (-1425.320) (-1423.999) [-1411.594] (-1424.902) -- 0:01:03 16000 -- (-1413.557) (-1430.522) [-1420.522] (-1422.061) * [-1420.522] (-1428.286) (-1411.320) (-1427.785) -- 0:01:01 16500 -- (-1414.734) [-1420.604] (-1425.621) (-1426.344) * (-1418.937) [-1419.967] (-1412.691) (-1424.319) -- 0:00:59 17000 -- (-1416.595) (-1429.779) [-1419.674] (-1422.947) * (-1428.595) [-1424.288] (-1417.425) (-1421.633) -- 0:00:57 17500 -- (-1414.378) [-1416.656] (-1419.972) (-1428.224) * (-1430.621) (-1421.455) [-1415.719] (-1420.608) -- 0:00:56 18000 -- (-1412.468) (-1423.105) [-1416.806] (-1428.256) * [-1424.958] (-1428.645) (-1416.957) (-1421.345) -- 0:00:54 18500 -- [-1412.318] (-1420.511) (-1427.189) (-1421.069) * (-1425.452) (-1423.621) (-1418.841) [-1415.580] -- 0:00:53 19000 -- (-1412.588) [-1423.636] (-1422.525) (-1424.846) * (-1416.420) (-1419.770) (-1420.062) [-1421.014] -- 0:00:51 19500 -- (-1414.921) (-1421.651) (-1428.907) [-1423.656] * (-1424.010) (-1428.233) (-1420.077) [-1423.442] -- 0:00:50 20000 -- (-1413.875) [-1421.394] (-1423.636) (-1417.672) * (-1422.473) [-1425.157] (-1416.664) (-1423.787) -- 0:00:49 Average standard deviation of split frequencies: 0.045620 20500 -- (-1414.516) (-1424.375) [-1420.734] (-1420.786) * (-1425.453) (-1422.917) [-1414.625] (-1418.577) -- 0:00:47 21000 -- (-1412.428) (-1424.789) [-1419.425] (-1420.863) * (-1429.333) [-1422.719] (-1412.891) (-1423.414) -- 0:00:46 21500 -- (-1413.437) (-1422.772) (-1419.838) [-1425.771] * (-1431.919) [-1415.187] (-1413.117) (-1423.442) -- 0:00:45 22000 -- (-1414.354) (-1420.379) (-1422.281) [-1424.518] * [-1419.899] (-1429.763) (-1413.598) (-1425.304) -- 0:00:44 22500 -- (-1412.443) [-1421.486] (-1431.688) (-1430.419) * [-1421.252] (-1433.343) (-1415.350) (-1421.877) -- 0:01:26 23000 -- (-1418.162) (-1417.662) [-1416.089] (-1419.917) * (-1425.329) [-1414.963] (-1412.437) (-1424.215) -- 0:01:24 23500 -- (-1412.995) (-1427.176) [-1428.366] (-1429.258) * [-1415.154] (-1417.561) (-1412.598) (-1433.380) -- 0:01:23 24000 -- (-1412.230) (-1416.249) (-1425.604) [-1417.650] * (-1420.555) [-1433.593] (-1413.247) (-1421.965) -- 0:01:21 24500 -- [-1411.894] (-1412.992) (-1424.959) (-1422.923) * [-1420.124] (-1421.965) (-1414.982) (-1431.842) -- 0:01:19 25000 -- [-1411.887] (-1417.052) (-1425.520) (-1421.909) * (-1417.995) (-1425.772) [-1416.230] (-1435.363) -- 0:01:18 Average standard deviation of split frequencies: 0.044503 25500 -- (-1412.982) [-1413.367] (-1419.828) (-1419.882) * (-1425.180) (-1417.665) (-1416.589) [-1416.520] -- 0:01:16 26000 -- (-1412.719) (-1412.617) [-1418.678] (-1430.647) * (-1419.512) (-1436.885) (-1414.588) [-1420.212] -- 0:01:14 26500 -- [-1412.192] (-1414.081) (-1427.777) (-1427.006) * [-1418.812] (-1421.338) (-1420.227) (-1416.524) -- 0:01:13 27000 -- (-1411.746) (-1415.563) [-1418.350] (-1429.766) * [-1420.197] (-1430.247) (-1414.091) (-1423.335) -- 0:01:12 27500 -- (-1416.616) [-1415.617] (-1425.832) (-1422.655) * (-1423.443) [-1426.940] (-1415.520) (-1427.676) -- 0:01:10 28000 -- (-1414.211) [-1411.638] (-1432.579) (-1423.627) * [-1420.871] (-1424.192) (-1415.439) (-1425.866) -- 0:01:09 28500 -- (-1412.240) (-1411.317) (-1431.763) [-1426.508] * (-1422.154) [-1418.327] (-1413.593) (-1419.835) -- 0:01:08 29000 -- (-1412.430) [-1412.090] (-1421.196) (-1415.450) * (-1423.301) (-1425.528) [-1414.734] (-1419.831) -- 0:01:06 29500 -- (-1413.950) (-1411.482) [-1421.631] (-1412.429) * (-1422.875) (-1429.483) [-1414.463] (-1428.689) -- 0:01:05 30000 -- (-1412.673) [-1412.012] (-1429.008) (-1411.705) * [-1422.905] (-1427.236) (-1414.780) (-1418.280) -- 0:01:04 Average standard deviation of split frequencies: 0.039827 30500 -- (-1413.055) (-1414.503) [-1423.634] (-1411.585) * (-1427.483) [-1417.453] (-1413.759) (-1426.054) -- 0:01:03 31000 -- (-1415.007) [-1413.882] (-1419.072) (-1412.150) * (-1423.904) [-1418.964] (-1413.595) (-1422.552) -- 0:01:02 31500 -- (-1412.017) (-1415.650) [-1424.801] (-1411.627) * (-1422.168) (-1432.820) [-1415.356] (-1431.429) -- 0:01:01 32000 -- (-1411.715) (-1419.368) (-1430.413) [-1411.691] * (-1423.995) (-1418.640) [-1415.342] (-1423.303) -- 0:01:00 32500 -- (-1411.393) (-1415.062) (-1428.705) [-1412.897] * [-1426.523] (-1418.571) (-1415.149) (-1425.782) -- 0:00:59 33000 -- [-1412.062] (-1414.332) (-1424.042) (-1412.793) * (-1427.201) (-1423.646) (-1415.013) [-1423.298] -- 0:00:58 33500 -- (-1412.299) [-1413.055] (-1425.339) (-1412.196) * (-1417.603) (-1422.230) [-1416.545] (-1424.084) -- 0:00:57 34000 -- [-1413.481] (-1415.285) (-1419.215) (-1417.407) * [-1421.099] (-1419.816) (-1415.533) (-1424.932) -- 0:00:56 34500 -- (-1415.254) (-1414.719) (-1412.140) [-1414.741] * (-1429.492) [-1423.365] (-1416.542) (-1420.540) -- 0:00:55 35000 -- (-1413.927) [-1416.687] (-1411.780) (-1412.339) * (-1420.625) [-1418.706] (-1415.500) (-1421.296) -- 0:00:55 Average standard deviation of split frequencies: 0.037320 35500 -- [-1411.247] (-1417.989) (-1413.740) (-1412.562) * (-1422.334) [-1431.192] (-1421.927) (-1423.894) -- 0:00:54 36000 -- (-1412.092) (-1420.463) (-1411.644) [-1414.232] * (-1419.390) (-1422.258) (-1417.321) [-1418.417] -- 0:00:53 36500 -- (-1414.744) [-1417.174] (-1411.661) (-1413.919) * [-1420.527] (-1419.971) (-1418.828) (-1424.283) -- 0:00:52 37000 -- (-1411.975) [-1415.080] (-1411.752) (-1416.449) * [-1430.870] (-1429.314) (-1413.332) (-1422.363) -- 0:00:52 37500 -- (-1411.871) [-1412.309] (-1412.868) (-1417.326) * (-1426.345) (-1422.640) (-1413.864) [-1420.430] -- 0:00:51 38000 -- (-1414.186) (-1412.402) (-1412.973) [-1413.368] * (-1422.994) [-1420.843] (-1414.707) (-1425.547) -- 0:01:15 38500 -- [-1413.560] (-1413.766) (-1411.557) (-1412.947) * [-1420.385] (-1419.273) (-1415.769) (-1422.732) -- 0:01:14 39000 -- (-1415.239) (-1412.328) (-1412.870) [-1413.512] * (-1420.204) (-1420.978) (-1413.464) [-1415.381] -- 0:01:13 39500 -- (-1413.708) [-1412.692] (-1413.358) (-1420.992) * (-1422.418) [-1419.461] (-1412.349) (-1413.649) -- 0:01:12 40000 -- (-1414.198) (-1415.177) [-1411.530] (-1413.081) * (-1428.543) (-1426.739) [-1412.316] (-1414.566) -- 0:01:12 Average standard deviation of split frequencies: 0.030719 40500 -- (-1414.450) (-1411.765) (-1411.555) [-1413.147] * (-1419.480) (-1425.875) (-1413.143) [-1411.358] -- 0:01:11 41000 -- (-1417.792) [-1411.406] (-1413.027) (-1413.415) * (-1426.242) [-1421.604] (-1413.204) (-1412.101) -- 0:01:10 41500 -- (-1413.907) (-1412.140) [-1413.879] (-1413.920) * (-1421.187) [-1422.528] (-1415.702) (-1412.454) -- 0:01:09 42000 -- (-1412.379) (-1411.256) (-1415.579) [-1414.981] * (-1416.871) (-1417.347) [-1414.474] (-1411.644) -- 0:01:08 42500 -- (-1413.653) (-1414.058) (-1413.256) [-1416.898] * (-1413.949) [-1421.094] (-1415.128) (-1414.640) -- 0:01:07 43000 -- [-1414.096] (-1413.686) (-1412.658) (-1414.025) * (-1415.172) (-1423.515) [-1411.631] (-1418.074) -- 0:01:06 43500 -- (-1413.361) [-1411.282] (-1414.961) (-1418.078) * (-1414.143) (-1421.027) (-1411.970) [-1414.648] -- 0:01:05 44000 -- [-1415.248] (-1415.061) (-1413.465) (-1413.461) * (-1414.781) (-1420.698) (-1413.595) [-1415.397] -- 0:01:05 44500 -- (-1411.619) [-1412.252] (-1414.695) (-1412.451) * [-1411.904] (-1421.765) (-1413.429) (-1416.139) -- 0:01:04 45000 -- (-1414.085) [-1412.751] (-1413.024) (-1411.729) * (-1415.314) (-1424.490) [-1411.589] (-1412.252) -- 0:01:03 Average standard deviation of split frequencies: 0.026086 45500 -- (-1413.076) (-1412.266) (-1411.734) [-1413.566] * (-1414.452) (-1423.198) [-1411.543] (-1414.264) -- 0:01:02 46000 -- [-1414.123] (-1411.396) (-1412.413) (-1413.226) * (-1413.929) [-1419.145] (-1412.323) (-1416.630) -- 0:01:02 46500 -- (-1413.246) (-1412.975) (-1414.084) [-1413.153] * [-1412.121] (-1421.441) (-1413.767) (-1416.189) -- 0:01:01 47000 -- [-1414.800] (-1412.723) (-1412.150) (-1411.956) * (-1413.339) (-1424.133) [-1412.099] (-1413.993) -- 0:01:00 47500 -- (-1414.877) (-1411.917) [-1412.809] (-1412.112) * (-1411.839) [-1420.964] (-1413.010) (-1413.555) -- 0:01:00 48000 -- (-1417.954) (-1414.785) (-1416.511) [-1412.054] * (-1415.235) [-1420.318] (-1413.156) (-1413.618) -- 0:00:59 48500 -- (-1415.220) [-1412.107] (-1412.364) (-1412.097) * (-1416.487) (-1423.830) (-1414.802) [-1411.297] -- 0:00:58 49000 -- (-1415.110) [-1412.082] (-1413.281) (-1412.154) * [-1412.917] (-1421.595) (-1416.694) (-1413.504) -- 0:00:58 49500 -- (-1419.674) (-1412.082) (-1414.004) [-1411.328] * (-1413.024) (-1420.478) (-1414.572) [-1413.504] -- 0:00:57 50000 -- (-1414.775) [-1412.372] (-1414.354) (-1412.748) * [-1415.206] (-1422.420) (-1411.204) (-1411.945) -- 0:00:57 Average standard deviation of split frequencies: 0.029980 50500 -- (-1412.258) [-1416.086] (-1424.874) (-1411.862) * (-1416.262) (-1420.270) [-1411.294] (-1415.827) -- 0:00:56 51000 -- (-1415.170) (-1414.813) (-1417.590) [-1411.813] * (-1416.089) (-1417.427) [-1412.124] (-1413.228) -- 0:00:55 51500 -- (-1412.847) [-1412.359] (-1414.544) (-1411.520) * (-1418.652) (-1419.577) (-1411.496) [-1415.492] -- 0:00:55 52000 -- (-1412.069) (-1413.033) [-1414.084] (-1412.386) * (-1416.394) (-1425.247) (-1414.741) [-1412.364] -- 0:00:54 52500 -- (-1412.054) [-1413.286] (-1413.739) (-1411.711) * (-1416.517) [-1421.145] (-1414.869) (-1411.826) -- 0:00:54 53000 -- (-1412.409) (-1415.074) (-1412.645) [-1412.386] * (-1416.750) (-1425.334) [-1414.382] (-1411.909) -- 0:00:53 53500 -- [-1412.882] (-1413.704) (-1411.951) (-1412.612) * (-1416.781) [-1422.095] (-1414.363) (-1411.909) -- 0:00:53 54000 -- (-1413.535) (-1412.461) (-1411.918) [-1413.385] * (-1414.844) (-1431.012) [-1414.306] (-1412.880) -- 0:01:10 54500 -- [-1413.655] (-1412.355) (-1412.018) (-1412.535) * (-1414.499) [-1421.191] (-1412.812) (-1413.307) -- 0:01:09 55000 -- (-1413.026) (-1415.159) [-1411.841] (-1416.316) * [-1411.786] (-1417.281) (-1412.964) (-1412.916) -- 0:01:08 Average standard deviation of split frequencies: 0.029463 55500 -- (-1416.068) [-1411.872] (-1411.356) (-1414.765) * (-1414.468) (-1418.095) [-1412.837] (-1411.587) -- 0:01:08 56000 -- (-1412.428) [-1415.944] (-1411.957) (-1413.091) * [-1412.430] (-1421.428) (-1412.839) (-1413.940) -- 0:01:07 56500 -- (-1414.050) (-1414.551) (-1413.281) [-1412.821] * (-1414.122) (-1420.168) [-1414.763] (-1415.726) -- 0:01:06 57000 -- (-1416.286) (-1418.257) (-1412.306) [-1413.407] * [-1412.608] (-1419.634) (-1415.583) (-1413.516) -- 0:01:06 57500 -- [-1411.679] (-1413.438) (-1414.405) (-1415.010) * [-1418.919] (-1421.837) (-1411.601) (-1414.769) -- 0:01:05 58000 -- (-1412.707) [-1411.746] (-1414.356) (-1412.993) * (-1416.052) [-1420.650] (-1411.973) (-1414.296) -- 0:01:04 58500 -- (-1411.129) (-1412.112) [-1414.406] (-1411.904) * (-1414.289) (-1417.761) [-1412.675] (-1418.063) -- 0:01:04 59000 -- (-1412.862) (-1415.078) [-1414.424] (-1416.767) * (-1413.729) (-1419.507) (-1415.184) [-1416.781] -- 0:01:03 59500 -- (-1411.954) (-1413.909) (-1414.482) [-1415.997] * (-1415.161) [-1416.922] (-1413.881) (-1415.575) -- 0:01:03 60000 -- (-1413.754) (-1413.741) (-1413.562) [-1415.375] * (-1414.225) [-1418.548] (-1416.232) (-1416.863) -- 0:01:02 Average standard deviation of split frequencies: 0.025642 60500 -- (-1413.251) (-1413.684) [-1415.185] (-1411.611) * [-1415.066] (-1424.750) (-1415.353) (-1413.352) -- 0:01:02 61000 -- (-1412.583) (-1412.439) [-1414.149] (-1412.801) * [-1414.038] (-1430.148) (-1414.776) (-1414.686) -- 0:01:01 61500 -- (-1414.924) [-1413.270] (-1414.150) (-1412.417) * (-1415.970) [-1419.029] (-1417.313) (-1416.871) -- 0:01:01 62000 -- (-1414.988) (-1412.710) (-1416.443) [-1411.082] * (-1415.882) [-1419.414] (-1412.632) (-1416.444) -- 0:01:00 62500 -- [-1415.166] (-1417.268) (-1414.212) (-1410.957) * (-1417.167) [-1424.381] (-1415.759) (-1414.575) -- 0:01:00 63000 -- (-1414.033) [-1412.456] (-1414.092) (-1415.094) * (-1414.337) [-1421.937] (-1415.236) (-1414.469) -- 0:00:59 63500 -- (-1414.394) (-1415.034) [-1413.930] (-1414.417) * [-1414.120] (-1422.890) (-1418.205) (-1412.426) -- 0:00:58 64000 -- [-1413.413] (-1413.206) (-1415.809) (-1413.808) * (-1416.393) [-1421.525] (-1416.520) (-1412.044) -- 0:00:58 64500 -- (-1413.096) (-1413.966) (-1417.604) [-1414.247] * [-1415.083] (-1419.633) (-1414.871) (-1416.291) -- 0:00:58 65000 -- (-1413.004) [-1413.446] (-1415.491) (-1417.422) * (-1414.446) [-1415.741] (-1416.985) (-1414.666) -- 0:00:57 Average standard deviation of split frequencies: 0.022108 65500 -- (-1412.806) (-1413.370) [-1414.090] (-1414.898) * (-1413.303) (-1432.283) [-1412.302] (-1415.527) -- 0:00:57 66000 -- [-1413.316] (-1414.766) (-1412.848) (-1414.002) * (-1412.462) [-1421.094] (-1413.243) (-1414.234) -- 0:00:56 66500 -- (-1414.484) [-1414.561] (-1412.172) (-1415.211) * (-1414.041) (-1424.970) (-1413.785) [-1414.768] -- 0:00:56 67000 -- (-1414.357) [-1412.837] (-1412.173) (-1415.334) * (-1413.822) [-1414.451] (-1414.129) (-1412.407) -- 0:00:55 67500 -- (-1411.977) (-1418.426) [-1411.598] (-1416.860) * [-1412.553] (-1420.111) (-1413.864) (-1412.631) -- 0:00:55 68000 -- (-1411.945) (-1419.633) (-1413.138) [-1415.543] * (-1412.867) [-1418.803] (-1414.455) (-1411.252) -- 0:00:54 68500 -- (-1412.812) (-1416.254) [-1414.163] (-1415.810) * (-1414.881) [-1422.741] (-1415.878) (-1412.004) -- 0:00:54 69000 -- (-1413.739) (-1413.906) [-1412.238] (-1416.639) * [-1414.234] (-1423.443) (-1418.051) (-1412.231) -- 0:00:53 69500 -- (-1412.309) (-1416.580) (-1412.927) [-1412.865] * [-1413.581] (-1424.168) (-1415.545) (-1412.520) -- 0:01:06 70000 -- [-1412.290] (-1413.837) (-1414.509) (-1415.004) * (-1414.991) [-1423.472] (-1417.910) (-1411.902) -- 0:01:06 Average standard deviation of split frequencies: 0.022014 70500 -- (-1414.167) [-1414.295] (-1415.371) (-1413.051) * (-1417.882) (-1425.923) (-1416.878) [-1411.133] -- 0:01:05 71000 -- (-1416.080) (-1413.403) [-1414.096] (-1411.681) * (-1412.223) (-1430.447) [-1412.783] (-1412.580) -- 0:01:05 71500 -- (-1414.079) (-1417.685) (-1413.994) [-1411.437] * [-1415.578] (-1424.707) (-1415.269) (-1415.012) -- 0:01:04 72000 -- (-1414.664) (-1413.115) (-1415.492) [-1411.577] * (-1416.350) (-1428.848) (-1413.518) [-1411.543] -- 0:01:04 72500 -- (-1412.296) (-1415.646) [-1418.775] (-1411.292) * [-1415.295] (-1426.010) (-1412.663) (-1412.033) -- 0:01:03 73000 -- (-1413.658) (-1414.849) [-1412.637] (-1411.655) * [-1415.863] (-1427.993) (-1420.252) (-1411.238) -- 0:01:03 73500 -- (-1412.790) (-1414.095) (-1412.749) [-1411.649] * (-1417.677) (-1424.852) [-1413.392] (-1412.620) -- 0:01:03 74000 -- (-1412.830) (-1413.016) [-1412.584] (-1416.758) * (-1414.499) (-1422.759) [-1413.041] (-1412.315) -- 0:01:02 74500 -- (-1419.150) [-1411.443] (-1415.373) (-1415.115) * (-1415.583) (-1422.363) [-1413.023] (-1415.472) -- 0:01:02 75000 -- (-1416.988) [-1411.649] (-1414.639) (-1414.583) * (-1415.356) [-1422.093] (-1419.438) (-1414.544) -- 0:01:01 Average standard deviation of split frequencies: 0.027749 75500 -- (-1414.712) [-1411.726] (-1414.423) (-1412.274) * (-1413.883) (-1423.331) (-1414.762) [-1418.065] -- 0:01:01 76000 -- (-1413.537) (-1412.038) (-1413.889) [-1411.774] * (-1416.637) (-1421.157) (-1414.503) [-1413.645] -- 0:01:00 76500 -- (-1413.582) [-1412.170] (-1413.406) (-1413.263) * (-1417.796) [-1418.348] (-1412.782) (-1412.644) -- 0:01:00 77000 -- (-1413.770) (-1414.084) (-1413.579) [-1413.673] * (-1413.134) [-1421.234] (-1412.934) (-1411.518) -- 0:00:59 77500 -- (-1411.751) [-1411.494] (-1413.233) (-1413.852) * (-1413.080) (-1421.663) [-1414.985] (-1413.500) -- 0:00:59 78000 -- (-1412.606) (-1412.354) [-1413.093] (-1414.777) * (-1418.273) (-1418.189) [-1413.457] (-1411.433) -- 0:00:59 78500 -- [-1414.851] (-1412.205) (-1413.179) (-1415.493) * (-1413.882) (-1415.823) (-1413.667) [-1411.017] -- 0:00:58 79000 -- [-1413.384] (-1417.134) (-1416.013) (-1412.664) * [-1414.376] (-1421.007) (-1411.979) (-1411.017) -- 0:00:58 79500 -- (-1412.887) [-1412.938] (-1412.525) (-1412.777) * [-1412.847] (-1428.331) (-1412.777) (-1415.817) -- 0:00:57 80000 -- (-1411.378) (-1414.936) [-1414.735] (-1413.863) * [-1413.201] (-1436.741) (-1412.915) (-1415.802) -- 0:00:57 Average standard deviation of split frequencies: 0.028124 80500 -- (-1411.379) (-1412.137) (-1412.304) [-1412.689] * (-1413.927) [-1419.774] (-1414.016) (-1414.855) -- 0:00:57 81000 -- (-1412.787) [-1413.480] (-1412.984) (-1412.023) * (-1413.062) (-1422.320) [-1411.857] (-1413.782) -- 0:00:56 81500 -- (-1414.371) (-1414.112) (-1413.952) [-1411.330] * [-1412.688] (-1423.016) (-1414.304) (-1412.872) -- 0:00:56 82000 -- (-1413.766) (-1415.846) [-1416.134] (-1417.813) * (-1413.003) (-1420.472) [-1413.836] (-1412.530) -- 0:00:55 82500 -- (-1414.675) (-1416.528) (-1414.825) [-1415.391] * (-1413.882) (-1416.894) [-1414.302] (-1413.061) -- 0:00:55 83000 -- (-1411.150) (-1414.195) (-1413.624) [-1414.000] * [-1416.241] (-1418.064) (-1414.509) (-1412.849) -- 0:00:55 83500 -- (-1411.200) (-1412.462) [-1414.575] (-1414.997) * (-1413.361) (-1421.774) [-1414.021] (-1412.269) -- 0:00:54 84000 -- (-1415.335) [-1412.179] (-1412.156) (-1414.795) * [-1413.695] (-1417.740) (-1413.332) (-1412.097) -- 0:00:54 84500 -- (-1413.104) (-1412.568) (-1415.887) [-1413.892] * (-1413.840) (-1424.735) (-1412.600) [-1412.103] -- 0:00:54 85000 -- (-1412.747) (-1416.681) (-1415.072) [-1412.078] * [-1412.869] (-1419.127) (-1412.721) (-1412.170) -- 0:00:53 Average standard deviation of split frequencies: 0.021349 85500 -- (-1413.111) (-1413.528) (-1412.880) [-1412.539] * [-1411.594] (-1419.061) (-1414.597) (-1413.356) -- 0:01:04 86000 -- (-1413.327) (-1412.202) (-1412.873) [-1413.238] * (-1411.475) (-1420.298) (-1413.690) [-1414.127] -- 0:01:03 86500 -- (-1415.565) (-1414.975) [-1414.713] (-1413.560) * [-1411.767] (-1421.687) (-1414.550) (-1414.338) -- 0:01:03 87000 -- [-1415.599] (-1415.130) (-1414.083) (-1412.382) * (-1411.245) (-1420.167) [-1412.069] (-1413.302) -- 0:01:02 87500 -- [-1416.175] (-1412.876) (-1413.181) (-1411.115) * [-1411.256] (-1422.597) (-1412.262) (-1413.637) -- 0:01:02 88000 -- (-1413.504) [-1412.454] (-1414.468) (-1412.656) * (-1411.931) (-1423.248) (-1413.176) [-1415.200] -- 0:01:02 88500 -- [-1413.317] (-1412.487) (-1413.329) (-1412.255) * (-1412.151) (-1421.581) [-1413.454] (-1414.773) -- 0:01:01 89000 -- (-1411.797) (-1413.059) [-1412.604] (-1415.055) * [-1411.239] (-1426.952) (-1416.536) (-1418.538) -- 0:01:01 89500 -- (-1412.054) (-1413.335) (-1412.948) [-1413.687] * [-1411.191] (-1422.447) (-1411.452) (-1419.475) -- 0:01:01 90000 -- [-1412.395] (-1414.928) (-1412.530) (-1412.679) * [-1412.365] (-1420.062) (-1411.452) (-1413.230) -- 0:01:00 Average standard deviation of split frequencies: 0.025419 90500 -- [-1414.369] (-1413.386) (-1412.630) (-1413.776) * (-1415.940) [-1419.092] (-1414.115) (-1416.565) -- 0:01:00 91000 -- (-1415.960) [-1414.292] (-1413.466) (-1412.405) * (-1414.147) (-1429.190) [-1413.794] (-1416.723) -- 0:00:59 91500 -- (-1413.142) [-1416.432] (-1413.378) (-1412.749) * (-1411.468) (-1419.279) (-1414.163) [-1419.042] -- 0:00:59 92000 -- (-1417.996) (-1415.134) (-1412.420) [-1411.422] * [-1413.427] (-1420.196) (-1412.705) (-1415.401) -- 0:00:59 92500 -- (-1415.432) (-1413.731) [-1412.152] (-1414.559) * (-1411.936) (-1421.795) [-1411.982] (-1412.578) -- 0:00:58 93000 -- (-1416.974) (-1413.709) [-1411.965] (-1417.905) * (-1415.788) (-1423.557) (-1413.189) [-1413.446] -- 0:00:58 93500 -- (-1415.228) (-1412.875) (-1411.911) [-1416.397] * (-1412.716) [-1426.919] (-1412.365) (-1414.098) -- 0:00:58 94000 -- (-1415.121) (-1414.738) [-1412.622] (-1415.070) * (-1415.307) [-1421.643] (-1412.701) (-1414.627) -- 0:00:57 94500 -- (-1415.762) (-1413.752) (-1415.302) [-1414.773] * (-1413.438) [-1423.201] (-1412.309) (-1412.966) -- 0:00:57 95000 -- (-1417.807) [-1413.895] (-1412.368) (-1415.283) * (-1412.801) (-1428.391) (-1412.988) [-1412.265] -- 0:00:57 Average standard deviation of split frequencies: 0.025130 95500 -- [-1414.302] (-1413.180) (-1414.649) (-1417.107) * [-1412.894] (-1421.974) (-1413.018) (-1412.479) -- 0:00:56 96000 -- (-1411.649) (-1415.105) (-1414.409) [-1420.203] * (-1412.484) [-1420.232] (-1416.003) (-1412.496) -- 0:00:56 96500 -- (-1411.784) (-1414.707) [-1413.284] (-1415.679) * [-1411.370] (-1420.947) (-1416.003) (-1415.034) -- 0:00:56 97000 -- (-1415.634) (-1412.986) (-1411.368) [-1413.777] * (-1411.945) (-1426.691) [-1413.318] (-1419.592) -- 0:00:55 97500 -- (-1415.364) (-1415.303) (-1413.546) [-1411.835] * [-1413.819] (-1425.149) (-1412.923) (-1416.403) -- 0:00:55 98000 -- (-1414.739) (-1415.400) [-1414.294] (-1411.840) * (-1412.328) (-1415.386) [-1412.102] (-1412.598) -- 0:00:55 98500 -- (-1411.260) (-1411.965) [-1415.615] (-1413.865) * (-1411.703) (-1415.582) (-1413.288) [-1413.374] -- 0:00:54 99000 -- (-1411.429) [-1420.795] (-1414.002) (-1414.065) * (-1411.324) [-1417.331] (-1412.424) (-1412.528) -- 0:00:54 99500 -- (-1411.820) [-1419.059] (-1418.971) (-1414.515) * (-1415.699) (-1416.226) [-1414.141] (-1413.046) -- 0:00:54 100000 -- (-1412.272) (-1413.003) [-1414.566] (-1416.319) * (-1417.288) (-1414.379) (-1412.033) [-1413.079] -- 0:00:54 Average standard deviation of split frequencies: 0.023674 100500 -- (-1412.951) (-1411.950) [-1414.937] (-1413.722) * (-1419.714) (-1413.868) (-1414.268) [-1412.776] -- 0:00:53 101000 -- (-1414.336) [-1412.243] (-1412.046) (-1413.246) * (-1414.331) (-1417.749) (-1411.599) [-1413.830] -- 0:01:02 101500 -- [-1413.698] (-1413.039) (-1412.625) (-1413.054) * (-1415.196) (-1412.352) [-1413.348] (-1411.527) -- 0:01:01 102000 -- (-1411.864) [-1412.303] (-1412.361) (-1413.043) * (-1413.781) [-1411.698] (-1411.638) (-1414.801) -- 0:01:01 102500 -- (-1417.817) (-1412.668) (-1412.980) [-1414.311] * (-1412.905) [-1413.571] (-1411.601) (-1414.575) -- 0:01:01 103000 -- (-1412.888) (-1411.895) (-1419.316) [-1413.294] * [-1413.403] (-1413.938) (-1411.632) (-1411.600) -- 0:01:00 103500 -- (-1414.413) (-1412.802) (-1415.761) [-1412.580] * [-1412.061] (-1415.555) (-1412.248) (-1415.144) -- 0:01:00 104000 -- (-1413.748) [-1416.765] (-1414.802) (-1416.470) * (-1413.058) (-1414.128) [-1413.061] (-1413.572) -- 0:01:00 104500 -- [-1414.613] (-1415.727) (-1411.646) (-1411.450) * (-1414.127) (-1412.126) (-1411.777) [-1413.115] -- 0:00:59 105000 -- (-1412.419) (-1414.790) (-1414.016) [-1411.702] * (-1413.247) [-1411.829] (-1414.165) (-1415.271) -- 0:00:59 Average standard deviation of split frequencies: 0.021569 105500 -- (-1412.679) (-1418.795) (-1412.138) [-1415.872] * (-1415.413) (-1412.824) [-1413.661] (-1416.051) -- 0:00:59 106000 -- [-1411.629] (-1414.190) (-1412.973) (-1412.072) * (-1416.282) (-1413.024) (-1412.540) [-1415.597] -- 0:00:59 106500 -- (-1414.807) (-1415.101) (-1411.741) [-1411.644] * [-1414.074] (-1419.329) (-1412.943) (-1417.080) -- 0:00:58 107000 -- [-1413.435] (-1418.156) (-1411.647) (-1412.608) * (-1413.535) (-1413.932) [-1413.650] (-1413.902) -- 0:00:58 107500 -- (-1416.080) (-1416.522) [-1412.848] (-1411.965) * [-1411.325] (-1415.531) (-1414.761) (-1413.643) -- 0:00:58 108000 -- (-1415.823) (-1414.909) [-1412.897] (-1413.585) * (-1411.329) [-1413.898] (-1412.941) (-1415.901) -- 0:00:57 108500 -- [-1413.285] (-1414.934) (-1413.915) (-1411.098) * (-1412.180) (-1415.130) [-1412.476] (-1415.131) -- 0:00:57 109000 -- (-1413.302) [-1414.543] (-1413.992) (-1411.098) * [-1412.011] (-1415.192) (-1413.512) (-1414.563) -- 0:00:57 109500 -- [-1415.949] (-1413.913) (-1413.260) (-1411.537) * (-1415.561) (-1420.180) (-1417.270) [-1412.802] -- 0:00:56 110000 -- (-1414.326) (-1412.742) (-1414.592) [-1411.769] * (-1411.522) (-1416.491) [-1414.345] (-1414.969) -- 0:00:56 Average standard deviation of split frequencies: 0.022868 110500 -- (-1413.165) [-1413.760] (-1417.279) (-1412.836) * (-1413.607) (-1414.559) (-1412.942) [-1415.589] -- 0:00:56 111000 -- (-1413.038) (-1414.127) (-1414.016) [-1412.682] * (-1412.962) [-1413.991] (-1415.892) (-1412.176) -- 0:00:56 111500 -- (-1413.671) [-1412.207] (-1413.056) (-1413.413) * (-1413.988) (-1415.188) [-1416.442] (-1412.479) -- 0:00:55 112000 -- (-1412.922) (-1412.854) (-1412.847) [-1413.950] * (-1412.192) [-1412.234] (-1416.282) (-1413.391) -- 0:00:55 112500 -- [-1414.332] (-1419.567) (-1413.797) (-1411.265) * (-1413.867) [-1414.646] (-1420.055) (-1411.930) -- 0:00:55 113000 -- (-1413.237) [-1415.047] (-1413.825) (-1411.419) * (-1413.615) (-1411.566) [-1418.584] (-1415.608) -- 0:00:54 113500 -- [-1413.348] (-1416.457) (-1415.469) (-1411.328) * (-1415.760) [-1412.288] (-1417.973) (-1414.840) -- 0:00:54 114000 -- (-1413.355) [-1414.437] (-1415.006) (-1411.530) * (-1414.833) [-1414.014] (-1417.428) (-1411.923) -- 0:00:54 114500 -- (-1412.780) [-1414.637] (-1414.456) (-1411.314) * (-1413.220) [-1414.583] (-1412.862) (-1411.763) -- 0:00:54 115000 -- (-1418.063) (-1414.055) (-1412.043) [-1411.360] * [-1412.219] (-1412.629) (-1413.586) (-1411.617) -- 0:00:53 Average standard deviation of split frequencies: 0.025452 115500 -- [-1414.535] (-1413.783) (-1412.582) (-1412.704) * [-1412.816] (-1411.727) (-1413.578) (-1416.239) -- 0:00:53 116000 -- (-1413.812) (-1413.103) (-1412.679) [-1412.927] * [-1412.741] (-1411.665) (-1414.134) (-1411.581) -- 0:00:53 116500 -- (-1411.631) (-1413.295) [-1412.859] (-1413.485) * (-1414.550) [-1414.182] (-1413.567) (-1411.942) -- 0:00:53 117000 -- (-1414.750) [-1413.118] (-1413.702) (-1412.618) * [-1414.386] (-1413.677) (-1414.465) (-1411.717) -- 0:01:00 117500 -- (-1413.908) [-1413.253] (-1413.371) (-1412.618) * [-1413.839] (-1412.344) (-1413.459) (-1412.398) -- 0:01:00 118000 -- (-1412.893) [-1413.477] (-1413.683) (-1412.618) * (-1411.218) [-1411.599] (-1413.958) (-1413.075) -- 0:00:59 118500 -- [-1412.100] (-1413.342) (-1413.662) (-1413.241) * (-1412.768) (-1411.734) [-1411.590] (-1413.274) -- 0:00:59 119000 -- (-1413.662) [-1411.623] (-1413.751) (-1415.099) * (-1411.180) (-1413.311) (-1411.196) [-1412.147] -- 0:00:59 119500 -- (-1413.971) (-1413.760) [-1412.312] (-1412.390) * (-1411.400) [-1413.334] (-1412.578) (-1411.523) -- 0:00:58 120000 -- [-1413.323] (-1412.612) (-1411.814) (-1414.217) * (-1413.898) (-1412.062) [-1411.767] (-1413.846) -- 0:00:58 Average standard deviation of split frequencies: 0.027564 120500 -- (-1413.236) (-1413.924) (-1413.110) [-1413.447] * (-1413.085) [-1411.743] (-1412.762) (-1414.384) -- 0:00:58 121000 -- (-1414.193) [-1412.070] (-1413.896) (-1415.737) * (-1413.406) (-1413.420) (-1411.823) [-1414.719] -- 0:00:58 121500 -- (-1416.397) (-1411.952) [-1412.886] (-1412.668) * (-1416.170) (-1413.858) [-1411.899] (-1413.069) -- 0:00:57 122000 -- (-1413.163) (-1411.177) (-1414.315) [-1412.242] * (-1413.270) (-1413.410) (-1414.402) [-1411.309] -- 0:00:57 122500 -- [-1412.991] (-1412.458) (-1412.340) (-1416.230) * (-1413.394) [-1412.945] (-1415.531) (-1413.522) -- 0:00:57 123000 -- (-1415.213) [-1414.349] (-1412.277) (-1416.352) * [-1413.109] (-1415.633) (-1415.771) (-1413.995) -- 0:00:57 123500 -- (-1412.452) (-1413.341) (-1414.294) [-1412.212] * (-1412.612) (-1412.756) (-1415.730) [-1413.036] -- 0:00:56 124000 -- (-1413.521) (-1413.455) [-1412.380] (-1413.872) * (-1411.808) (-1415.087) (-1414.708) [-1415.545] -- 0:00:56 124500 -- (-1412.944) (-1413.956) (-1412.477) [-1411.499] * (-1413.093) [-1413.375] (-1415.042) (-1415.596) -- 0:00:56 125000 -- (-1412.353) (-1413.750) (-1411.803) [-1411.757] * (-1411.124) (-1413.416) [-1416.724] (-1412.005) -- 0:00:56 Average standard deviation of split frequencies: 0.025254 125500 -- (-1412.924) [-1414.843] (-1412.281) (-1413.324) * [-1411.488] (-1413.388) (-1420.644) (-1411.378) -- 0:00:55 126000 -- (-1412.871) (-1415.764) (-1411.270) [-1412.590] * (-1412.210) (-1411.777) (-1411.450) [-1412.181] -- 0:00:55 126500 -- (-1416.610) (-1413.871) [-1411.396] (-1413.703) * (-1412.607) (-1411.783) (-1411.846) [-1411.266] -- 0:00:55 127000 -- (-1412.389) (-1413.318) [-1414.835] (-1413.266) * (-1413.115) (-1413.991) (-1415.673) [-1412.069] -- 0:00:54 127500 -- [-1412.661] (-1413.335) (-1415.097) (-1413.239) * (-1411.919) (-1414.538) [-1413.804] (-1412.069) -- 0:00:54 128000 -- (-1412.872) (-1414.313) [-1413.707] (-1412.329) * (-1413.529) (-1413.372) (-1412.750) [-1411.973] -- 0:00:54 128500 -- (-1414.050) (-1415.320) (-1412.725) [-1415.357] * [-1411.710] (-1414.976) (-1415.340) (-1412.484) -- 0:00:54 129000 -- [-1413.618] (-1415.374) (-1413.616) (-1417.005) * (-1412.286) (-1414.464) (-1414.185) [-1412.180] -- 0:00:54 129500 -- (-1415.675) (-1417.058) (-1412.386) [-1415.444] * [-1411.274] (-1413.492) (-1413.127) (-1411.760) -- 0:00:53 130000 -- (-1415.435) (-1415.729) (-1413.460) [-1412.504] * (-1413.668) [-1414.285] (-1420.359) (-1411.525) -- 0:00:53 Average standard deviation of split frequencies: 0.024352 130500 -- [-1412.074] (-1415.219) (-1417.431) (-1415.204) * (-1412.882) [-1411.735] (-1415.597) (-1414.102) -- 0:00:53 131000 -- (-1414.508) (-1419.503) [-1414.642] (-1411.873) * (-1412.737) (-1412.721) [-1415.604] (-1416.032) -- 0:00:53 131500 -- (-1413.408) (-1412.563) [-1412.673] (-1414.631) * (-1412.385) [-1411.966] (-1413.770) (-1415.652) -- 0:00:52 132000 -- (-1415.101) (-1412.206) [-1413.841] (-1413.821) * [-1413.463] (-1413.932) (-1413.895) (-1413.695) -- 0:00:52 132500 -- (-1412.202) [-1412.041] (-1413.221) (-1412.428) * (-1412.678) (-1413.351) (-1413.550) [-1414.285] -- 0:00:52 133000 -- (-1413.212) (-1411.526) (-1413.133) [-1412.299] * [-1412.632] (-1413.616) (-1412.325) (-1416.111) -- 0:00:58 133500 -- (-1412.960) (-1411.999) [-1412.463] (-1412.315) * [-1411.073] (-1412.367) (-1412.435) (-1416.327) -- 0:00:58 134000 -- (-1412.564) (-1413.620) (-1412.463) [-1414.342] * (-1413.051) [-1412.472] (-1411.760) (-1416.204) -- 0:00:58 134500 -- (-1413.893) [-1412.169] (-1413.303) (-1414.210) * [-1413.018] (-1415.588) (-1417.684) (-1416.294) -- 0:00:57 135000 -- (-1413.290) [-1412.179] (-1412.542) (-1418.104) * [-1415.726] (-1411.497) (-1416.454) (-1416.535) -- 0:00:57 Average standard deviation of split frequencies: 0.024594 135500 -- (-1414.206) (-1411.976) (-1415.234) [-1412.931] * (-1415.180) [-1413.016] (-1412.935) (-1412.701) -- 0:00:57 136000 -- [-1413.074] (-1412.916) (-1413.255) (-1414.518) * (-1411.506) (-1412.020) (-1413.364) [-1412.341] -- 0:00:57 136500 -- [-1411.940] (-1412.701) (-1413.333) (-1417.051) * (-1411.667) [-1411.621] (-1415.213) (-1413.122) -- 0:00:56 137000 -- [-1411.940] (-1412.403) (-1413.225) (-1419.825) * (-1412.206) (-1413.647) (-1411.464) [-1412.412] -- 0:00:56 137500 -- (-1411.939) (-1412.920) [-1412.476] (-1417.739) * [-1414.460] (-1413.866) (-1412.938) (-1412.264) -- 0:00:56 138000 -- (-1412.100) (-1413.008) [-1413.032] (-1417.994) * (-1414.083) (-1414.851) (-1412.780) [-1413.048] -- 0:00:56 138500 -- (-1411.053) (-1412.750) [-1414.594] (-1418.025) * (-1414.294) [-1413.990] (-1413.292) (-1412.412) -- 0:00:55 139000 -- [-1414.128] (-1414.502) (-1411.778) (-1415.928) * (-1413.210) (-1413.337) [-1412.194] (-1412.674) -- 0:00:55 139500 -- (-1414.470) (-1413.191) (-1414.604) [-1413.093] * [-1411.118] (-1413.262) (-1413.885) (-1413.233) -- 0:00:55 140000 -- (-1411.449) [-1415.108] (-1414.970) (-1413.728) * (-1415.819) [-1414.808] (-1411.831) (-1413.449) -- 0:00:55 Average standard deviation of split frequencies: 0.025804 140500 -- (-1414.551) (-1415.274) (-1413.411) [-1411.728] * (-1412.183) (-1413.555) [-1411.384] (-1415.657) -- 0:00:55 141000 -- (-1415.090) (-1413.008) (-1417.128) [-1411.991] * [-1414.869] (-1411.756) (-1412.048) (-1415.336) -- 0:00:54 141500 -- (-1413.137) (-1413.145) (-1414.376) [-1412.664] * [-1415.271] (-1412.766) (-1416.753) (-1412.771) -- 0:00:54 142000 -- (-1413.410) (-1413.873) (-1417.467) [-1412.670] * (-1412.195) (-1412.570) [-1416.544] (-1413.730) -- 0:00:54 142500 -- (-1412.956) (-1414.114) (-1413.296) [-1411.901] * (-1414.426) [-1413.110] (-1412.841) (-1414.350) -- 0:00:54 143000 -- (-1411.470) [-1413.790] (-1415.513) (-1412.428) * (-1411.259) (-1415.115) [-1412.927] (-1413.160) -- 0:00:53 143500 -- (-1412.071) (-1415.067) (-1413.248) [-1413.538] * [-1411.258] (-1412.996) (-1413.231) (-1412.786) -- 0:00:53 144000 -- (-1411.722) (-1412.387) [-1413.128] (-1413.534) * (-1413.792) (-1412.290) (-1413.084) [-1411.838] -- 0:00:53 144500 -- [-1413.168] (-1412.516) (-1417.670) (-1413.760) * (-1413.272) (-1412.351) (-1412.218) [-1411.058] -- 0:00:53 145000 -- (-1412.146) (-1415.147) [-1413.035] (-1411.474) * (-1415.177) (-1411.457) (-1411.912) [-1412.956] -- 0:00:53 Average standard deviation of split frequencies: 0.026138 145500 -- (-1413.854) [-1416.341] (-1412.428) (-1411.509) * (-1413.468) [-1411.430] (-1412.563) (-1412.966) -- 0:00:52 146000 -- (-1413.819) (-1417.946) (-1414.285) [-1411.158] * (-1417.426) (-1412.943) [-1413.770] (-1414.261) -- 0:00:52 146500 -- (-1412.581) [-1416.602] (-1416.214) (-1411.072) * (-1415.355) [-1415.256] (-1416.858) (-1413.085) -- 0:00:52 147000 -- (-1415.702) (-1417.447) (-1415.261) [-1411.014] * [-1416.162] (-1414.583) (-1412.953) (-1415.490) -- 0:00:52 147500 -- (-1416.518) (-1412.622) (-1411.683) [-1418.144] * (-1415.454) (-1412.028) (-1411.964) [-1416.968] -- 0:00:52 148000 -- (-1415.006) [-1411.394] (-1412.325) (-1411.967) * (-1412.681) (-1412.348) [-1411.615] (-1414.095) -- 0:00:51 148500 -- (-1413.178) [-1412.606] (-1412.699) (-1412.678) * (-1415.411) [-1412.013] (-1412.792) (-1412.052) -- 0:00:57 149000 -- (-1414.005) (-1414.915) (-1412.849) [-1411.205] * [-1414.846] (-1413.407) (-1412.430) (-1412.287) -- 0:00:57 149500 -- (-1414.531) (-1414.759) (-1417.628) [-1411.764] * (-1414.117) (-1412.482) (-1414.089) [-1413.891] -- 0:00:56 150000 -- (-1412.683) (-1413.905) (-1413.025) [-1414.879] * [-1413.059] (-1418.173) (-1413.590) (-1412.137) -- 0:00:56 Average standard deviation of split frequencies: 0.026222 150500 -- (-1411.884) (-1413.149) (-1412.974) [-1417.341] * (-1413.091) (-1412.894) [-1416.275] (-1412.732) -- 0:00:56 151000 -- (-1414.211) (-1416.476) [-1412.479] (-1416.414) * [-1413.542] (-1412.866) (-1418.171) (-1412.893) -- 0:00:56 151500 -- [-1415.281] (-1418.073) (-1412.055) (-1412.096) * (-1411.802) (-1413.701) (-1416.461) [-1412.811] -- 0:00:56 152000 -- (-1414.651) (-1417.461) (-1412.901) [-1412.838] * (-1414.811) [-1415.302] (-1411.767) (-1413.015) -- 0:00:55 152500 -- [-1416.101] (-1418.757) (-1413.051) (-1414.096) * (-1413.767) [-1413.650] (-1411.783) (-1413.166) -- 0:00:55 153000 -- [-1413.480] (-1414.762) (-1413.241) (-1414.345) * (-1413.979) (-1413.786) (-1411.971) [-1413.961] -- 0:00:55 153500 -- (-1416.388) (-1415.952) (-1415.849) [-1413.913] * [-1413.090] (-1414.024) (-1412.821) (-1414.124) -- 0:00:55 154000 -- (-1413.715) (-1413.713) (-1411.380) [-1413.207] * (-1415.218) (-1414.691) (-1414.317) [-1412.563] -- 0:00:54 154500 -- (-1412.520) [-1413.746] (-1413.865) (-1415.406) * (-1413.876) (-1412.943) [-1412.955] (-1412.936) -- 0:00:54 155000 -- [-1413.804] (-1413.086) (-1412.285) (-1411.866) * [-1411.747] (-1415.315) (-1414.674) (-1414.693) -- 0:00:54 Average standard deviation of split frequencies: 0.025837 155500 -- (-1412.667) (-1413.566) [-1412.246] (-1411.831) * [-1412.417] (-1415.060) (-1413.773) (-1415.998) -- 0:00:54 156000 -- (-1415.147) [-1413.245] (-1412.246) (-1413.423) * (-1412.817) [-1411.696] (-1413.789) (-1412.712) -- 0:00:54 156500 -- (-1414.739) (-1411.578) [-1411.388] (-1412.501) * (-1411.109) [-1413.301] (-1412.808) (-1412.483) -- 0:00:53 157000 -- (-1413.283) (-1412.883) [-1411.629] (-1412.338) * (-1411.373) [-1413.958] (-1412.399) (-1412.312) -- 0:00:53 157500 -- (-1415.095) (-1412.102) (-1413.142) [-1412.119] * [-1411.021] (-1414.098) (-1412.688) (-1412.765) -- 0:00:53 158000 -- (-1414.330) (-1415.085) (-1414.656) [-1413.960] * (-1411.983) (-1414.045) [-1412.145] (-1414.073) -- 0:00:53 158500 -- (-1413.521) [-1413.127] (-1415.208) (-1411.810) * (-1412.808) [-1413.899] (-1412.213) (-1417.837) -- 0:00:53 159000 -- [-1412.429] (-1411.375) (-1415.975) (-1412.563) * (-1416.564) (-1414.723) (-1412.986) [-1414.193] -- 0:00:52 159500 -- (-1412.614) (-1411.416) (-1414.239) [-1412.112] * (-1415.273) [-1412.997] (-1412.341) (-1415.002) -- 0:00:52 160000 -- (-1411.865) (-1413.629) [-1412.955] (-1415.076) * (-1415.519) (-1415.729) (-1417.771) [-1413.146] -- 0:00:52 Average standard deviation of split frequencies: 0.023913 160500 -- (-1412.096) (-1416.356) [-1413.113] (-1412.805) * (-1418.675) (-1419.339) (-1417.189) [-1413.577] -- 0:00:52 161000 -- [-1412.625] (-1414.740) (-1414.424) (-1412.637) * (-1413.687) (-1417.874) (-1416.401) [-1414.505] -- 0:00:52 161500 -- (-1413.910) (-1412.767) (-1413.710) [-1411.799] * [-1412.408] (-1415.561) (-1414.820) (-1415.049) -- 0:00:51 162000 -- (-1412.447) (-1412.931) (-1414.336) [-1413.484] * (-1411.983) (-1415.498) [-1414.541] (-1412.850) -- 0:00:51 162500 -- (-1412.404) [-1412.610] (-1414.957) (-1413.005) * [-1412.856] (-1415.882) (-1416.639) (-1412.644) -- 0:00:51 163000 -- (-1411.747) [-1412.916] (-1415.091) (-1414.305) * (-1411.919) (-1415.973) [-1414.907] (-1412.943) -- 0:00:51 163500 -- [-1412.030] (-1412.152) (-1412.136) (-1413.200) * (-1411.919) (-1415.334) [-1415.096] (-1413.660) -- 0:00:51 164000 -- (-1414.314) [-1411.368] (-1411.626) (-1411.774) * (-1413.162) (-1415.930) (-1412.375) [-1412.626] -- 0:00:50 164500 -- (-1412.023) [-1411.612] (-1413.375) (-1415.874) * (-1412.473) (-1415.436) [-1415.172] (-1414.178) -- 0:00:55 165000 -- (-1412.129) [-1411.419] (-1414.128) (-1414.167) * (-1412.002) (-1413.249) (-1412.879) [-1413.313] -- 0:00:55 Average standard deviation of split frequencies: 0.024882 165500 -- (-1411.908) [-1411.271] (-1415.173) (-1418.507) * (-1413.715) [-1411.915] (-1414.647) (-1415.386) -- 0:00:55 166000 -- (-1415.285) (-1416.715) (-1413.984) [-1420.364] * (-1413.501) (-1413.607) [-1412.881] (-1414.117) -- 0:00:55 166500 -- (-1415.253) [-1412.064] (-1413.352) (-1412.388) * [-1412.790] (-1412.433) (-1413.393) (-1414.163) -- 0:00:55 167000 -- (-1415.185) (-1414.015) (-1415.456) [-1411.881] * (-1414.481) (-1413.107) (-1412.536) [-1413.626] -- 0:00:54 167500 -- (-1412.213) [-1414.203] (-1413.782) (-1412.846) * [-1413.094] (-1411.287) (-1412.780) (-1417.048) -- 0:00:54 168000 -- (-1413.548) (-1416.565) [-1413.202] (-1411.835) * [-1413.454] (-1411.339) (-1411.186) (-1412.476) -- 0:00:54 168500 -- (-1413.411) (-1413.602) (-1413.300) [-1411.897] * [-1415.723] (-1411.249) (-1413.971) (-1412.243) -- 0:00:54 169000 -- (-1411.951) (-1414.646) [-1414.468] (-1414.832) * (-1414.019) (-1413.293) [-1412.504] (-1412.370) -- 0:00:54 169500 -- (-1412.574) [-1418.171] (-1414.926) (-1411.788) * (-1411.639) (-1413.293) [-1414.051] (-1415.705) -- 0:00:53 170000 -- (-1411.939) (-1415.070) (-1416.136) [-1412.877] * (-1411.788) [-1411.079] (-1416.854) (-1412.845) -- 0:00:53 Average standard deviation of split frequencies: 0.022492 170500 -- [-1411.362] (-1413.123) (-1420.413) (-1414.257) * [-1413.884] (-1413.743) (-1415.505) (-1412.678) -- 0:00:53 171000 -- (-1413.016) [-1413.618] (-1417.240) (-1414.538) * (-1414.134) (-1415.735) [-1418.885] (-1411.961) -- 0:00:53 171500 -- [-1412.060] (-1414.056) (-1415.237) (-1414.022) * (-1412.933) [-1413.742] (-1421.863) (-1412.895) -- 0:00:53 172000 -- (-1412.662) (-1411.946) (-1412.969) [-1412.471] * (-1412.826) [-1412.100] (-1420.576) (-1413.232) -- 0:00:52 172500 -- (-1413.348) (-1411.394) [-1413.035] (-1412.459) * [-1417.124] (-1412.165) (-1423.711) (-1413.073) -- 0:00:52 173000 -- (-1415.167) [-1411.592] (-1414.820) (-1416.793) * (-1415.157) (-1412.605) (-1419.651) [-1414.230] -- 0:00:52 173500 -- [-1412.862] (-1414.008) (-1418.471) (-1413.017) * (-1415.708) (-1412.523) [-1412.406] (-1412.732) -- 0:00:52 174000 -- (-1412.822) (-1413.659) (-1421.252) [-1416.021] * (-1413.541) (-1412.470) [-1412.379] (-1413.237) -- 0:00:52 174500 -- (-1414.489) (-1411.023) [-1413.509] (-1412.809) * (-1414.237) (-1412.748) (-1412.713) [-1412.643] -- 0:00:52 175000 -- (-1413.310) (-1413.903) (-1416.031) [-1414.030] * (-1412.598) (-1413.599) (-1413.275) [-1412.551] -- 0:00:51 Average standard deviation of split frequencies: 0.019877 175500 -- (-1416.011) [-1411.198] (-1413.688) (-1416.969) * (-1415.436) [-1411.355] (-1415.093) (-1412.580) -- 0:00:51 176000 -- [-1411.407] (-1411.792) (-1414.150) (-1412.923) * (-1416.012) [-1413.788] (-1413.131) (-1413.366) -- 0:00:51 176500 -- [-1412.489] (-1411.640) (-1413.431) (-1412.352) * [-1413.987] (-1412.168) (-1416.983) (-1414.238) -- 0:00:51 177000 -- (-1415.271) (-1411.368) [-1410.904] (-1414.211) * (-1418.382) (-1411.725) (-1415.402) [-1416.393] -- 0:00:51 177500 -- (-1412.602) (-1411.894) [-1411.753] (-1412.071) * (-1417.309) [-1413.896] (-1415.958) (-1412.511) -- 0:00:50 178000 -- (-1412.856) (-1413.687) [-1411.665] (-1412.322) * (-1419.794) (-1413.821) [-1415.321] (-1411.776) -- 0:00:50 178500 -- [-1413.387] (-1412.357) (-1412.612) (-1414.456) * (-1417.831) (-1413.875) (-1414.898) [-1412.648] -- 0:00:50 179000 -- [-1414.032] (-1411.285) (-1413.267) (-1415.653) * (-1412.003) (-1412.674) [-1414.220] (-1413.064) -- 0:00:50 179500 -- (-1413.509) (-1411.530) (-1411.662) [-1413.657] * (-1411.869) (-1411.828) (-1414.219) [-1412.421] -- 0:00:54 180000 -- (-1412.451) (-1412.451) [-1412.787] (-1419.657) * (-1411.812) (-1411.846) (-1415.722) [-1414.915] -- 0:00:54 Average standard deviation of split frequencies: 0.018951 180500 -- (-1413.293) (-1412.425) (-1414.860) [-1413.712] * (-1413.871) (-1412.602) (-1414.520) [-1416.185] -- 0:00:54 181000 -- [-1412.216] (-1411.860) (-1414.245) (-1414.889) * (-1413.060) (-1412.007) [-1417.349] (-1414.166) -- 0:00:54 181500 -- (-1413.841) [-1413.507] (-1416.562) (-1412.427) * (-1413.301) (-1411.597) (-1413.086) [-1413.208] -- 0:00:54 182000 -- (-1412.792) (-1415.018) (-1416.364) [-1414.264] * (-1412.624) [-1411.991] (-1412.306) (-1413.799) -- 0:00:53 182500 -- [-1415.101] (-1411.536) (-1414.135) (-1412.862) * [-1411.499] (-1414.071) (-1411.873) (-1412.121) -- 0:00:53 183000 -- (-1417.132) [-1412.820] (-1413.858) (-1413.183) * (-1411.452) (-1414.082) [-1411.605] (-1411.908) -- 0:00:53 183500 -- (-1412.581) (-1413.714) [-1413.648] (-1412.669) * [-1412.062] (-1412.947) (-1413.343) (-1412.533) -- 0:00:53 184000 -- (-1412.343) (-1411.961) [-1411.892] (-1412.882) * (-1412.647) (-1411.591) (-1416.324) [-1412.533] -- 0:00:53 184500 -- (-1412.491) [-1412.607] (-1412.189) (-1411.812) * (-1412.347) [-1413.300] (-1415.266) (-1413.009) -- 0:00:53 185000 -- (-1412.628) (-1412.379) (-1412.570) [-1414.939] * [-1412.489] (-1413.706) (-1416.639) (-1413.099) -- 0:00:52 Average standard deviation of split frequencies: 0.021036 185500 -- (-1415.120) (-1413.360) [-1412.706] (-1413.466) * (-1412.613) [-1412.468] (-1413.917) (-1415.472) -- 0:00:52 186000 -- (-1412.852) (-1417.000) [-1412.753] (-1418.579) * (-1412.911) [-1411.668] (-1411.651) (-1414.907) -- 0:00:52 186500 -- (-1414.855) (-1414.395) (-1413.753) [-1413.196] * (-1412.174) [-1411.642] (-1411.620) (-1417.739) -- 0:00:52 187000 -- [-1414.553] (-1413.967) (-1412.478) (-1413.755) * (-1412.428) [-1411.648] (-1412.035) (-1416.759) -- 0:00:52 187500 -- (-1412.304) (-1415.368) (-1417.235) [-1412.677] * (-1412.611) (-1411.947) [-1413.047] (-1415.345) -- 0:00:52 188000 -- (-1414.205) (-1414.002) [-1413.561] (-1411.845) * (-1413.361) (-1413.299) (-1418.286) [-1418.396] -- 0:00:51 188500 -- [-1411.834] (-1413.012) (-1412.683) (-1412.598) * (-1412.648) (-1411.912) [-1412.173] (-1413.581) -- 0:00:51 189000 -- (-1411.809) (-1415.822) (-1412.657) [-1411.984] * (-1412.881) (-1412.631) (-1416.972) [-1413.771] -- 0:00:51 189500 -- (-1412.413) (-1412.170) [-1413.639] (-1414.323) * (-1412.499) [-1412.256] (-1416.972) (-1415.643) -- 0:00:51 190000 -- [-1412.268] (-1412.441) (-1412.455) (-1412.782) * (-1413.305) (-1413.199) (-1414.904) [-1412.377] -- 0:00:51 Average standard deviation of split frequencies: 0.021757 190500 -- (-1414.131) (-1412.433) [-1411.816] (-1417.215) * (-1413.982) [-1413.017] (-1412.659) (-1412.406) -- 0:00:50 191000 -- (-1412.244) [-1412.211] (-1415.072) (-1416.337) * (-1416.300) (-1412.569) (-1412.765) [-1412.667] -- 0:00:50 191500 -- (-1412.520) [-1413.811] (-1412.185) (-1412.557) * (-1414.979) (-1413.757) (-1414.481) [-1412.280] -- 0:00:50 192000 -- (-1411.432) [-1413.422] (-1415.148) (-1416.004) * (-1413.258) (-1413.879) [-1412.647] (-1413.192) -- 0:00:50 192500 -- (-1414.564) (-1411.642) (-1414.412) [-1412.092] * (-1417.478) (-1412.280) [-1412.786] (-1412.039) -- 0:00:50 193000 -- (-1415.732) [-1411.682] (-1414.663) (-1412.223) * (-1414.319) (-1412.205) (-1412.748) [-1412.018] -- 0:00:50 193500 -- (-1412.972) (-1414.308) (-1416.262) [-1412.359] * (-1414.361) [-1412.743] (-1412.665) (-1412.996) -- 0:00:50 194000 -- (-1412.123) (-1412.096) [-1417.718] (-1416.527) * (-1414.912) [-1411.958] (-1411.322) (-1412.402) -- 0:00:49 194500 -- [-1413.600] (-1412.755) (-1417.168) (-1414.471) * (-1413.449) [-1413.471] (-1412.787) (-1412.421) -- 0:00:49 195000 -- [-1413.457] (-1413.672) (-1412.571) (-1413.807) * (-1414.282) (-1413.821) [-1413.086] (-1413.350) -- 0:00:49 Average standard deviation of split frequencies: 0.021773 195500 -- (-1412.925) [-1415.589] (-1412.977) (-1417.511) * (-1412.957) (-1412.353) (-1416.670) [-1413.130] -- 0:00:53 196000 -- [-1411.853] (-1413.815) (-1414.386) (-1414.310) * (-1412.983) (-1415.561) (-1413.193) [-1413.089] -- 0:00:53 196500 -- (-1411.653) (-1412.042) [-1411.936] (-1412.511) * (-1413.216) (-1415.710) (-1412.493) [-1412.769] -- 0:00:53 197000 -- (-1415.567) (-1412.130) (-1416.595) [-1412.479] * (-1413.644) [-1416.132] (-1414.263) (-1413.948) -- 0:00:52 197500 -- [-1414.285] (-1414.653) (-1412.915) (-1415.511) * (-1414.223) [-1415.342] (-1414.848) (-1413.192) -- 0:00:52 198000 -- [-1414.117] (-1412.491) (-1412.252) (-1417.595) * [-1412.725] (-1413.026) (-1411.860) (-1412.473) -- 0:00:52 198500 -- (-1413.593) (-1412.136) (-1413.205) [-1413.098] * (-1412.682) [-1412.098] (-1416.413) (-1415.975) -- 0:00:52 199000 -- (-1414.144) (-1413.300) [-1413.565] (-1411.673) * (-1412.738) (-1415.112) [-1415.093] (-1414.779) -- 0:00:52 199500 -- (-1414.297) (-1413.978) [-1413.351] (-1413.152) * (-1412.042) (-1412.930) (-1414.286) [-1412.727] -- 0:00:52 200000 -- (-1414.523) (-1416.888) (-1413.659) [-1413.853] * [-1411.912] (-1413.343) (-1414.286) (-1412.234) -- 0:00:51 Average standard deviation of split frequencies: 0.021637 200500 -- (-1413.893) [-1413.395] (-1414.495) (-1412.067) * [-1411.811] (-1415.130) (-1417.611) (-1412.381) -- 0:00:51 201000 -- (-1413.379) (-1413.034) (-1413.326) [-1412.655] * (-1412.643) (-1415.209) [-1415.031] (-1412.289) -- 0:00:51 201500 -- (-1417.562) (-1414.105) (-1412.469) [-1412.604] * (-1412.469) [-1416.092] (-1415.112) (-1411.020) -- 0:00:51 202000 -- (-1412.420) [-1416.631] (-1414.903) (-1413.562) * (-1412.469) [-1414.902] (-1411.765) (-1412.095) -- 0:00:51 202500 -- (-1410.882) (-1412.764) [-1412.915] (-1415.386) * (-1413.168) [-1412.656] (-1414.783) (-1414.335) -- 0:00:51 203000 -- [-1411.468] (-1412.747) (-1414.111) (-1413.931) * (-1411.956) (-1415.844) (-1414.742) [-1413.827] -- 0:00:51 203500 -- (-1412.385) (-1413.596) (-1413.129) [-1412.685] * (-1411.650) (-1411.884) (-1414.976) [-1414.018] -- 0:00:50 204000 -- (-1412.440) [-1414.396] (-1413.130) (-1413.123) * [-1414.047] (-1412.090) (-1412.934) (-1418.318) -- 0:00:50 204500 -- (-1411.794) [-1413.664] (-1413.171) (-1413.854) * (-1412.217) [-1413.502] (-1417.054) (-1411.686) -- 0:00:50 205000 -- (-1415.453) [-1413.616] (-1414.481) (-1415.839) * (-1413.064) (-1412.663) (-1415.972) [-1412.234] -- 0:00:50 Average standard deviation of split frequencies: 0.023486 205500 -- [-1414.255] (-1412.679) (-1413.732) (-1415.100) * (-1411.618) [-1414.760] (-1413.230) (-1412.369) -- 0:00:50 206000 -- (-1412.797) [-1412.291] (-1414.501) (-1411.878) * (-1414.572) [-1412.511] (-1412.652) (-1414.876) -- 0:00:50 206500 -- (-1414.756) [-1413.486] (-1414.013) (-1411.828) * [-1415.166] (-1413.314) (-1412.003) (-1414.309) -- 0:00:49 207000 -- (-1418.011) (-1414.417) (-1414.650) [-1412.133] * (-1414.380) (-1413.050) [-1413.355] (-1413.213) -- 0:00:49 207500 -- (-1415.145) (-1412.956) (-1418.327) [-1414.374] * (-1412.002) [-1419.086] (-1412.578) (-1413.218) -- 0:00:49 208000 -- (-1416.556) (-1413.920) [-1414.462] (-1417.259) * [-1412.644] (-1417.134) (-1412.570) (-1415.198) -- 0:00:49 208500 -- (-1413.943) (-1414.242) [-1412.694] (-1412.748) * (-1417.041) (-1416.698) (-1412.758) [-1414.272] -- 0:00:49 209000 -- (-1413.696) (-1412.140) (-1413.934) [-1412.913] * (-1413.606) (-1412.170) [-1412.286] (-1414.814) -- 0:00:49 209500 -- (-1412.679) (-1412.271) (-1415.463) [-1411.705] * (-1413.785) (-1413.326) (-1413.787) [-1412.460] -- 0:00:49 210000 -- (-1412.147) (-1411.789) [-1413.527] (-1414.412) * (-1412.534) [-1412.945] (-1411.991) (-1414.334) -- 0:00:48 Average standard deviation of split frequencies: 0.023319 210500 -- (-1412.136) (-1412.259) [-1414.602] (-1413.865) * [-1412.768] (-1414.233) (-1413.288) (-1415.581) -- 0:00:48 211000 -- [-1416.337] (-1412.703) (-1412.956) (-1411.906) * [-1413.094] (-1413.225) (-1411.847) (-1419.882) -- 0:00:48 211500 -- [-1414.417] (-1416.638) (-1416.029) (-1417.502) * [-1415.574] (-1412.578) (-1412.620) (-1414.584) -- 0:00:52 212000 -- (-1412.208) (-1418.062) [-1416.218] (-1412.425) * (-1413.655) (-1418.060) [-1415.168] (-1412.399) -- 0:00:52 212500 -- [-1411.994] (-1415.264) (-1413.960) (-1411.464) * [-1412.832] (-1415.707) (-1412.889) (-1412.428) -- 0:00:51 213000 -- [-1412.345] (-1413.294) (-1412.586) (-1412.106) * (-1414.996) (-1413.708) (-1414.678) [-1412.161] -- 0:00:51 213500 -- [-1412.626] (-1412.806) (-1414.835) (-1411.983) * (-1414.170) (-1414.744) [-1414.653] (-1414.694) -- 0:00:51 214000 -- (-1412.202) (-1413.583) (-1412.080) [-1412.325] * (-1413.179) (-1414.757) (-1414.179) [-1411.848] -- 0:00:51 214500 -- [-1412.168] (-1413.318) (-1411.872) (-1411.988) * (-1414.427) (-1414.173) [-1412.167] (-1414.295) -- 0:00:51 215000 -- (-1414.021) (-1413.538) [-1414.119] (-1411.134) * (-1414.702) (-1412.730) [-1414.740] (-1413.512) -- 0:00:51 Average standard deviation of split frequencies: 0.024236 215500 -- (-1412.344) (-1411.802) (-1411.952) [-1412.873] * (-1414.568) (-1413.411) (-1413.359) [-1413.112] -- 0:00:50 216000 -- [-1413.739] (-1411.099) (-1414.550) (-1413.267) * [-1411.572] (-1412.556) (-1412.090) (-1412.711) -- 0:00:50 216500 -- [-1415.131] (-1413.470) (-1413.660) (-1415.696) * (-1412.685) [-1411.439] (-1412.855) (-1413.392) -- 0:00:50 217000 -- (-1412.014) (-1412.768) [-1414.722] (-1413.483) * (-1413.373) [-1413.023] (-1414.233) (-1411.198) -- 0:00:50 217500 -- (-1411.783) (-1413.842) [-1416.207] (-1414.237) * (-1412.358) (-1412.592) [-1413.547] (-1411.462) -- 0:00:50 218000 -- (-1411.783) [-1413.902] (-1413.144) (-1414.499) * [-1412.636] (-1413.291) (-1412.525) (-1412.016) -- 0:00:50 218500 -- (-1414.399) (-1412.021) [-1412.877] (-1413.556) * (-1413.865) (-1415.153) [-1412.682] (-1411.658) -- 0:00:50 219000 -- (-1414.873) (-1411.468) [-1412.171] (-1419.973) * (-1414.570) [-1412.654] (-1414.380) (-1416.499) -- 0:00:49 219500 -- (-1411.579) (-1411.468) [-1412.626] (-1415.325) * (-1413.439) (-1412.829) (-1416.192) [-1412.806] -- 0:00:49 220000 -- (-1412.476) (-1413.577) [-1413.640] (-1412.766) * (-1412.652) (-1416.449) (-1416.017) [-1412.415] -- 0:00:49 Average standard deviation of split frequencies: 0.024330 220500 -- (-1412.398) (-1413.237) (-1416.899) [-1412.203] * (-1413.766) [-1414.794] (-1415.701) (-1411.498) -- 0:00:49 221000 -- (-1411.823) (-1414.479) [-1411.589] (-1413.535) * [-1413.088] (-1411.546) (-1413.669) (-1413.991) -- 0:00:49 221500 -- (-1416.837) (-1414.887) (-1411.326) [-1412.841] * [-1412.393] (-1412.360) (-1414.475) (-1414.106) -- 0:00:49 222000 -- (-1413.175) (-1413.026) [-1413.534] (-1411.655) * [-1417.038] (-1411.371) (-1414.395) (-1411.276) -- 0:00:49 222500 -- (-1412.965) (-1413.626) [-1412.745] (-1411.476) * (-1415.606) (-1411.290) (-1415.778) [-1412.041] -- 0:00:48 223000 -- (-1412.837) (-1412.688) [-1414.578] (-1412.006) * (-1415.287) (-1413.078) (-1415.542) [-1411.621] -- 0:00:48 223500 -- (-1412.769) (-1412.152) (-1416.779) [-1411.300] * (-1413.521) [-1413.645] (-1413.352) (-1411.564) -- 0:00:48 224000 -- (-1413.452) [-1411.939] (-1415.833) (-1413.122) * (-1413.523) [-1413.073] (-1411.249) (-1413.102) -- 0:00:48 224500 -- (-1412.174) [-1413.735] (-1416.981) (-1413.816) * (-1415.081) (-1411.638) [-1414.894] (-1412.238) -- 0:00:48 225000 -- (-1413.042) (-1416.197) (-1420.889) [-1415.941] * (-1417.259) [-1411.554] (-1411.828) (-1412.238) -- 0:00:48 Average standard deviation of split frequencies: 0.025579 225500 -- (-1412.499) (-1413.754) (-1412.923) [-1412.603] * [-1413.211] (-1412.211) (-1413.174) (-1413.113) -- 0:00:48 226000 -- (-1411.641) (-1411.638) [-1414.009] (-1413.291) * (-1417.035) (-1414.339) (-1414.578) [-1411.259] -- 0:00:47 226500 -- (-1411.921) (-1411.432) (-1414.862) [-1414.762] * (-1417.043) (-1412.669) (-1413.086) [-1413.263] -- 0:00:47 227000 -- (-1411.829) (-1415.167) [-1413.523] (-1413.337) * [-1414.234] (-1411.279) (-1414.316) (-1413.012) -- 0:00:47 227500 -- (-1411.696) (-1414.546) (-1414.268) [-1413.682] * (-1413.626) (-1412.668) [-1412.544] (-1411.122) -- 0:00:47 228000 -- [-1411.696] (-1416.589) (-1413.607) (-1415.748) * (-1412.596) [-1411.327] (-1413.258) (-1412.004) -- 0:00:50 228500 -- (-1411.696) (-1415.524) [-1413.925] (-1414.085) * (-1413.059) (-1411.198) (-1411.317) [-1411.618] -- 0:00:50 229000 -- (-1412.811) [-1413.805] (-1415.255) (-1413.660) * (-1412.004) (-1411.008) (-1416.863) [-1415.155] -- 0:00:50 229500 -- (-1412.912) (-1411.727) (-1413.279) [-1413.491] * (-1415.468) [-1411.006] (-1411.901) (-1420.171) -- 0:00:50 230000 -- (-1414.780) (-1412.845) (-1413.015) [-1414.865] * (-1415.260) (-1412.332) (-1413.151) [-1414.984] -- 0:00:50 Average standard deviation of split frequencies: 0.024201 230500 -- (-1411.628) [-1412.755] (-1413.102) (-1414.107) * [-1411.693] (-1412.709) (-1413.990) (-1414.651) -- 0:00:50 231000 -- (-1412.794) (-1414.268) [-1412.199] (-1417.582) * (-1412.640) [-1413.918] (-1413.268) (-1413.310) -- 0:00:49 231500 -- [-1412.388] (-1413.490) (-1414.344) (-1412.677) * (-1414.367) (-1417.228) (-1412.210) [-1413.530] -- 0:00:49 232000 -- [-1417.005] (-1415.861) (-1417.127) (-1413.400) * (-1412.978) (-1416.632) [-1412.036] (-1413.174) -- 0:00:49 232500 -- (-1413.856) [-1412.306] (-1417.624) (-1415.304) * (-1412.677) (-1412.816) (-1413.206) [-1413.081] -- 0:00:49 233000 -- (-1412.828) (-1415.806) [-1413.050] (-1413.293) * [-1414.905] (-1415.809) (-1414.749) (-1412.066) -- 0:00:49 233500 -- [-1415.096] (-1411.149) (-1412.640) (-1411.610) * [-1412.873] (-1415.533) (-1412.854) (-1413.172) -- 0:00:49 234000 -- (-1413.435) (-1411.170) [-1411.959] (-1411.131) * (-1414.550) [-1415.324] (-1414.283) (-1413.507) -- 0:00:49 234500 -- (-1412.619) (-1416.112) [-1411.729] (-1411.276) * (-1414.234) [-1412.531] (-1413.863) (-1416.275) -- 0:00:48 235000 -- (-1413.851) (-1411.597) (-1413.254) [-1412.183] * (-1414.823) [-1413.985] (-1414.869) (-1416.676) -- 0:00:48 Average standard deviation of split frequencies: 0.024601 235500 -- [-1416.192] (-1413.110) (-1416.349) (-1413.348) * (-1412.436) (-1414.691) [-1412.924] (-1412.994) -- 0:00:48 236000 -- (-1411.364) [-1410.894] (-1417.103) (-1415.732) * [-1412.431] (-1413.193) (-1412.604) (-1411.952) -- 0:00:48 236500 -- (-1411.354) [-1413.605] (-1416.621) (-1415.989) * (-1411.723) [-1412.657] (-1415.056) (-1414.818) -- 0:00:48 237000 -- [-1415.785] (-1414.077) (-1412.334) (-1415.625) * (-1411.723) (-1414.119) [-1414.567] (-1412.050) -- 0:00:48 237500 -- [-1414.970] (-1414.949) (-1412.352) (-1414.218) * (-1412.287) (-1413.601) [-1414.178] (-1413.475) -- 0:00:48 238000 -- (-1412.706) [-1415.991] (-1412.019) (-1417.098) * (-1413.642) (-1411.730) [-1413.729] (-1412.985) -- 0:00:48 238500 -- (-1416.819) [-1412.795] (-1412.019) (-1414.149) * (-1412.602) (-1411.849) [-1411.564] (-1415.487) -- 0:00:47 239000 -- (-1412.663) (-1412.036) [-1413.358] (-1417.825) * (-1412.546) (-1414.790) [-1412.885] (-1412.700) -- 0:00:47 239500 -- (-1412.635) (-1415.846) [-1411.677] (-1414.396) * (-1413.144) [-1412.988] (-1416.376) (-1413.129) -- 0:00:47 240000 -- [-1413.829] (-1411.552) (-1413.960) (-1414.586) * [-1412.081] (-1413.564) (-1412.287) (-1411.724) -- 0:00:47 Average standard deviation of split frequencies: 0.023608 240500 -- [-1413.275] (-1414.842) (-1411.852) (-1415.064) * (-1411.388) (-1412.843) [-1411.963] (-1411.107) -- 0:00:47 241000 -- (-1412.940) (-1413.963) (-1412.777) [-1411.900] * [-1411.805] (-1411.790) (-1411.544) (-1411.326) -- 0:00:47 241500 -- (-1413.353) (-1415.059) (-1412.091) [-1411.267] * [-1412.490] (-1411.874) (-1411.689) (-1411.326) -- 0:00:47 242000 -- (-1412.931) (-1412.636) [-1414.232] (-1414.035) * (-1420.675) (-1415.113) [-1413.353] (-1411.326) -- 0:00:46 242500 -- (-1413.099) (-1413.692) [-1413.658] (-1413.853) * (-1414.246) (-1413.323) [-1413.353] (-1411.025) -- 0:00:46 243000 -- [-1413.431] (-1414.155) (-1413.264) (-1411.796) * (-1414.185) (-1413.247) [-1412.089] (-1411.667) -- 0:00:46 243500 -- (-1411.668) (-1415.599) (-1411.317) [-1413.514] * [-1413.372] (-1412.722) (-1413.018) (-1412.659) -- 0:00:49 244000 -- [-1413.556] (-1413.362) (-1412.104) (-1412.325) * (-1414.155) (-1413.804) [-1411.845] (-1411.537) -- 0:00:49 244500 -- (-1414.817) (-1414.310) [-1413.875] (-1412.325) * (-1415.434) (-1414.262) [-1413.470] (-1412.676) -- 0:00:49 245000 -- (-1415.838) (-1412.781) [-1414.254] (-1411.975) * (-1415.180) (-1413.460) (-1417.950) [-1413.078] -- 0:00:49 Average standard deviation of split frequencies: 0.022894 245500 -- (-1413.260) (-1411.909) [-1414.958] (-1413.400) * (-1414.124) (-1414.453) [-1412.007] (-1414.261) -- 0:00:49 246000 -- (-1411.968) (-1414.853) (-1411.428) [-1411.417] * (-1411.959) (-1416.299) [-1411.490] (-1418.835) -- 0:00:49 246500 -- (-1417.903) (-1417.522) [-1412.955] (-1412.511) * [-1412.230] (-1415.086) (-1414.551) (-1412.273) -- 0:00:48 247000 -- (-1418.723) (-1411.943) [-1414.185] (-1412.313) * (-1418.182) (-1414.093) [-1414.626] (-1412.062) -- 0:00:48 247500 -- [-1412.271] (-1416.410) (-1414.695) (-1411.616) * [-1416.319] (-1413.803) (-1414.895) (-1411.706) -- 0:00:48 248000 -- [-1412.711] (-1416.430) (-1417.424) (-1411.530) * (-1412.889) (-1413.803) [-1415.215] (-1414.288) -- 0:00:48 248500 -- (-1413.491) (-1414.905) (-1412.876) [-1411.705] * (-1412.766) (-1415.016) [-1413.054] (-1417.153) -- 0:00:48 249000 -- (-1414.602) (-1415.425) (-1415.116) [-1413.089] * (-1414.647) (-1417.053) [-1412.664] (-1413.087) -- 0:00:48 249500 -- (-1413.951) (-1417.684) [-1416.052] (-1412.921) * [-1411.460] (-1413.826) (-1413.502) (-1412.123) -- 0:00:48 250000 -- (-1414.584) (-1415.101) [-1412.601] (-1415.207) * [-1413.037] (-1414.248) (-1413.989) (-1412.121) -- 0:00:48 Average standard deviation of split frequencies: 0.021836 250500 -- (-1412.442) [-1415.067] (-1418.361) (-1412.593) * (-1412.913) [-1414.160] (-1412.460) (-1413.370) -- 0:00:47 251000 -- [-1412.556] (-1415.325) (-1412.091) (-1414.650) * [-1411.348] (-1411.986) (-1412.056) (-1412.598) -- 0:00:47 251500 -- (-1411.858) (-1413.008) [-1411.362] (-1413.235) * (-1416.085) [-1411.762] (-1413.824) (-1411.133) -- 0:00:47 252000 -- (-1413.478) [-1414.634] (-1414.097) (-1415.696) * (-1415.231) [-1414.151] (-1413.225) (-1411.518) -- 0:00:47 252500 -- (-1412.858) [-1415.075] (-1413.707) (-1415.753) * [-1414.721] (-1411.191) (-1414.253) (-1411.352) -- 0:00:47 253000 -- [-1412.939] (-1418.493) (-1414.109) (-1411.837) * (-1412.441) (-1412.822) (-1415.034) [-1411.492] -- 0:00:47 253500 -- (-1416.269) (-1414.329) [-1415.546] (-1418.140) * (-1417.773) (-1412.613) [-1413.224] (-1412.792) -- 0:00:47 254000 -- (-1412.274) (-1417.685) [-1416.712] (-1416.437) * (-1412.190) (-1411.508) [-1413.231] (-1413.345) -- 0:00:46 254500 -- (-1413.271) [-1413.821] (-1416.683) (-1412.386) * (-1412.911) [-1412.654] (-1412.900) (-1413.691) -- 0:00:46 255000 -- [-1413.011] (-1412.798) (-1412.716) (-1411.690) * (-1412.166) (-1412.937) (-1421.657) [-1413.250] -- 0:00:46 Average standard deviation of split frequencies: 0.022302 255500 -- (-1413.569) (-1413.237) (-1416.896) [-1414.101] * (-1412.705) (-1412.890) (-1413.556) [-1411.663] -- 0:00:46 256000 -- (-1412.241) (-1412.325) (-1414.750) [-1413.852] * (-1412.706) (-1415.007) (-1413.474) [-1412.027] -- 0:00:46 256500 -- (-1412.249) (-1413.825) [-1414.893] (-1414.418) * (-1412.441) [-1413.145] (-1414.451) (-1412.862) -- 0:00:46 257000 -- (-1413.618) (-1411.835) (-1414.122) [-1413.031] * (-1414.939) (-1414.057) (-1413.303) [-1412.198] -- 0:00:46 257500 -- (-1413.490) [-1414.871] (-1413.167) (-1412.639) * (-1415.052) [-1417.770] (-1412.015) (-1413.222) -- 0:00:46 258000 -- (-1412.958) (-1411.811) (-1414.755) [-1414.975] * [-1413.134] (-1416.018) (-1412.059) (-1412.170) -- 0:00:46 258500 -- (-1411.640) (-1413.601) (-1412.040) [-1412.162] * (-1413.964) (-1414.733) [-1413.735] (-1411.975) -- 0:00:45 259000 -- (-1412.812) (-1415.065) [-1412.391] (-1412.786) * [-1413.599] (-1416.711) (-1413.938) (-1412.148) -- 0:00:45 259500 -- (-1411.284) (-1414.474) (-1414.203) [-1412.885] * (-1412.775) [-1414.875] (-1415.209) (-1413.642) -- 0:00:48 260000 -- (-1411.290) (-1412.313) [-1412.765] (-1414.661) * (-1413.157) (-1413.173) [-1411.999] (-1413.517) -- 0:00:48 Average standard deviation of split frequencies: 0.022233 260500 -- (-1413.652) [-1412.368] (-1414.081) (-1415.427) * (-1416.777) (-1413.161) [-1412.008] (-1416.239) -- 0:00:48 261000 -- (-1413.327) (-1413.612) [-1413.170] (-1413.217) * [-1414.331] (-1411.943) (-1413.319) (-1415.140) -- 0:00:48 261500 -- (-1413.139) (-1413.163) [-1412.417] (-1414.337) * (-1414.442) (-1419.132) (-1413.198) [-1414.855] -- 0:00:48 262000 -- (-1413.502) (-1414.970) [-1412.077] (-1414.629) * (-1413.844) (-1414.577) [-1412.054] (-1414.028) -- 0:00:47 262500 -- (-1415.157) [-1414.171] (-1416.396) (-1411.133) * [-1412.986] (-1414.692) (-1413.643) (-1413.298) -- 0:00:47 263000 -- (-1413.607) (-1412.702) (-1415.445) [-1412.079] * (-1413.549) (-1415.166) (-1416.679) [-1412.320] -- 0:00:47 263500 -- (-1413.599) (-1412.824) [-1412.426] (-1412.131) * (-1413.351) (-1414.033) [-1412.621] (-1417.158) -- 0:00:47 264000 -- (-1412.679) (-1419.509) [-1415.295] (-1419.310) * (-1413.089) (-1415.569) (-1412.293) [-1411.093] -- 0:00:47 264500 -- (-1413.732) (-1412.879) [-1412.416] (-1411.818) * (-1413.449) (-1412.810) [-1413.342] (-1413.793) -- 0:00:47 265000 -- (-1412.190) (-1414.948) (-1412.535) [-1413.652] * (-1413.234) [-1414.785] (-1418.162) (-1414.016) -- 0:00:47 Average standard deviation of split frequencies: 0.019406 265500 -- (-1412.705) (-1413.362) [-1415.104] (-1412.443) * [-1411.148] (-1414.021) (-1412.074) (-1416.225) -- 0:00:47 266000 -- (-1415.056) (-1416.364) [-1413.352] (-1413.109) * (-1412.286) (-1415.218) (-1411.782) [-1412.554] -- 0:00:46 266500 -- (-1415.155) (-1415.561) [-1411.714] (-1413.331) * (-1417.431) [-1413.560] (-1412.001) (-1414.762) -- 0:00:46 267000 -- (-1413.361) (-1415.606) (-1413.570) [-1414.129] * (-1416.539) (-1414.081) (-1412.342) [-1413.288] -- 0:00:46 267500 -- (-1413.509) (-1417.416) (-1415.105) [-1413.091] * (-1413.854) (-1412.902) [-1411.779] (-1412.118) -- 0:00:46 268000 -- (-1418.549) (-1412.658) (-1413.986) [-1416.575] * (-1412.692) (-1415.562) [-1411.774] (-1412.412) -- 0:00:46 268500 -- (-1414.729) (-1411.785) (-1414.066) [-1414.322] * (-1413.822) (-1414.593) (-1411.701) [-1412.413] -- 0:00:46 269000 -- (-1414.993) (-1414.295) (-1419.739) [-1413.478] * (-1414.532) (-1414.919) (-1415.110) [-1415.484] -- 0:00:46 269500 -- (-1414.946) (-1413.057) (-1416.129) [-1413.478] * [-1412.268] (-1414.216) (-1411.595) (-1417.372) -- 0:00:46 270000 -- [-1411.621] (-1414.964) (-1412.165) (-1414.154) * [-1412.923] (-1417.730) (-1411.564) (-1412.405) -- 0:00:45 Average standard deviation of split frequencies: 0.019616 270500 -- [-1414.765] (-1414.237) (-1414.717) (-1412.291) * [-1413.224] (-1414.740) (-1412.117) (-1412.871) -- 0:00:45 271000 -- (-1414.004) (-1414.818) [-1413.547] (-1413.342) * (-1414.981) [-1411.975] (-1411.760) (-1412.749) -- 0:00:45 271500 -- (-1411.554) [-1414.493] (-1412.266) (-1414.029) * (-1413.596) (-1412.954) (-1413.644) [-1413.093] -- 0:00:45 272000 -- [-1413.399] (-1414.591) (-1413.006) (-1413.185) * [-1412.107] (-1412.209) (-1412.321) (-1413.974) -- 0:00:45 272500 -- (-1412.282) [-1415.207] (-1414.353) (-1411.737) * (-1413.568) (-1412.734) [-1412.060] (-1413.213) -- 0:00:45 273000 -- [-1412.256] (-1416.557) (-1412.267) (-1413.332) * (-1415.369) (-1411.640) (-1413.938) [-1414.824] -- 0:00:45 273500 -- (-1412.823) (-1414.814) (-1413.250) [-1413.411] * (-1414.568) [-1411.999] (-1414.097) (-1414.477) -- 0:00:45 274000 -- (-1412.027) [-1422.999] (-1412.458) (-1414.555) * (-1419.218) [-1412.090] (-1412.309) (-1416.242) -- 0:00:45 274500 -- [-1413.721] (-1418.217) (-1411.985) (-1417.450) * (-1422.643) (-1413.215) (-1413.055) [-1414.303] -- 0:00:44 275000 -- (-1413.063) [-1412.189] (-1412.716) (-1415.723) * (-1413.538) (-1412.075) (-1412.588) [-1413.574] -- 0:00:44 Average standard deviation of split frequencies: 0.018587 275500 -- (-1415.582) [-1412.413] (-1414.695) (-1412.335) * (-1415.613) (-1414.618) [-1413.380] (-1416.366) -- 0:00:47 276000 -- [-1414.272] (-1414.889) (-1412.306) (-1414.234) * [-1414.887] (-1411.357) (-1412.733) (-1418.865) -- 0:00:47 276500 -- (-1413.456) (-1413.598) (-1412.092) [-1412.985] * [-1415.027] (-1412.803) (-1412.280) (-1414.189) -- 0:00:47 277000 -- [-1412.441] (-1413.776) (-1411.362) (-1411.422) * (-1416.242) (-1414.527) (-1412.434) [-1415.466] -- 0:00:46 277500 -- (-1412.187) (-1413.429) [-1411.521] (-1412.763) * (-1414.065) (-1414.308) (-1411.708) [-1413.124] -- 0:00:46 278000 -- (-1411.894) (-1414.585) (-1411.408) [-1412.219] * [-1414.506] (-1413.234) (-1411.422) (-1414.307) -- 0:00:46 278500 -- [-1412.285] (-1414.797) (-1412.755) (-1412.591) * [-1414.785] (-1413.564) (-1412.953) (-1412.429) -- 0:00:46 279000 -- (-1412.478) [-1411.512] (-1414.774) (-1416.324) * (-1414.852) (-1412.451) [-1413.592] (-1413.446) -- 0:00:46 279500 -- [-1411.976] (-1412.300) (-1414.255) (-1412.885) * (-1418.301) (-1419.162) (-1411.714) [-1414.325] -- 0:00:46 280000 -- (-1413.557) (-1412.535) (-1412.169) [-1414.850] * [-1412.071] (-1419.085) (-1411.691) (-1415.141) -- 0:00:46 Average standard deviation of split frequencies: 0.018266 280500 -- [-1413.453] (-1412.193) (-1412.669) (-1413.186) * (-1412.991) [-1412.763] (-1411.882) (-1414.056) -- 0:00:46 281000 -- (-1414.990) [-1412.560] (-1412.710) (-1414.134) * [-1415.148] (-1412.078) (-1412.152) (-1416.737) -- 0:00:46 281500 -- [-1412.215] (-1412.463) (-1414.116) (-1415.831) * (-1413.437) [-1412.583] (-1412.632) (-1412.121) -- 0:00:45 282000 -- [-1412.134] (-1412.276) (-1413.694) (-1414.627) * (-1412.164) (-1411.728) [-1412.617] (-1412.617) -- 0:00:45 282500 -- (-1412.000) [-1414.592] (-1415.429) (-1413.148) * (-1411.397) (-1417.028) (-1412.126) [-1411.985] -- 0:00:45 283000 -- (-1414.222) (-1416.722) (-1411.601) [-1412.714] * (-1412.086) (-1418.887) [-1412.126] (-1415.529) -- 0:00:45 283500 -- (-1412.342) (-1416.194) [-1412.756] (-1414.245) * (-1411.672) (-1416.839) [-1412.714] (-1413.451) -- 0:00:45 284000 -- (-1413.247) [-1413.464] (-1414.553) (-1415.579) * (-1413.460) [-1414.805] (-1417.693) (-1411.711) -- 0:00:45 284500 -- (-1416.123) (-1411.329) [-1413.828] (-1413.789) * (-1414.757) (-1412.270) (-1412.492) [-1411.659] -- 0:00:45 285000 -- (-1415.481) [-1412.112] (-1413.318) (-1413.265) * (-1414.280) (-1412.020) (-1412.959) [-1413.174] -- 0:00:45 Average standard deviation of split frequencies: 0.016689 285500 -- (-1412.561) (-1413.423) (-1411.815) [-1413.065] * (-1413.607) [-1411.731] (-1412.331) (-1415.700) -- 0:00:45 286000 -- (-1413.125) (-1416.185) [-1414.009] (-1412.463) * (-1414.062) (-1412.857) (-1412.573) [-1417.038] -- 0:00:44 286500 -- [-1412.911] (-1415.644) (-1411.648) (-1411.791) * (-1414.955) [-1412.279] (-1411.493) (-1418.354) -- 0:00:44 287000 -- [-1413.759] (-1414.195) (-1412.717) (-1417.903) * (-1414.274) (-1414.574) [-1412.211] (-1417.412) -- 0:00:44 287500 -- (-1413.451) (-1411.829) [-1415.318] (-1417.602) * (-1412.838) (-1417.563) (-1419.803) [-1414.726] -- 0:00:44 288000 -- [-1412.689] (-1411.873) (-1416.004) (-1417.206) * (-1412.436) (-1411.651) (-1414.673) [-1414.684] -- 0:00:44 288500 -- [-1412.444] (-1411.758) (-1412.811) (-1414.818) * [-1412.037] (-1411.865) (-1412.659) (-1412.274) -- 0:00:44 289000 -- [-1412.486] (-1412.725) (-1418.302) (-1417.296) * (-1413.613) (-1412.200) (-1412.700) [-1411.991] -- 0:00:44 289500 -- [-1412.569] (-1412.169) (-1416.486) (-1413.458) * (-1414.077) (-1413.081) [-1411.511] (-1412.573) -- 0:00:44 290000 -- (-1412.988) [-1412.976] (-1414.049) (-1415.781) * (-1412.787) (-1414.741) [-1411.789] (-1412.958) -- 0:00:44 Average standard deviation of split frequencies: 0.016623 290500 -- (-1414.149) (-1411.487) (-1413.596) [-1413.111] * (-1412.490) (-1413.997) (-1414.179) [-1411.542] -- 0:00:43 291000 -- (-1414.591) (-1412.645) [-1413.991] (-1412.780) * (-1412.222) [-1414.722] (-1413.437) (-1412.652) -- 0:00:43 291500 -- (-1413.982) (-1411.473) [-1414.696] (-1414.220) * [-1412.488] (-1415.822) (-1413.756) (-1413.916) -- 0:00:46 292000 -- (-1412.763) [-1412.072] (-1414.765) (-1414.323) * [-1412.527] (-1414.389) (-1411.387) (-1412.771) -- 0:00:46 292500 -- (-1412.497) [-1412.406] (-1416.379) (-1415.465) * [-1413.911] (-1413.877) (-1414.887) (-1413.278) -- 0:00:45 293000 -- (-1413.114) [-1411.816] (-1415.218) (-1415.989) * (-1412.442) (-1414.870) (-1415.234) [-1412.884] -- 0:00:45 293500 -- (-1415.826) (-1413.505) (-1419.865) [-1413.452] * (-1411.208) (-1415.738) [-1414.981] (-1412.234) -- 0:00:45 294000 -- (-1415.068) [-1412.987] (-1414.494) (-1412.881) * (-1410.916) (-1417.842) (-1414.317) [-1415.644] -- 0:00:45 294500 -- (-1415.168) (-1412.234) (-1414.756) [-1413.069] * [-1411.317] (-1415.908) (-1414.744) (-1414.820) -- 0:00:45 295000 -- (-1415.426) (-1415.438) [-1414.940] (-1415.899) * [-1411.156] (-1413.856) (-1413.530) (-1413.179) -- 0:00:45 Average standard deviation of split frequencies: 0.016224 295500 -- [-1412.905] (-1411.694) (-1414.060) (-1412.898) * (-1411.389) (-1415.129) [-1413.499] (-1412.253) -- 0:00:45 296000 -- [-1411.678] (-1413.316) (-1413.009) (-1411.881) * [-1412.268] (-1415.652) (-1414.873) (-1411.903) -- 0:00:45 296500 -- (-1410.919) (-1413.659) [-1415.280] (-1414.651) * (-1412.268) (-1413.424) (-1414.159) [-1412.794] -- 0:00:45 297000 -- (-1411.580) (-1413.029) (-1415.236) [-1412.493] * (-1412.712) (-1413.359) [-1415.252] (-1415.801) -- 0:00:44 297500 -- [-1411.581] (-1411.709) (-1413.943) (-1413.215) * [-1412.099] (-1412.200) (-1414.071) (-1414.939) -- 0:00:44 298000 -- (-1411.469) (-1412.467) (-1416.237) [-1412.705] * [-1412.651] (-1411.679) (-1414.928) (-1412.593) -- 0:00:44 298500 -- (-1413.045) (-1413.368) [-1417.172] (-1413.700) * (-1413.347) (-1411.772) (-1413.784) [-1412.582] -- 0:00:44 299000 -- (-1411.675) (-1415.110) [-1414.389] (-1413.862) * (-1412.245) (-1412.138) [-1412.546] (-1412.194) -- 0:00:44 299500 -- (-1414.027) [-1414.526] (-1416.690) (-1415.096) * (-1411.757) (-1412.967) (-1413.223) [-1412.298] -- 0:00:44 300000 -- (-1413.685) [-1412.819] (-1414.124) (-1413.722) * [-1411.337] (-1414.472) (-1420.299) (-1411.018) -- 0:00:44 Average standard deviation of split frequencies: 0.015287 300500 -- (-1412.458) (-1413.869) (-1412.883) [-1417.029] * (-1414.081) (-1412.392) [-1414.670] (-1413.747) -- 0:00:44 301000 -- [-1412.819] (-1412.098) (-1412.624) (-1415.143) * (-1412.094) [-1412.052] (-1415.342) (-1414.256) -- 0:00:44 301500 -- [-1413.175] (-1412.781) (-1412.196) (-1415.833) * [-1411.999] (-1412.348) (-1421.161) (-1414.920) -- 0:00:44 302000 -- (-1416.397) [-1413.553] (-1412.756) (-1414.852) * (-1412.013) (-1413.009) (-1415.992) [-1413.310] -- 0:00:43 302500 -- (-1416.972) (-1413.214) (-1412.128) [-1412.943] * (-1418.531) (-1413.874) [-1412.878] (-1414.544) -- 0:00:43 303000 -- (-1412.205) (-1411.847) (-1411.862) [-1413.545] * (-1414.209) [-1414.752] (-1417.142) (-1413.169) -- 0:00:43 303500 -- [-1412.460] (-1415.060) (-1412.419) (-1413.001) * (-1412.737) [-1418.184] (-1412.663) (-1414.427) -- 0:00:43 304000 -- (-1412.920) (-1415.615) [-1413.141] (-1411.532) * [-1413.604] (-1412.889) (-1411.207) (-1412.935) -- 0:00:43 304500 -- [-1412.779] (-1413.067) (-1415.558) (-1411.677) * [-1412.907] (-1420.590) (-1411.805) (-1413.231) -- 0:00:43 305000 -- (-1414.050) (-1413.191) [-1416.555] (-1415.704) * (-1412.786) [-1411.117] (-1413.055) (-1412.788) -- 0:00:43 Average standard deviation of split frequencies: 0.015213 305500 -- (-1413.627) [-1412.789] (-1415.475) (-1416.205) * (-1414.118) (-1411.618) (-1411.764) [-1414.147] -- 0:00:43 306000 -- (-1415.301) (-1414.158) [-1412.274] (-1418.452) * (-1418.759) (-1413.794) (-1416.207) [-1413.273] -- 0:00:43 306500 -- [-1412.978] (-1417.824) (-1411.892) (-1416.661) * (-1415.195) [-1412.678] (-1415.542) (-1413.415) -- 0:00:42 307000 -- (-1414.051) [-1414.461] (-1417.341) (-1417.988) * (-1417.203) (-1412.436) (-1412.465) [-1414.317] -- 0:00:42 307500 -- (-1414.674) [-1411.873] (-1414.955) (-1416.838) * (-1415.153) [-1413.030] (-1412.680) (-1414.123) -- 0:00:45 308000 -- (-1414.188) [-1411.746] (-1413.357) (-1412.381) * (-1413.781) [-1414.021] (-1413.433) (-1415.344) -- 0:00:44 308500 -- (-1414.816) (-1411.509) (-1414.644) [-1413.048] * (-1413.782) (-1411.989) (-1412.779) [-1412.249] -- 0:00:44 309000 -- (-1412.001) [-1411.836] (-1414.385) (-1412.495) * (-1413.430) (-1411.309) [-1412.416] (-1414.329) -- 0:00:44 309500 -- [-1414.472] (-1411.621) (-1414.345) (-1412.446) * [-1416.648] (-1412.148) (-1412.339) (-1414.485) -- 0:00:44 310000 -- [-1412.677] (-1413.720) (-1412.789) (-1415.706) * [-1414.338] (-1412.240) (-1413.288) (-1413.507) -- 0:00:44 Average standard deviation of split frequencies: 0.014192 310500 -- [-1414.230] (-1410.971) (-1418.268) (-1413.548) * (-1416.098) (-1414.957) [-1414.276] (-1412.823) -- 0:00:44 311000 -- (-1415.739) (-1411.807) (-1413.832) [-1413.517] * (-1413.182) (-1413.297) [-1413.010] (-1413.058) -- 0:00:44 311500 -- (-1414.329) (-1414.869) (-1412.667) [-1412.721] * (-1413.124) (-1413.950) [-1413.908] (-1414.213) -- 0:00:44 312000 -- (-1412.946) [-1412.588] (-1413.057) (-1414.168) * (-1420.241) [-1413.281] (-1417.133) (-1412.227) -- 0:00:44 312500 -- (-1412.698) (-1412.682) [-1411.490] (-1412.708) * [-1414.755] (-1413.509) (-1413.680) (-1414.559) -- 0:00:44 313000 -- (-1413.952) [-1411.426] (-1412.014) (-1412.958) * (-1416.590) [-1413.291] (-1415.480) (-1419.312) -- 0:00:43 313500 -- (-1412.165) (-1412.706) [-1412.738] (-1413.020) * (-1415.068) (-1412.544) [-1413.966] (-1420.287) -- 0:00:43 314000 -- [-1412.270] (-1416.935) (-1412.462) (-1414.045) * (-1413.177) [-1412.200] (-1416.176) (-1416.705) -- 0:00:43 314500 -- (-1412.618) (-1412.326) (-1415.646) [-1413.251] * (-1414.575) (-1412.941) [-1413.282] (-1414.097) -- 0:00:43 315000 -- (-1414.328) (-1412.621) [-1412.244] (-1413.808) * [-1416.376] (-1411.680) (-1412.574) (-1411.995) -- 0:00:43 Average standard deviation of split frequencies: 0.014358 315500 -- [-1413.664] (-1412.524) (-1413.548) (-1416.078) * [-1416.730] (-1413.232) (-1415.040) (-1411.560) -- 0:00:43 316000 -- (-1412.818) [-1412.594] (-1414.502) (-1411.490) * (-1417.666) (-1414.556) (-1414.518) [-1412.347] -- 0:00:43 316500 -- (-1412.089) [-1415.390] (-1420.384) (-1412.968) * [-1416.530] (-1412.916) (-1412.196) (-1412.157) -- 0:00:43 317000 -- (-1413.929) (-1413.432) [-1416.451] (-1418.211) * (-1415.222) [-1411.727] (-1411.351) (-1413.225) -- 0:00:43 317500 -- (-1415.414) (-1412.188) (-1413.779) [-1415.865] * [-1416.141] (-1411.832) (-1412.694) (-1412.488) -- 0:00:42 318000 -- (-1415.424) (-1412.439) (-1417.257) [-1417.721] * (-1418.172) (-1417.104) (-1414.413) [-1412.801] -- 0:00:42 318500 -- (-1412.542) [-1412.221] (-1414.178) (-1412.348) * (-1417.080) (-1414.702) (-1413.315) [-1411.832] -- 0:00:42 319000 -- [-1412.005] (-1413.969) (-1415.475) (-1414.152) * [-1412.442] (-1411.753) (-1412.298) (-1413.155) -- 0:00:42 319500 -- (-1414.377) [-1412.831] (-1414.037) (-1415.435) * (-1411.949) [-1410.897] (-1413.077) (-1414.411) -- 0:00:42 320000 -- (-1415.368) (-1413.859) [-1413.207] (-1414.403) * (-1412.020) (-1411.396) (-1417.007) [-1416.052] -- 0:00:42 Average standard deviation of split frequencies: 0.014701 320500 -- (-1415.062) [-1413.485] (-1412.308) (-1414.441) * [-1413.199] (-1411.675) (-1415.292) (-1418.933) -- 0:00:42 321000 -- [-1414.742] (-1413.908) (-1412.313) (-1412.759) * (-1411.973) [-1415.920] (-1413.655) (-1416.288) -- 0:00:42 321500 -- [-1413.259] (-1414.675) (-1413.630) (-1414.066) * (-1411.186) (-1414.475) [-1412.682] (-1412.275) -- 0:00:42 322000 -- (-1415.404) (-1415.517) [-1410.909] (-1412.082) * [-1411.204] (-1416.290) (-1412.709) (-1411.299) -- 0:00:42 322500 -- (-1423.560) (-1415.925) [-1415.690] (-1412.040) * (-1411.152) (-1412.921) [-1414.515] (-1411.958) -- 0:00:42 323000 -- (-1413.859) (-1414.186) (-1415.971) [-1413.512] * (-1411.246) (-1417.524) (-1413.526) [-1411.822] -- 0:00:41 323500 -- (-1411.617) (-1412.174) (-1411.583) [-1412.535] * (-1411.841) (-1416.234) (-1413.249) [-1412.092] -- 0:00:43 324000 -- (-1414.427) (-1417.049) (-1411.738) [-1413.333] * [-1412.055] (-1413.221) (-1413.294) (-1412.407) -- 0:00:43 324500 -- (-1414.121) (-1414.552) [-1411.739] (-1412.039) * (-1411.955) (-1413.482) (-1414.210) [-1412.154] -- 0:00:43 325000 -- [-1412.999] (-1417.020) (-1413.896) (-1412.559) * (-1413.923) (-1414.594) (-1412.373) [-1411.803] -- 0:00:43 Average standard deviation of split frequencies: 0.013647 325500 -- [-1411.398] (-1414.974) (-1413.302) (-1414.097) * (-1412.719) (-1414.537) [-1418.011] (-1414.433) -- 0:00:43 326000 -- (-1411.967) (-1412.797) (-1412.676) [-1413.602] * (-1412.928) [-1412.198] (-1418.436) (-1414.451) -- 0:00:43 326500 -- (-1412.995) [-1411.646] (-1412.097) (-1413.707) * [-1411.338] (-1412.562) (-1411.698) (-1412.753) -- 0:00:43 327000 -- (-1413.472) (-1411.460) (-1411.311) [-1411.788] * [-1411.376] (-1417.114) (-1413.448) (-1412.959) -- 0:00:43 327500 -- (-1411.876) [-1413.578] (-1412.049) (-1411.899) * (-1411.404) (-1414.696) [-1411.549] (-1412.066) -- 0:00:43 328000 -- (-1411.242) (-1413.522) (-1412.180) [-1413.793] * (-1411.234) [-1414.198] (-1413.047) (-1412.623) -- 0:00:43 328500 -- (-1415.511) (-1413.007) [-1411.513] (-1415.701) * (-1412.604) [-1411.472] (-1413.186) (-1414.868) -- 0:00:42 329000 -- (-1416.472) (-1415.077) [-1413.321] (-1414.978) * (-1416.654) (-1412.521) (-1412.075) [-1411.790] -- 0:00:42 329500 -- [-1414.675] (-1412.962) (-1415.036) (-1414.237) * (-1417.389) [-1412.560] (-1412.752) (-1413.944) -- 0:00:42 330000 -- (-1412.399) [-1413.613] (-1414.426) (-1415.040) * (-1414.088) [-1411.680] (-1411.054) (-1414.343) -- 0:00:42 Average standard deviation of split frequencies: 0.013334 330500 -- (-1411.626) (-1415.375) (-1412.730) [-1415.500] * (-1413.584) [-1411.983] (-1416.100) (-1414.434) -- 0:00:42 331000 -- (-1414.121) [-1413.548] (-1412.420) (-1414.275) * (-1411.254) [-1412.190] (-1415.760) (-1415.588) -- 0:00:42 331500 -- (-1416.909) (-1416.984) (-1415.034) [-1414.223] * [-1411.193] (-1412.198) (-1414.859) (-1411.790) -- 0:00:42 332000 -- (-1417.226) [-1413.793] (-1414.772) (-1415.108) * (-1415.085) (-1413.203) [-1413.268] (-1412.738) -- 0:00:42 332500 -- (-1416.626) (-1411.726) [-1412.357] (-1416.051) * (-1413.801) (-1412.243) (-1412.385) [-1413.123] -- 0:00:42 333000 -- (-1413.039) (-1412.424) [-1411.431] (-1413.736) * (-1411.153) [-1412.247] (-1414.294) (-1412.664) -- 0:00:42 333500 -- (-1414.099) [-1412.640] (-1411.538) (-1412.181) * (-1414.000) (-1413.825) [-1413.381] (-1414.075) -- 0:00:41 334000 -- (-1416.272) (-1412.047) (-1411.773) [-1413.138] * (-1413.554) (-1413.262) [-1411.595] (-1413.862) -- 0:00:41 334500 -- (-1413.336) (-1411.497) [-1417.433] (-1414.002) * (-1415.806) (-1413.247) [-1412.982] (-1417.353) -- 0:00:41 335000 -- (-1413.598) (-1412.282) [-1415.685] (-1410.942) * [-1411.760] (-1414.623) (-1414.046) (-1416.466) -- 0:00:41 Average standard deviation of split frequencies: 0.014112 335500 -- [-1412.117] (-1415.902) (-1415.473) (-1411.413) * (-1411.743) (-1413.390) [-1413.069] (-1413.037) -- 0:00:41 336000 -- (-1414.648) (-1413.079) [-1413.880] (-1411.716) * (-1413.120) [-1414.496] (-1414.193) (-1413.857) -- 0:00:41 336500 -- (-1411.486) (-1413.865) (-1412.569) [-1413.585] * (-1411.391) [-1414.494] (-1414.955) (-1411.804) -- 0:00:41 337000 -- (-1411.803) (-1413.865) (-1413.277) [-1412.598] * (-1414.589) [-1413.293] (-1413.528) (-1412.106) -- 0:00:41 337500 -- (-1411.755) (-1413.039) (-1418.176) [-1413.964] * (-1414.389) (-1416.938) [-1413.564] (-1412.106) -- 0:00:41 338000 -- (-1412.210) [-1415.890] (-1411.948) (-1412.888) * (-1415.423) [-1415.852] (-1414.882) (-1412.106) -- 0:00:41 338500 -- (-1414.891) [-1412.336] (-1415.073) (-1411.496) * (-1414.497) [-1413.038] (-1416.331) (-1413.229) -- 0:00:41 339000 -- (-1413.387) [-1412.669] (-1412.732) (-1411.085) * [-1413.227] (-1418.628) (-1414.335) (-1413.063) -- 0:00:40 339500 -- (-1412.651) [-1411.870] (-1413.861) (-1413.170) * (-1411.891) (-1414.745) [-1414.622] (-1413.093) -- 0:00:42 340000 -- [-1414.069] (-1411.951) (-1415.965) (-1411.133) * (-1413.730) (-1414.744) [-1413.418] (-1413.797) -- 0:00:42 Average standard deviation of split frequencies: 0.014145 340500 -- (-1414.256) [-1417.126] (-1413.789) (-1411.127) * (-1412.550) (-1415.242) (-1413.603) [-1412.401] -- 0:00:42 341000 -- (-1411.771) (-1412.172) (-1416.854) [-1411.975] * (-1412.757) (-1412.233) [-1413.509] (-1416.302) -- 0:00:42 341500 -- (-1411.940) [-1412.905] (-1418.878) (-1412.985) * [-1411.454] (-1411.091) (-1414.036) (-1413.079) -- 0:00:42 342000 -- (-1412.647) [-1412.178] (-1418.702) (-1412.918) * (-1414.261) [-1411.094] (-1412.886) (-1419.089) -- 0:00:42 342500 -- (-1413.811) (-1412.173) (-1413.717) [-1414.006] * [-1416.246] (-1413.637) (-1412.406) (-1415.583) -- 0:00:42 343000 -- (-1414.000) (-1412.091) (-1422.177) [-1413.077] * (-1412.587) (-1413.652) (-1412.353) [-1415.573] -- 0:00:42 343500 -- (-1414.554) (-1414.093) [-1414.325] (-1411.842) * (-1411.886) (-1412.538) [-1412.300] (-1415.538) -- 0:00:42 344000 -- (-1417.394) (-1412.393) (-1414.062) [-1415.400] * [-1412.358] (-1411.897) (-1412.813) (-1412.542) -- 0:00:41 344500 -- (-1417.915) (-1414.573) (-1414.445) [-1414.245] * [-1411.984] (-1414.228) (-1412.602) (-1417.140) -- 0:00:41 345000 -- (-1415.085) (-1411.917) (-1411.930) [-1412.287] * [-1411.943] (-1419.331) (-1411.469) (-1412.235) -- 0:00:41 Average standard deviation of split frequencies: 0.013549 345500 -- (-1420.599) (-1416.419) (-1413.619) [-1411.415] * (-1414.160) (-1415.660) [-1413.168] (-1416.739) -- 0:00:41 346000 -- (-1413.072) (-1412.291) (-1412.696) [-1413.418] * (-1412.780) (-1412.204) [-1415.902] (-1411.963) -- 0:00:41 346500 -- [-1411.319] (-1412.664) (-1412.173) (-1412.470) * [-1414.176] (-1412.609) (-1414.764) (-1411.654) -- 0:00:41 347000 -- (-1411.527) (-1413.467) [-1412.960] (-1415.301) * [-1411.445] (-1415.410) (-1414.107) (-1414.323) -- 0:00:41 347500 -- [-1411.350] (-1413.725) (-1411.509) (-1413.445) * [-1412.654] (-1413.670) (-1413.667) (-1412.860) -- 0:00:41 348000 -- (-1411.709) (-1413.023) (-1411.768) [-1411.773] * (-1411.431) (-1412.667) (-1416.520) [-1412.209] -- 0:00:41 348500 -- [-1414.776] (-1413.092) (-1418.730) (-1411.894) * (-1411.190) (-1412.613) [-1412.088] (-1413.112) -- 0:00:41 349000 -- (-1412.380) (-1416.658) [-1412.771] (-1411.913) * (-1412.284) [-1412.950] (-1411.697) (-1413.639) -- 0:00:41 349500 -- (-1412.357) (-1416.515) [-1412.882] (-1415.445) * (-1417.757) [-1414.164] (-1413.797) (-1416.508) -- 0:00:40 350000 -- (-1412.465) [-1415.271] (-1413.442) (-1416.501) * (-1413.966) (-1413.727) [-1414.704] (-1420.531) -- 0:00:40 Average standard deviation of split frequencies: 0.013219 350500 -- [-1413.184] (-1414.799) (-1415.038) (-1411.718) * (-1411.811) [-1415.113] (-1416.074) (-1414.276) -- 0:00:40 351000 -- [-1413.619] (-1412.593) (-1412.988) (-1412.507) * (-1413.110) (-1417.559) [-1412.925] (-1411.567) -- 0:00:40 351500 -- (-1414.263) [-1413.242] (-1415.864) (-1413.891) * (-1413.058) [-1412.840] (-1413.711) (-1411.551) -- 0:00:40 352000 -- (-1411.457) (-1413.248) (-1414.844) [-1412.967] * (-1412.843) (-1412.497) (-1415.207) [-1414.086] -- 0:00:40 352500 -- (-1411.846) [-1412.810] (-1414.548) (-1413.020) * (-1412.777) (-1413.664) [-1416.016] (-1417.637) -- 0:00:40 353000 -- (-1413.637) (-1414.065) (-1411.508) [-1413.638] * (-1413.517) [-1415.622] (-1415.747) (-1414.974) -- 0:00:40 353500 -- (-1412.583) (-1413.532) [-1412.643] (-1413.502) * (-1413.251) [-1416.501] (-1414.214) (-1416.268) -- 0:00:40 354000 -- (-1413.161) [-1411.887] (-1416.830) (-1414.426) * (-1414.375) [-1413.873] (-1415.494) (-1413.729) -- 0:00:40 354500 -- [-1413.544] (-1412.835) (-1413.455) (-1412.867) * [-1412.218] (-1412.928) (-1416.305) (-1413.180) -- 0:00:40 355000 -- [-1415.551] (-1413.728) (-1415.393) (-1411.923) * (-1417.079) [-1414.006] (-1416.581) (-1411.722) -- 0:00:39 Average standard deviation of split frequencies: 0.013475 355500 -- [-1412.717] (-1415.051) (-1415.866) (-1411.258) * (-1412.985) (-1415.815) [-1415.500] (-1411.665) -- 0:00:41 356000 -- (-1412.319) (-1414.078) (-1412.723) [-1413.959] * [-1413.467] (-1412.440) (-1412.691) (-1411.851) -- 0:00:41 356500 -- (-1416.897) [-1412.417] (-1416.210) (-1413.604) * (-1412.980) [-1412.990] (-1416.421) (-1413.013) -- 0:00:41 357000 -- (-1412.860) [-1412.599] (-1416.855) (-1414.660) * (-1414.138) [-1413.441] (-1415.114) (-1418.382) -- 0:00:41 357500 -- (-1415.712) [-1413.137] (-1411.306) (-1415.966) * [-1412.082] (-1414.029) (-1412.676) (-1419.856) -- 0:00:41 358000 -- [-1412.554] (-1413.508) (-1414.006) (-1413.849) * (-1412.369) (-1412.497) [-1414.767] (-1419.849) -- 0:00:41 358500 -- (-1415.552) (-1415.579) (-1412.472) [-1416.728] * [-1412.996] (-1414.367) (-1412.783) (-1415.375) -- 0:00:41 359000 -- (-1411.717) [-1412.577] (-1413.296) (-1413.971) * [-1411.813] (-1413.295) (-1411.412) (-1414.247) -- 0:00:41 359500 -- (-1413.501) (-1414.020) [-1412.182] (-1414.746) * (-1412.291) (-1413.719) [-1411.474] (-1414.921) -- 0:00:40 360000 -- [-1412.068] (-1414.341) (-1412.922) (-1414.003) * (-1412.583) (-1413.713) (-1411.925) [-1413.150] -- 0:00:40 Average standard deviation of split frequencies: 0.013762 360500 -- (-1413.477) (-1414.636) (-1412.323) [-1415.373] * (-1413.683) [-1411.172] (-1411.519) (-1411.566) -- 0:00:40 361000 -- [-1413.804] (-1416.956) (-1411.311) (-1412.308) * (-1415.302) (-1411.849) [-1412.948] (-1413.987) -- 0:00:40 361500 -- (-1413.874) (-1417.709) (-1411.548) [-1413.848] * (-1416.178) [-1411.568] (-1411.922) (-1413.220) -- 0:00:40 362000 -- (-1414.432) (-1415.789) [-1412.428] (-1413.019) * (-1413.157) [-1412.061] (-1411.818) (-1413.000) -- 0:00:40 362500 -- (-1414.660) (-1412.125) [-1412.099] (-1415.145) * (-1418.557) (-1415.139) (-1414.187) [-1412.969] -- 0:00:40 363000 -- (-1413.998) (-1415.083) (-1412.394) [-1411.271] * [-1420.330] (-1412.288) (-1414.522) (-1413.997) -- 0:00:40 363500 -- (-1414.003) (-1412.027) (-1411.218) [-1411.129] * (-1421.214) [-1416.494] (-1413.597) (-1414.789) -- 0:00:40 364000 -- (-1413.921) (-1415.468) (-1416.373) [-1411.370] * (-1416.118) (-1417.368) (-1415.250) [-1411.745] -- 0:00:40 364500 -- (-1413.606) [-1411.575] (-1413.515) (-1411.357) * (-1414.669) (-1413.798) (-1415.150) [-1412.537] -- 0:00:40 365000 -- [-1414.348] (-1411.619) (-1413.452) (-1411.597) * [-1412.256] (-1411.316) (-1415.001) (-1412.428) -- 0:00:40 Average standard deviation of split frequencies: 0.012956 365500 -- (-1413.664) (-1413.929) [-1413.944] (-1411.798) * (-1415.215) [-1415.957] (-1416.923) (-1414.148) -- 0:00:39 366000 -- (-1415.414) (-1412.441) (-1413.220) [-1410.990] * (-1413.844) (-1414.491) (-1412.386) [-1413.112] -- 0:00:39 366500 -- (-1413.265) (-1412.668) (-1415.688) [-1411.743] * (-1412.812) [-1414.724] (-1413.181) (-1412.963) -- 0:00:39 367000 -- [-1413.093] (-1413.893) (-1415.075) (-1412.167) * [-1411.563] (-1412.711) (-1413.051) (-1413.351) -- 0:00:39 367500 -- (-1413.045) (-1413.849) (-1415.226) [-1413.317] * (-1412.633) [-1412.001] (-1412.171) (-1414.929) -- 0:00:39 368000 -- (-1412.335) (-1412.804) (-1413.303) [-1411.862] * (-1413.801) (-1411.744) [-1412.662] (-1416.613) -- 0:00:39 368500 -- (-1412.662) [-1419.275] (-1412.328) (-1412.429) * (-1412.286) (-1412.943) (-1413.997) [-1414.902] -- 0:00:39 369000 -- (-1413.398) (-1413.229) (-1415.508) [-1414.087] * (-1413.073) [-1411.781] (-1414.258) (-1413.373) -- 0:00:39 369500 -- (-1412.384) (-1414.739) [-1412.675] (-1413.656) * (-1413.242) (-1411.502) (-1413.482) [-1414.037] -- 0:00:39 370000 -- (-1412.979) (-1414.522) [-1412.873] (-1411.704) * [-1413.489] (-1413.202) (-1412.625) (-1415.145) -- 0:00:39 Average standard deviation of split frequencies: 0.012942 370500 -- (-1414.651) (-1414.472) (-1412.770) [-1411.795] * (-1412.869) [-1411.978] (-1412.512) (-1414.907) -- 0:00:39 371000 -- (-1412.250) (-1416.619) [-1412.702] (-1412.320) * [-1412.855] (-1412.579) (-1415.950) (-1419.911) -- 0:00:40 371500 -- (-1412.343) [-1418.614] (-1413.380) (-1413.633) * (-1412.732) (-1411.466) (-1412.331) [-1412.966] -- 0:00:40 372000 -- (-1412.622) (-1419.874) (-1411.401) [-1411.736] * (-1411.947) (-1411.539) [-1413.908] (-1412.345) -- 0:00:40 372500 -- (-1414.003) (-1416.910) [-1412.206] (-1411.714) * (-1413.518) [-1413.762] (-1414.982) (-1412.268) -- 0:00:40 373000 -- (-1415.806) (-1418.122) (-1411.858) [-1413.461] * [-1412.702] (-1415.544) (-1411.695) (-1412.842) -- 0:00:40 373500 -- [-1411.259] (-1417.299) (-1412.829) (-1413.059) * (-1413.189) (-1413.429) [-1412.434] (-1414.088) -- 0:00:40 374000 -- (-1411.341) (-1412.877) [-1411.816] (-1413.207) * (-1419.120) [-1413.719] (-1412.179) (-1413.526) -- 0:00:40 374500 -- (-1413.218) (-1413.291) [-1413.109] (-1413.982) * (-1412.085) [-1413.149] (-1412.394) (-1413.334) -- 0:00:40 375000 -- (-1411.702) [-1413.508] (-1413.583) (-1413.718) * (-1411.970) (-1414.396) [-1412.407] (-1412.634) -- 0:00:40 Average standard deviation of split frequencies: 0.012611 375500 -- [-1411.380] (-1411.142) (-1413.615) (-1413.561) * (-1411.697) (-1414.658) (-1413.153) [-1411.882] -- 0:00:39 376000 -- (-1412.606) (-1415.690) (-1414.055) [-1412.419] * (-1412.041) [-1416.206] (-1413.070) (-1413.586) -- 0:00:39 376500 -- (-1413.669) [-1414.388] (-1415.921) (-1412.340) * (-1413.513) (-1414.051) [-1414.472] (-1413.440) -- 0:00:39 377000 -- (-1414.695) [-1413.332] (-1414.459) (-1416.404) * [-1411.797] (-1411.303) (-1414.011) (-1413.767) -- 0:00:39 377500 -- (-1414.111) (-1411.973) (-1413.544) [-1417.041] * (-1412.977) [-1412.605] (-1415.737) (-1417.569) -- 0:00:39 378000 -- [-1413.224] (-1412.261) (-1414.230) (-1412.664) * [-1412.968] (-1412.423) (-1414.043) (-1412.191) -- 0:00:39 378500 -- (-1414.378) (-1415.190) [-1412.103] (-1412.165) * (-1413.531) [-1412.354] (-1412.754) (-1414.211) -- 0:00:39 379000 -- (-1411.757) (-1415.579) [-1413.730] (-1411.355) * (-1413.984) [-1411.612] (-1415.870) (-1416.496) -- 0:00:39 379500 -- [-1415.178] (-1415.112) (-1411.121) (-1412.790) * (-1414.820) [-1413.100] (-1413.995) (-1420.746) -- 0:00:39 380000 -- (-1416.712) [-1413.456] (-1415.120) (-1413.026) * (-1413.676) (-1416.352) [-1411.106] (-1412.687) -- 0:00:39 Average standard deviation of split frequencies: 0.010733 380500 -- (-1413.586) (-1415.279) (-1412.566) [-1412.440] * (-1415.147) [-1416.482] (-1411.490) (-1412.272) -- 0:00:39 381000 -- (-1413.083) [-1413.815] (-1414.460) (-1411.792) * (-1412.354) (-1413.117) (-1411.333) [-1411.888] -- 0:00:38 381500 -- (-1415.976) (-1412.885) [-1413.017] (-1411.952) * (-1411.730) (-1412.555) (-1412.418) [-1411.631] -- 0:00:38 382000 -- (-1411.911) (-1415.163) [-1414.760] (-1412.311) * [-1413.527] (-1413.168) (-1414.369) (-1414.536) -- 0:00:38 382500 -- (-1411.477) [-1412.480] (-1414.125) (-1412.334) * (-1411.792) [-1412.237] (-1412.662) (-1416.507) -- 0:00:38 383000 -- (-1412.202) [-1412.531] (-1416.928) (-1412.337) * (-1412.903) [-1411.869] (-1412.741) (-1412.348) -- 0:00:38 383500 -- (-1414.349) (-1414.632) [-1411.696] (-1411.752) * (-1414.377) (-1412.042) (-1414.814) [-1412.563] -- 0:00:38 384000 -- (-1413.549) [-1412.752] (-1414.945) (-1412.095) * (-1412.318) (-1412.747) (-1412.991) [-1415.389] -- 0:00:38 384500 -- (-1412.717) (-1412.751) (-1412.783) [-1413.051] * [-1412.334] (-1413.246) (-1412.227) (-1413.837) -- 0:00:38 385000 -- [-1412.345] (-1416.939) (-1412.189) (-1415.907) * (-1414.535) (-1412.078) [-1414.392] (-1413.002) -- 0:00:38 Average standard deviation of split frequencies: 0.009770 385500 -- (-1414.956) (-1412.086) [-1414.691] (-1419.302) * [-1413.396] (-1412.910) (-1415.459) (-1412.911) -- 0:00:38 386000 -- [-1414.528] (-1417.729) (-1415.290) (-1422.074) * (-1414.124) (-1411.696) (-1412.825) [-1412.957] -- 0:00:38 386500 -- (-1413.095) (-1413.873) [-1412.830] (-1421.831) * (-1411.875) (-1412.769) [-1412.526] (-1416.915) -- 0:00:38 387000 -- (-1415.798) [-1417.258] (-1414.061) (-1413.793) * (-1415.688) (-1412.689) (-1416.812) [-1414.298] -- 0:00:39 387500 -- (-1414.257) [-1413.498] (-1413.223) (-1415.139) * (-1414.117) (-1412.205) [-1411.816] (-1412.235) -- 0:00:39 388000 -- (-1416.237) (-1414.070) [-1411.260] (-1415.464) * (-1415.395) [-1412.651] (-1412.579) (-1414.859) -- 0:00:39 388500 -- [-1415.092] (-1412.871) (-1411.348) (-1414.889) * (-1414.526) (-1414.805) (-1414.439) [-1413.170] -- 0:00:39 389000 -- (-1416.191) (-1417.098) (-1413.061) [-1412.886] * [-1415.296] (-1414.299) (-1413.847) (-1412.914) -- 0:00:39 389500 -- (-1419.446) (-1415.870) [-1414.838] (-1412.328) * (-1414.668) (-1414.585) [-1412.473] (-1411.811) -- 0:00:39 390000 -- [-1414.454] (-1414.086) (-1412.512) (-1411.401) * [-1413.920] (-1414.714) (-1414.731) (-1415.240) -- 0:00:39 Average standard deviation of split frequencies: 0.009720 390500 -- [-1413.757] (-1414.714) (-1414.215) (-1412.051) * [-1413.310] (-1414.879) (-1412.084) (-1413.101) -- 0:00:39 391000 -- (-1417.028) [-1414.509] (-1413.530) (-1412.899) * (-1412.951) (-1413.680) (-1412.372) [-1413.496] -- 0:00:38 391500 -- (-1413.290) (-1412.321) [-1412.413] (-1413.814) * (-1420.283) (-1412.288) (-1414.076) [-1412.982] -- 0:00:38 392000 -- (-1411.659) (-1412.067) (-1415.665) [-1412.736] * (-1414.312) (-1413.842) (-1416.593) [-1413.185] -- 0:00:38 392500 -- (-1412.824) [-1411.897] (-1413.393) (-1412.736) * (-1413.740) (-1415.574) (-1420.088) [-1411.849] -- 0:00:38 393000 -- (-1415.104) (-1415.627) (-1415.937) [-1411.826] * (-1414.884) (-1415.216) [-1415.801] (-1412.521) -- 0:00:38 393500 -- (-1413.398) [-1414.802] (-1411.462) (-1414.635) * (-1415.713) [-1415.130] (-1412.870) (-1412.285) -- 0:00:38 394000 -- (-1413.308) (-1413.032) (-1413.825) [-1413.272] * [-1415.709] (-1412.333) (-1412.838) (-1415.225) -- 0:00:38 394500 -- [-1413.307] (-1411.786) (-1413.715) (-1420.385) * (-1413.970) [-1412.916] (-1414.388) (-1417.753) -- 0:00:38 395000 -- (-1411.348) (-1411.629) [-1413.700] (-1410.980) * (-1414.237) [-1412.437] (-1415.016) (-1413.112) -- 0:00:38 Average standard deviation of split frequencies: 0.009733 395500 -- (-1411.842) (-1412.182) (-1411.565) [-1411.892] * [-1413.674] (-1412.568) (-1413.297) (-1412.294) -- 0:00:38 396000 -- (-1411.963) [-1412.106] (-1412.193) (-1411.858) * (-1414.557) (-1411.662) (-1413.214) [-1415.403] -- 0:00:38 396500 -- (-1414.316) (-1416.508) [-1411.745] (-1415.172) * (-1413.152) (-1412.605) (-1413.352) [-1419.105] -- 0:00:38 397000 -- (-1414.283) (-1413.755) [-1411.863] (-1411.892) * (-1412.866) [-1412.439] (-1412.995) (-1415.680) -- 0:00:37 397500 -- (-1412.372) (-1412.883) (-1412.029) [-1415.213] * (-1414.609) (-1412.534) [-1414.715] (-1413.383) -- 0:00:37 398000 -- [-1413.764] (-1413.498) (-1412.960) (-1415.020) * (-1414.589) (-1414.641) (-1412.245) [-1418.755] -- 0:00:37 398500 -- (-1413.596) (-1414.306) (-1414.018) [-1413.198] * (-1415.504) (-1412.509) [-1412.866] (-1412.860) -- 0:00:37 399000 -- (-1416.559) (-1413.942) (-1413.281) [-1411.574] * (-1415.199) (-1412.560) (-1415.587) [-1412.500] -- 0:00:37 399500 -- (-1415.305) (-1415.172) [-1412.477] (-1412.360) * (-1414.667) [-1412.591] (-1420.065) (-1413.501) -- 0:00:37 400000 -- (-1416.739) (-1413.997) [-1413.238] (-1413.215) * (-1414.749) (-1413.910) (-1418.172) [-1415.295] -- 0:00:37 Average standard deviation of split frequencies: 0.009870 400500 -- (-1418.272) (-1415.172) [-1413.236] (-1412.294) * [-1414.952] (-1412.629) (-1414.375) (-1414.044) -- 0:00:37 401000 -- (-1412.141) [-1414.694] (-1411.751) (-1412.959) * (-1414.395) (-1414.136) (-1412.738) [-1412.242] -- 0:00:37 401500 -- (-1413.477) (-1414.616) (-1415.692) [-1412.857] * (-1413.096) (-1415.236) (-1412.777) [-1413.050] -- 0:00:37 402000 -- (-1416.652) [-1417.404] (-1414.088) (-1414.272) * (-1411.941) (-1416.841) [-1412.374] (-1415.284) -- 0:00:37 402500 -- [-1413.685] (-1414.189) (-1413.312) (-1414.523) * (-1415.540) (-1412.561) [-1413.786] (-1416.510) -- 0:00:37 403000 -- (-1414.291) (-1413.504) (-1414.790) [-1414.941] * (-1414.551) [-1412.631] (-1412.027) (-1414.195) -- 0:00:38 403500 -- [-1411.410] (-1414.389) (-1412.701) (-1415.691) * (-1415.755) (-1415.952) (-1411.921) [-1414.244] -- 0:00:38 404000 -- (-1416.490) (-1412.589) (-1412.180) [-1411.749] * [-1412.337] (-1418.533) (-1415.137) (-1415.756) -- 0:00:38 404500 -- [-1414.154] (-1413.283) (-1414.226) (-1413.285) * [-1413.222] (-1415.766) (-1414.444) (-1413.511) -- 0:00:38 405000 -- [-1413.586] (-1410.928) (-1413.293) (-1414.855) * [-1411.882] (-1414.790) (-1415.322) (-1413.886) -- 0:00:38 Average standard deviation of split frequencies: 0.010063 405500 -- (-1413.053) (-1414.212) [-1413.501] (-1414.533) * [-1411.634] (-1413.972) (-1413.564) (-1414.565) -- 0:00:38 406000 -- [-1414.491] (-1413.774) (-1412.664) (-1413.627) * (-1413.078) (-1413.026) [-1413.478] (-1412.681) -- 0:00:38 406500 -- (-1413.989) (-1413.037) [-1411.342] (-1413.596) * (-1413.837) [-1413.998] (-1414.757) (-1413.223) -- 0:00:37 407000 -- (-1416.722) (-1412.570) (-1411.555) [-1411.818] * (-1413.402) (-1412.242) (-1413.399) [-1414.618] -- 0:00:37 407500 -- (-1413.469) [-1411.230] (-1411.037) (-1412.606) * (-1412.474) [-1411.862] (-1414.484) (-1414.371) -- 0:00:37 408000 -- (-1415.439) (-1412.597) (-1413.961) [-1412.616] * [-1412.467] (-1412.829) (-1412.630) (-1412.743) -- 0:00:37 408500 -- (-1411.913) (-1412.594) (-1413.213) [-1419.081] * (-1413.221) (-1413.710) [-1412.135] (-1413.239) -- 0:00:37 409000 -- [-1414.064] (-1413.691) (-1412.565) (-1417.278) * (-1413.734) (-1412.986) (-1413.986) [-1414.211] -- 0:00:37 409500 -- (-1414.859) (-1413.704) (-1413.025) [-1412.913] * [-1411.366] (-1413.837) (-1413.866) (-1414.256) -- 0:00:37 410000 -- [-1413.355] (-1416.038) (-1412.765) (-1412.122) * (-1414.716) [-1413.342] (-1414.073) (-1415.311) -- 0:00:37 Average standard deviation of split frequencies: 0.010546 410500 -- (-1415.176) [-1414.281] (-1413.973) (-1412.208) * (-1413.355) [-1411.751] (-1411.834) (-1416.047) -- 0:00:37 411000 -- (-1412.770) (-1414.866) (-1412.294) [-1411.744] * (-1411.487) [-1411.176] (-1412.364) (-1414.528) -- 0:00:37 411500 -- (-1414.605) (-1414.396) [-1413.470] (-1411.465) * [-1414.528] (-1410.965) (-1414.610) (-1413.891) -- 0:00:37 412000 -- (-1420.158) (-1411.418) (-1419.448) [-1414.624] * (-1411.563) (-1413.317) [-1412.675] (-1415.112) -- 0:00:37 412500 -- (-1411.602) (-1411.283) (-1414.410) [-1412.194] * (-1411.830) (-1412.098) [-1413.596] (-1412.649) -- 0:00:37 413000 -- (-1415.355) (-1411.885) (-1415.003) [-1411.400] * [-1411.372] (-1416.328) (-1414.091) (-1413.199) -- 0:00:36 413500 -- [-1411.917] (-1413.967) (-1412.431) (-1411.382) * (-1413.750) (-1416.556) (-1413.811) [-1411.445] -- 0:00:36 414000 -- (-1411.047) (-1412.132) [-1415.088] (-1411.536) * (-1418.495) (-1414.575) (-1411.683) [-1411.280] -- 0:00:36 414500 -- [-1413.209] (-1413.347) (-1413.362) (-1411.273) * (-1414.053) (-1418.542) (-1412.353) [-1412.947] -- 0:00:36 415000 -- [-1416.087] (-1415.241) (-1414.030) (-1415.160) * (-1414.240) (-1419.240) [-1412.207] (-1412.227) -- 0:00:36 Average standard deviation of split frequencies: 0.011181 415500 -- [-1411.084] (-1414.880) (-1412.342) (-1414.625) * (-1412.848) (-1413.871) (-1411.983) [-1412.838] -- 0:00:36 416000 -- [-1411.719] (-1414.881) (-1413.659) (-1411.735) * (-1412.853) (-1415.320) (-1414.993) [-1412.841] -- 0:00:36 416500 -- (-1412.372) (-1415.612) [-1412.092] (-1413.773) * (-1412.021) (-1415.379) [-1413.240] (-1411.728) -- 0:00:36 417000 -- (-1412.566) (-1412.400) [-1413.099] (-1414.888) * (-1412.936) (-1415.363) (-1415.467) [-1415.266] -- 0:00:36 417500 -- [-1412.414] (-1416.193) (-1413.635) (-1413.736) * [-1413.554] (-1411.464) (-1412.765) (-1412.158) -- 0:00:36 418000 -- (-1411.405) [-1413.418] (-1415.343) (-1413.003) * (-1412.642) (-1411.652) [-1412.699] (-1411.455) -- 0:00:36 418500 -- (-1412.883) (-1415.751) [-1414.261] (-1415.863) * (-1415.797) (-1411.764) (-1413.418) [-1411.393] -- 0:00:36 419000 -- [-1412.767] (-1412.413) (-1412.874) (-1411.409) * (-1420.365) (-1412.204) (-1413.144) [-1411.882] -- 0:00:37 419500 -- (-1412.717) (-1412.080) [-1413.240] (-1412.962) * [-1416.436] (-1415.363) (-1412.708) (-1413.269) -- 0:00:37 420000 -- (-1413.306) (-1412.369) [-1413.038] (-1412.077) * (-1415.384) (-1412.252) (-1416.028) [-1412.395] -- 0:00:37 Average standard deviation of split frequencies: 0.011057 420500 -- (-1411.931) (-1415.383) (-1413.187) [-1413.005] * (-1412.152) (-1415.416) [-1412.691] (-1413.619) -- 0:00:37 421000 -- (-1412.740) (-1412.844) [-1413.690] (-1416.377) * (-1414.391) [-1412.242] (-1414.336) (-1418.803) -- 0:00:37 421500 -- (-1417.317) (-1410.972) [-1412.451] (-1414.284) * (-1411.936) [-1411.362] (-1415.512) (-1411.969) -- 0:00:37 422000 -- [-1415.742] (-1413.588) (-1414.268) (-1413.226) * [-1415.338] (-1414.489) (-1412.285) (-1411.941) -- 0:00:36 422500 -- (-1415.009) (-1412.472) [-1413.091] (-1415.969) * [-1414.663] (-1413.393) (-1416.890) (-1412.956) -- 0:00:36 423000 -- (-1414.952) [-1412.708] (-1413.273) (-1413.940) * (-1411.931) (-1415.226) (-1412.921) [-1418.827] -- 0:00:36 423500 -- [-1413.761] (-1414.274) (-1412.810) (-1412.979) * (-1412.889) (-1418.357) (-1412.735) [-1414.720] -- 0:00:36 424000 -- (-1415.634) (-1413.452) [-1413.438] (-1412.053) * (-1413.947) [-1415.278] (-1414.197) (-1413.358) -- 0:00:36 424500 -- (-1416.449) (-1415.856) (-1413.712) [-1411.636] * [-1412.423] (-1415.137) (-1413.840) (-1415.346) -- 0:00:36 425000 -- (-1417.118) (-1415.725) [-1416.485] (-1413.036) * [-1413.171] (-1418.218) (-1416.114) (-1415.114) -- 0:00:36 Average standard deviation of split frequencies: 0.011730 425500 -- (-1413.340) (-1413.349) [-1413.941] (-1413.066) * [-1412.579] (-1412.103) (-1416.169) (-1417.746) -- 0:00:36 426000 -- (-1412.098) [-1414.358] (-1415.160) (-1414.139) * [-1412.115] (-1411.794) (-1414.541) (-1418.855) -- 0:00:36 426500 -- (-1413.347) (-1414.655) [-1414.895] (-1412.720) * [-1413.858] (-1412.740) (-1413.797) (-1412.218) -- 0:00:36 427000 -- (-1413.585) (-1414.838) [-1412.539] (-1412.926) * (-1414.498) (-1411.447) (-1420.576) [-1414.399] -- 0:00:36 427500 -- (-1413.704) [-1413.476] (-1412.268) (-1413.782) * (-1414.413) (-1411.472) (-1416.284) [-1415.064] -- 0:00:36 428000 -- (-1413.384) [-1412.185] (-1415.746) (-1415.143) * (-1414.366) (-1411.285) [-1416.595] (-1412.429) -- 0:00:36 428500 -- [-1413.068] (-1411.952) (-1412.635) (-1412.382) * [-1416.426] (-1411.271) (-1416.085) (-1413.114) -- 0:00:36 429000 -- [-1414.883] (-1411.925) (-1412.247) (-1412.060) * (-1413.287) (-1411.701) (-1414.071) [-1413.958] -- 0:00:35 429500 -- (-1413.606) (-1413.854) (-1413.042) [-1411.738] * (-1411.261) [-1412.692] (-1413.949) (-1413.841) -- 0:00:35 430000 -- (-1414.391) (-1412.135) [-1412.923] (-1416.051) * [-1416.705] (-1420.434) (-1412.448) (-1415.712) -- 0:00:35 Average standard deviation of split frequencies: 0.011384 430500 -- (-1414.084) [-1413.957] (-1411.528) (-1411.305) * (-1412.017) (-1415.020) [-1416.344] (-1415.242) -- 0:00:35 431000 -- (-1411.925) (-1413.952) [-1413.006] (-1414.163) * (-1413.091) (-1413.060) (-1413.920) [-1413.374] -- 0:00:35 431500 -- (-1412.690) (-1414.663) (-1413.060) [-1412.168] * [-1412.346] (-1411.499) (-1415.194) (-1414.813) -- 0:00:35 432000 -- (-1413.757) (-1416.614) (-1415.384) [-1411.437] * [-1412.819] (-1411.933) (-1414.081) (-1421.962) -- 0:00:35 432500 -- (-1414.376) (-1417.268) (-1413.208) [-1414.258] * (-1411.513) [-1412.013] (-1411.432) (-1414.108) -- 0:00:35 433000 -- (-1414.002) (-1416.028) [-1414.048] (-1416.270) * (-1415.028) [-1414.121] (-1411.815) (-1414.628) -- 0:00:35 433500 -- (-1413.228) (-1416.405) (-1414.791) [-1413.968] * [-1414.338] (-1414.011) (-1413.642) (-1411.831) -- 0:00:35 434000 -- [-1414.124] (-1411.423) (-1411.636) (-1415.603) * (-1414.475) [-1413.249] (-1414.807) (-1411.919) -- 0:00:35 434500 -- (-1412.244) (-1413.280) [-1411.833] (-1418.018) * (-1412.939) (-1413.235) (-1414.107) [-1412.375] -- 0:00:35 435000 -- (-1418.110) (-1412.191) [-1412.377] (-1412.664) * (-1414.733) (-1415.509) [-1413.354] (-1412.896) -- 0:00:36 Average standard deviation of split frequencies: 0.011257 435500 -- (-1416.979) (-1412.659) [-1413.786] (-1412.398) * [-1414.559] (-1412.140) (-1414.371) (-1413.499) -- 0:00:36 436000 -- (-1414.666) [-1413.436] (-1413.491) (-1411.816) * [-1412.722] (-1411.795) (-1414.099) (-1416.410) -- 0:00:36 436500 -- (-1412.651) (-1416.028) [-1413.973] (-1418.982) * [-1411.529] (-1411.797) (-1414.134) (-1411.131) -- 0:00:36 437000 -- [-1411.917] (-1415.854) (-1417.467) (-1415.755) * (-1411.843) (-1413.409) (-1413.619) [-1415.012] -- 0:00:36 437500 -- (-1412.914) (-1413.250) (-1413.631) [-1412.784] * [-1412.637] (-1412.767) (-1413.792) (-1416.701) -- 0:00:36 438000 -- (-1411.347) (-1412.987) (-1412.536) [-1411.822] * (-1416.553) [-1412.722] (-1415.945) (-1420.252) -- 0:00:35 438500 -- (-1416.076) (-1411.896) (-1413.371) [-1412.527] * (-1414.194) [-1413.175] (-1414.540) (-1416.083) -- 0:00:35 439000 -- (-1412.754) [-1415.229] (-1414.732) (-1412.330) * (-1419.000) (-1413.113) [-1420.041] (-1415.243) -- 0:00:35 439500 -- [-1414.274] (-1414.983) (-1416.091) (-1414.127) * (-1417.205) (-1413.802) [-1413.453] (-1414.731) -- 0:00:35 440000 -- (-1413.971) (-1413.736) [-1418.998] (-1416.878) * (-1414.706) (-1413.091) [-1412.957] (-1411.764) -- 0:00:35 Average standard deviation of split frequencies: 0.011366 440500 -- (-1411.252) (-1412.874) (-1414.501) [-1415.801] * (-1411.622) [-1414.975] (-1411.889) (-1414.794) -- 0:00:35 441000 -- (-1411.497) [-1412.876] (-1413.986) (-1416.246) * (-1414.499) [-1412.549] (-1412.292) (-1415.144) -- 0:00:35 441500 -- (-1412.427) [-1412.097] (-1414.751) (-1413.107) * (-1414.355) [-1414.714] (-1411.445) (-1418.127) -- 0:00:35 442000 -- [-1412.368] (-1412.424) (-1412.901) (-1413.317) * (-1417.559) [-1412.116] (-1414.429) (-1417.247) -- 0:00:35 442500 -- [-1413.432] (-1412.060) (-1411.455) (-1415.201) * (-1412.128) (-1412.310) (-1411.434) [-1415.576] -- 0:00:35 443000 -- [-1415.351] (-1412.824) (-1415.711) (-1413.443) * (-1412.417) (-1413.044) (-1411.313) [-1417.434] -- 0:00:35 443500 -- [-1411.774] (-1414.465) (-1415.608) (-1414.962) * (-1412.431) (-1413.616) [-1412.642] (-1412.406) -- 0:00:35 444000 -- (-1411.678) (-1413.071) (-1416.556) [-1413.074] * (-1413.893) [-1414.984] (-1412.436) (-1413.169) -- 0:00:35 444500 -- [-1412.601] (-1411.229) (-1412.131) (-1413.641) * (-1422.095) (-1412.858) (-1411.786) [-1415.306] -- 0:00:34 445000 -- (-1414.768) (-1413.303) [-1414.653] (-1414.399) * (-1413.848) (-1414.695) [-1411.219] (-1412.295) -- 0:00:34 Average standard deviation of split frequencies: 0.012435 445500 -- (-1411.578) [-1416.042] (-1414.994) (-1414.056) * (-1413.253) [-1414.772] (-1411.219) (-1415.357) -- 0:00:34 446000 -- (-1414.731) (-1418.648) (-1414.853) [-1414.780] * (-1412.722) (-1413.266) (-1411.219) [-1415.422] -- 0:00:34 446500 -- (-1412.996) (-1415.246) (-1413.803) [-1413.885] * [-1414.395] (-1411.200) (-1411.328) (-1413.488) -- 0:00:34 447000 -- (-1413.034) (-1415.588) [-1411.733] (-1411.694) * (-1411.082) (-1411.140) [-1411.473] (-1413.175) -- 0:00:34 447500 -- (-1412.225) (-1413.238) [-1411.635] (-1412.673) * (-1414.462) (-1412.425) (-1413.048) [-1411.706] -- 0:00:34 448000 -- (-1412.946) (-1413.254) [-1411.481] (-1413.798) * [-1414.821] (-1414.698) (-1412.207) (-1413.245) -- 0:00:34 448500 -- [-1413.011] (-1416.344) (-1411.951) (-1414.485) * [-1413.309] (-1414.824) (-1411.223) (-1412.944) -- 0:00:34 449000 -- (-1411.872) (-1415.809) (-1412.592) [-1415.770] * (-1415.600) [-1413.784] (-1414.213) (-1412.709) -- 0:00:34 449500 -- (-1412.652) (-1414.688) (-1411.521) [-1414.371] * [-1415.318] (-1415.085) (-1414.461) (-1416.265) -- 0:00:34 450000 -- [-1412.974] (-1414.018) (-1411.532) (-1415.248) * [-1415.939] (-1415.219) (-1413.682) (-1420.824) -- 0:00:34 Average standard deviation of split frequencies: 0.012245 450500 -- [-1413.905] (-1413.683) (-1412.802) (-1414.155) * [-1413.956] (-1414.945) (-1414.223) (-1416.259) -- 0:00:34 451000 -- (-1412.651) [-1412.593] (-1412.802) (-1411.866) * (-1416.141) [-1414.100] (-1412.790) (-1412.706) -- 0:00:35 451500 -- (-1412.234) (-1417.058) (-1414.100) [-1412.879] * (-1413.636) (-1417.848) (-1412.729) [-1415.409] -- 0:00:35 452000 -- [-1411.433] (-1417.408) (-1413.856) (-1413.693) * (-1415.264) (-1412.020) [-1413.059] (-1414.615) -- 0:00:35 452500 -- (-1415.977) (-1415.611) [-1413.047] (-1411.926) * (-1414.225) (-1411.684) (-1413.963) [-1413.561] -- 0:00:35 453000 -- (-1417.049) (-1415.015) (-1415.844) [-1412.394] * (-1412.779) [-1414.472] (-1412.004) (-1411.383) -- 0:00:35 453500 -- (-1419.343) [-1414.313] (-1412.232) (-1412.012) * [-1417.815] (-1416.620) (-1414.247) (-1412.771) -- 0:00:34 454000 -- [-1413.702] (-1414.377) (-1414.167) (-1413.526) * [-1413.394] (-1412.453) (-1419.513) (-1412.886) -- 0:00:34 454500 -- [-1417.516] (-1413.937) (-1413.425) (-1411.456) * [-1414.096] (-1412.658) (-1413.087) (-1419.403) -- 0:00:34 455000 -- (-1414.757) (-1412.077) (-1414.354) [-1411.498] * (-1412.755) (-1414.235) (-1414.178) [-1416.821] -- 0:00:34 Average standard deviation of split frequencies: 0.011919 455500 -- (-1411.915) [-1411.850] (-1415.350) (-1412.236) * (-1412.755) (-1415.270) [-1414.142] (-1413.577) -- 0:00:34 456000 -- (-1411.775) (-1412.357) (-1414.375) [-1411.667] * (-1412.282) [-1412.202] (-1413.029) (-1411.919) -- 0:00:34 456500 -- (-1411.164) (-1412.239) [-1416.298] (-1411.416) * [-1412.631] (-1413.798) (-1413.060) (-1412.254) -- 0:00:34 457000 -- (-1411.429) (-1413.192) (-1413.157) [-1413.022] * (-1412.306) (-1412.344) [-1412.766] (-1413.020) -- 0:00:34 457500 -- (-1411.538) (-1415.175) (-1412.550) [-1413.933] * [-1414.042] (-1413.873) (-1412.998) (-1417.633) -- 0:00:34 458000 -- (-1411.634) (-1413.868) (-1414.537) [-1414.400] * (-1412.831) (-1415.441) [-1412.737] (-1413.128) -- 0:00:34 458500 -- (-1412.058) (-1413.567) (-1411.518) [-1412.634] * (-1416.563) (-1414.126) (-1414.499) [-1416.170] -- 0:00:34 459000 -- (-1413.940) [-1414.632] (-1412.730) (-1412.305) * (-1415.966) (-1412.522) [-1413.248] (-1414.105) -- 0:00:34 459500 -- [-1412.511] (-1417.982) (-1411.875) (-1414.359) * (-1414.432) [-1411.911] (-1416.273) (-1414.027) -- 0:00:34 460000 -- (-1413.443) (-1411.861) [-1414.571] (-1412.902) * (-1412.022) (-1414.082) (-1416.165) [-1414.338] -- 0:00:34 Average standard deviation of split frequencies: 0.011196 460500 -- (-1413.023) [-1412.564] (-1417.173) (-1411.999) * (-1414.103) (-1412.407) (-1418.864) [-1412.088] -- 0:00:33 461000 -- (-1412.163) (-1411.414) [-1415.963] (-1412.050) * (-1412.608) [-1411.599] (-1415.445) (-1411.334) -- 0:00:33 461500 -- (-1411.203) (-1413.174) (-1413.614) [-1414.116] * (-1412.089) [-1414.872] (-1413.733) (-1413.682) -- 0:00:33 462000 -- [-1411.521] (-1414.629) (-1413.210) (-1413.582) * (-1412.415) (-1416.497) [-1414.400] (-1412.936) -- 0:00:33 462500 -- (-1411.736) (-1411.802) (-1415.056) [-1411.534] * [-1413.171] (-1412.230) (-1414.697) (-1419.023) -- 0:00:33 463000 -- (-1411.706) (-1411.650) (-1412.173) [-1414.599] * (-1413.049) [-1412.627] (-1413.144) (-1412.132) -- 0:00:33 463500 -- (-1413.504) (-1414.326) [-1411.204] (-1413.821) * (-1413.762) [-1412.614] (-1413.411) (-1413.234) -- 0:00:33 464000 -- (-1415.450) (-1411.999) [-1411.623] (-1412.383) * (-1416.990) (-1412.682) [-1413.678] (-1413.747) -- 0:00:33 464500 -- (-1411.798) [-1414.990] (-1413.128) (-1412.271) * (-1418.120) (-1413.235) [-1413.317] (-1414.343) -- 0:00:33 465000 -- (-1411.645) (-1416.460) [-1415.066] (-1412.271) * (-1415.208) (-1415.964) (-1414.506) [-1413.290] -- 0:00:33 Average standard deviation of split frequencies: 0.010890 465500 -- (-1414.660) (-1414.120) (-1414.602) [-1414.915] * (-1415.603) (-1415.198) (-1415.969) [-1412.611] -- 0:00:33 466000 -- [-1413.772] (-1412.457) (-1414.061) (-1413.474) * (-1418.505) [-1412.807] (-1417.517) (-1415.300) -- 0:00:33 466500 -- (-1412.841) (-1415.342) [-1413.311] (-1413.492) * (-1417.079) (-1412.786) (-1411.774) [-1413.397] -- 0:00:33 467000 -- (-1411.567) (-1413.583) (-1411.951) [-1411.743] * (-1417.445) (-1413.866) (-1412.118) [-1414.767] -- 0:00:34 467500 -- [-1411.013] (-1413.315) (-1414.918) (-1412.880) * (-1412.124) [-1415.874] (-1412.628) (-1414.991) -- 0:00:34 468000 -- (-1414.202) (-1413.356) [-1412.004] (-1412.204) * (-1414.407) (-1412.627) (-1416.752) [-1413.184] -- 0:00:34 468500 -- (-1412.066) [-1412.648] (-1413.355) (-1413.312) * (-1413.069) (-1412.249) (-1412.989) [-1411.546] -- 0:00:34 469000 -- (-1411.565) (-1412.344) [-1414.135] (-1412.107) * (-1413.250) (-1412.390) [-1412.068] (-1414.571) -- 0:00:33 469500 -- (-1412.036) [-1413.997] (-1416.787) (-1414.322) * (-1413.196) (-1414.662) [-1413.796] (-1415.691) -- 0:00:33 470000 -- (-1411.159) [-1414.426] (-1412.689) (-1413.670) * (-1413.552) (-1415.407) (-1414.979) [-1415.123] -- 0:00:33 Average standard deviation of split frequencies: 0.010428 470500 -- (-1411.687) (-1414.647) (-1411.752) [-1411.499] * (-1414.738) [-1413.413] (-1413.369) (-1414.043) -- 0:00:33 471000 -- [-1414.355] (-1413.894) (-1413.794) (-1413.683) * (-1414.334) (-1413.399) [-1412.469] (-1415.302) -- 0:00:33 471500 -- (-1412.559) (-1416.687) [-1414.189] (-1412.958) * (-1413.388) (-1416.400) (-1411.609) [-1413.101] -- 0:00:33 472000 -- (-1414.214) (-1413.377) (-1413.919) [-1413.164] * [-1413.032] (-1411.109) (-1411.743) (-1413.892) -- 0:00:33 472500 -- (-1413.404) (-1414.555) [-1411.932] (-1414.498) * (-1418.794) [-1410.983] (-1416.227) (-1414.797) -- 0:00:33 473000 -- (-1416.339) (-1412.364) (-1415.272) [-1413.114] * (-1414.903) (-1413.806) (-1415.734) [-1412.566] -- 0:00:33 473500 -- (-1415.019) (-1411.875) (-1412.771) [-1415.134] * [-1415.043] (-1412.339) (-1413.900) (-1412.857) -- 0:00:33 474000 -- (-1414.536) [-1412.768] (-1413.984) (-1419.093) * (-1417.296) (-1417.662) [-1412.759] (-1416.814) -- 0:00:33 474500 -- (-1414.430) (-1412.858) [-1412.004] (-1412.671) * (-1413.126) (-1413.233) [-1415.414] (-1414.362) -- 0:00:33 475000 -- [-1412.282] (-1415.204) (-1412.862) (-1411.334) * [-1412.602] (-1413.788) (-1415.287) (-1419.328) -- 0:00:33 Average standard deviation of split frequencies: 0.009962 475500 -- (-1411.691) [-1411.886] (-1412.081) (-1413.190) * [-1412.407] (-1414.375) (-1414.479) (-1415.542) -- 0:00:33 476000 -- (-1411.243) (-1412.426) [-1412.353] (-1414.539) * [-1414.128] (-1414.617) (-1415.332) (-1413.088) -- 0:00:33 476500 -- (-1411.243) (-1413.639) [-1414.512] (-1413.530) * [-1411.399] (-1416.440) (-1412.584) (-1412.980) -- 0:00:32 477000 -- (-1411.773) (-1412.591) (-1412.767) [-1412.494] * (-1411.403) (-1411.625) (-1411.622) [-1413.612] -- 0:00:32 477500 -- (-1411.872) [-1411.944] (-1412.561) (-1418.366) * [-1411.653] (-1412.109) (-1411.748) (-1414.587) -- 0:00:32 478000 -- (-1412.973) [-1417.227] (-1412.807) (-1412.008) * (-1412.019) (-1413.297) (-1412.183) [-1413.820] -- 0:00:32 478500 -- [-1413.000] (-1414.301) (-1413.347) (-1411.915) * [-1411.893] (-1414.125) (-1412.023) (-1416.311) -- 0:00:32 479000 -- [-1413.017] (-1412.060) (-1414.997) (-1412.761) * (-1414.263) [-1412.155] (-1415.824) (-1414.035) -- 0:00:32 479500 -- [-1412.518] (-1414.683) (-1412.532) (-1413.257) * [-1414.263] (-1413.137) (-1418.385) (-1414.995) -- 0:00:32 480000 -- [-1412.529] (-1412.538) (-1412.976) (-1414.309) * (-1418.034) (-1414.354) [-1419.731] (-1414.468) -- 0:00:32 Average standard deviation of split frequencies: 0.009698 480500 -- [-1411.701] (-1415.175) (-1412.912) (-1413.916) * [-1416.251] (-1418.584) (-1421.211) (-1417.104) -- 0:00:32 481000 -- (-1413.212) (-1416.217) (-1412.129) [-1416.778] * (-1411.732) [-1415.509] (-1415.875) (-1413.261) -- 0:00:32 481500 -- (-1413.111) [-1415.794] (-1412.468) (-1412.522) * [-1414.229] (-1413.947) (-1412.743) (-1413.055) -- 0:00:32 482000 -- (-1415.743) (-1415.363) (-1413.958) [-1411.726] * [-1414.786] (-1411.819) (-1412.071) (-1418.042) -- 0:00:32 482500 -- (-1412.315) (-1417.619) [-1414.024] (-1411.573) * (-1414.994) (-1412.554) (-1414.338) [-1414.677] -- 0:00:32 483000 -- (-1413.868) [-1413.803] (-1417.299) (-1411.384) * [-1412.853] (-1413.839) (-1413.166) (-1414.921) -- 0:00:33 483500 -- (-1411.463) (-1413.155) (-1413.280) [-1412.180] * (-1414.970) (-1420.096) (-1414.139) [-1412.007] -- 0:00:33 484000 -- (-1411.400) (-1415.846) (-1417.107) [-1416.544] * (-1415.166) (-1420.139) [-1412.941] (-1412.437) -- 0:00:33 484500 -- (-1411.340) (-1413.500) (-1413.213) [-1412.739] * (-1413.041) (-1418.933) (-1412.351) [-1411.945] -- 0:00:32 485000 -- [-1411.435] (-1413.539) (-1417.375) (-1411.153) * (-1411.290) (-1413.693) [-1412.705] (-1413.926) -- 0:00:32 Average standard deviation of split frequencies: 0.009269 485500 -- [-1411.429] (-1417.995) (-1415.757) (-1411.257) * (-1411.837) (-1414.681) [-1413.503] (-1419.121) -- 0:00:32 486000 -- (-1411.955) (-1418.437) [-1413.858] (-1414.346) * (-1410.926) (-1412.508) [-1413.618] (-1417.216) -- 0:00:32 486500 -- (-1411.661) (-1414.684) (-1416.027) [-1411.936] * [-1415.289] (-1413.023) (-1413.400) (-1413.463) -- 0:00:32 487000 -- (-1412.650) [-1412.587] (-1413.314) (-1414.667) * (-1417.105) [-1413.698] (-1418.776) (-1415.306) -- 0:00:32 487500 -- (-1412.655) (-1414.439) (-1413.071) [-1413.609] * [-1411.484] (-1413.578) (-1415.851) (-1413.495) -- 0:00:32 488000 -- (-1411.635) (-1414.361) [-1413.456] (-1419.243) * [-1413.527] (-1414.298) (-1413.368) (-1412.292) -- 0:00:32 488500 -- [-1413.802] (-1412.963) (-1412.197) (-1415.241) * (-1413.078) (-1412.572) [-1414.639] (-1414.005) -- 0:00:32 489000 -- (-1417.097) (-1412.320) [-1412.380] (-1415.570) * [-1412.597] (-1411.789) (-1415.503) (-1415.324) -- 0:00:32 489500 -- (-1413.579) (-1412.538) [-1411.324] (-1416.507) * (-1412.275) (-1412.604) (-1414.746) [-1415.398] -- 0:00:32 490000 -- (-1413.539) (-1413.719) (-1415.019) [-1414.828] * [-1417.185] (-1414.359) (-1412.336) (-1415.692) -- 0:00:32 Average standard deviation of split frequencies: 0.008860 490500 -- (-1416.775) (-1413.178) (-1415.353) [-1415.523] * (-1412.352) (-1415.156) [-1412.336] (-1414.173) -- 0:00:32 491000 -- (-1413.833) (-1412.594) (-1414.414) [-1412.730] * (-1411.499) (-1414.489) (-1415.151) [-1412.617] -- 0:00:32 491500 -- (-1414.368) (-1412.800) (-1413.816) [-1411.988] * (-1412.667) [-1414.807] (-1413.607) (-1411.972) -- 0:00:32 492000 -- (-1413.615) [-1412.353] (-1414.820) (-1412.497) * [-1411.976] (-1413.552) (-1414.376) (-1415.142) -- 0:00:32 492500 -- (-1414.441) (-1412.691) (-1416.556) [-1412.441] * (-1413.396) (-1415.933) [-1415.399] (-1414.411) -- 0:00:31 493000 -- [-1416.107] (-1414.505) (-1412.499) (-1413.176) * (-1413.031) (-1412.368) [-1412.714] (-1412.585) -- 0:00:31 493500 -- (-1416.448) [-1412.391] (-1413.854) (-1413.088) * [-1412.595] (-1413.043) (-1415.217) (-1416.489) -- 0:00:31 494000 -- (-1412.964) (-1412.678) (-1417.858) [-1413.454] * (-1412.503) (-1417.349) [-1412.676] (-1415.083) -- 0:00:31 494500 -- [-1412.540] (-1412.752) (-1413.228) (-1413.273) * [-1413.095] (-1416.495) (-1416.629) (-1414.017) -- 0:00:31 495000 -- (-1412.163) (-1411.945) (-1413.968) [-1413.966] * (-1414.888) [-1414.929] (-1412.128) (-1414.564) -- 0:00:31 Average standard deviation of split frequencies: 0.007995 495500 -- (-1413.219) (-1414.555) (-1412.190) [-1414.770] * (-1413.504) (-1412.201) (-1413.510) [-1412.768] -- 0:00:31 496000 -- [-1413.606] (-1416.920) (-1412.575) (-1415.867) * [-1411.469] (-1414.281) (-1415.641) (-1414.221) -- 0:00:31 496500 -- (-1414.094) [-1412.774] (-1413.238) (-1415.626) * (-1412.772) [-1413.773] (-1413.076) (-1414.946) -- 0:00:31 497000 -- (-1414.203) (-1412.019) (-1415.150) [-1413.604] * (-1415.640) (-1412.401) (-1414.389) [-1412.434] -- 0:00:31 497500 -- (-1412.922) (-1411.963) (-1418.982) [-1413.327] * (-1413.102) (-1411.583) [-1412.777] (-1415.780) -- 0:00:31 498000 -- (-1413.698) [-1411.276] (-1412.509) (-1417.551) * (-1413.426) (-1412.728) [-1412.361] (-1414.479) -- 0:00:31 498500 -- (-1411.934) [-1412.552] (-1413.390) (-1414.149) * (-1413.908) [-1415.240] (-1415.066) (-1413.148) -- 0:00:31 499000 -- (-1411.613) (-1411.342) (-1413.552) [-1413.807] * [-1412.546] (-1412.120) (-1412.279) (-1413.505) -- 0:00:32 499500 -- (-1411.841) (-1412.357) [-1413.084] (-1413.566) * [-1412.872] (-1412.087) (-1412.801) (-1415.441) -- 0:00:32 500000 -- (-1419.236) (-1413.990) [-1414.674] (-1415.127) * [-1412.524] (-1413.275) (-1415.166) (-1413.595) -- 0:00:32 Average standard deviation of split frequencies: 0.007865 500500 -- (-1415.898) (-1413.478) [-1413.551] (-1419.222) * [-1414.870] (-1413.847) (-1412.994) (-1413.574) -- 0:00:31 501000 -- [-1413.365] (-1417.256) (-1413.808) (-1414.964) * (-1412.718) (-1414.819) [-1411.463] (-1412.858) -- 0:00:31 501500 -- [-1411.493] (-1411.709) (-1413.966) (-1414.945) * (-1412.117) (-1417.180) (-1412.347) [-1413.682] -- 0:00:31 502000 -- [-1412.624] (-1411.435) (-1412.791) (-1413.110) * (-1411.970) [-1413.306] (-1412.815) (-1414.421) -- 0:00:31 502500 -- (-1414.886) [-1411.391] (-1414.896) (-1413.601) * (-1411.971) [-1412.379] (-1411.876) (-1412.913) -- 0:00:31 503000 -- [-1413.897] (-1412.133) (-1413.897) (-1413.808) * [-1412.129] (-1419.018) (-1412.247) (-1413.109) -- 0:00:31 503500 -- (-1412.623) (-1413.630) [-1413.586] (-1413.284) * [-1414.785] (-1412.933) (-1413.459) (-1415.933) -- 0:00:31 504000 -- (-1412.041) (-1413.971) (-1415.326) [-1413.069] * (-1414.792) (-1418.275) [-1414.839] (-1414.412) -- 0:00:31 504500 -- [-1411.519] (-1419.273) (-1412.994) (-1414.788) * (-1416.438) [-1412.524] (-1413.052) (-1413.774) -- 0:00:31 505000 -- [-1414.549] (-1411.156) (-1412.230) (-1413.750) * (-1413.300) (-1411.020) (-1413.349) [-1419.828] -- 0:00:31 Average standard deviation of split frequencies: 0.007867 505500 -- (-1413.429) [-1411.335] (-1411.860) (-1412.834) * [-1413.000] (-1412.539) (-1413.730) (-1416.131) -- 0:00:31 506000 -- [-1411.924] (-1412.239) (-1412.332) (-1412.329) * (-1414.423) [-1413.193] (-1414.714) (-1413.515) -- 0:00:31 506500 -- (-1412.912) (-1411.933) [-1411.720] (-1416.613) * (-1414.051) [-1412.423] (-1413.911) (-1411.643) -- 0:00:31 507000 -- [-1412.476] (-1412.772) (-1411.709) (-1417.344) * (-1416.260) [-1411.010] (-1413.804) (-1413.137) -- 0:00:31 507500 -- (-1411.519) [-1413.032] (-1412.619) (-1419.205) * (-1415.292) (-1411.246) (-1412.378) [-1411.747] -- 0:00:31 508000 -- (-1412.479) (-1412.663) (-1412.500) [-1413.148] * (-1412.930) (-1417.339) [-1413.785] (-1412.934) -- 0:00:30 508500 -- (-1412.235) (-1414.554) (-1416.035) [-1414.859] * (-1411.466) [-1414.537] (-1413.180) (-1415.101) -- 0:00:30 509000 -- (-1412.085) (-1413.977) (-1412.528) [-1411.314] * (-1411.280) [-1415.185] (-1417.662) (-1414.350) -- 0:00:30 509500 -- (-1413.974) (-1414.338) [-1412.698] (-1414.689) * (-1412.901) (-1420.240) (-1417.129) [-1413.876] -- 0:00:30 510000 -- [-1412.072] (-1412.874) (-1412.019) (-1415.042) * [-1411.419] (-1413.096) (-1413.377) (-1415.299) -- 0:00:30 Average standard deviation of split frequencies: 0.007982 510500 -- (-1411.730) [-1412.956] (-1412.528) (-1413.332) * [-1411.965] (-1414.170) (-1413.554) (-1413.031) -- 0:00:30 511000 -- (-1411.756) (-1414.333) [-1412.148] (-1411.607) * (-1411.975) [-1413.224] (-1411.509) (-1413.541) -- 0:00:30 511500 -- (-1414.046) (-1413.762) (-1416.168) [-1414.303] * [-1414.839] (-1413.720) (-1418.487) (-1411.695) -- 0:00:30 512000 -- [-1413.823] (-1411.934) (-1413.235) (-1416.197) * [-1415.533] (-1412.995) (-1417.385) (-1411.651) -- 0:00:30 512500 -- (-1414.203) (-1414.033) [-1414.288] (-1413.765) * (-1412.571) (-1412.357) (-1412.629) [-1412.097] -- 0:00:30 513000 -- (-1411.926) (-1417.305) [-1413.647] (-1414.839) * (-1412.167) (-1412.193) (-1413.106) [-1412.307] -- 0:00:30 513500 -- (-1412.435) (-1412.919) (-1412.589) [-1412.206] * (-1414.711) [-1412.263] (-1414.117) (-1413.106) -- 0:00:30 514000 -- (-1415.903) [-1411.383] (-1414.766) (-1412.271) * (-1414.172) (-1413.825) (-1414.250) [-1414.143] -- 0:00:30 514500 -- (-1413.854) [-1412.153] (-1413.641) (-1413.168) * (-1412.976) [-1412.913] (-1412.246) (-1413.283) -- 0:00:30 515000 -- (-1415.088) [-1412.517] (-1414.840) (-1415.944) * [-1413.296] (-1412.206) (-1411.674) (-1413.307) -- 0:00:31 Average standard deviation of split frequencies: 0.007900 515500 -- (-1413.904) (-1414.983) [-1414.359] (-1414.860) * [-1415.245] (-1413.659) (-1411.772) (-1411.180) -- 0:00:31 516000 -- (-1412.147) (-1413.025) (-1414.909) [-1414.738] * (-1416.871) (-1412.361) (-1412.092) [-1412.023] -- 0:00:30 516500 -- [-1411.139] (-1414.776) (-1415.949) (-1411.907) * [-1416.635] (-1414.577) (-1411.725) (-1412.925) -- 0:00:30 517000 -- [-1411.706] (-1413.099) (-1414.446) (-1414.527) * (-1413.493) (-1412.686) [-1412.880] (-1412.301) -- 0:00:30 517500 -- [-1413.602] (-1413.362) (-1413.406) (-1415.676) * (-1412.336) [-1411.845] (-1411.287) (-1413.657) -- 0:00:30 518000 -- (-1413.109) (-1411.911) (-1412.543) [-1416.291] * (-1414.346) (-1411.435) [-1412.094] (-1416.090) -- 0:00:30 518500 -- [-1413.832] (-1412.075) (-1415.647) (-1413.298) * (-1415.053) (-1411.643) (-1414.160) [-1413.749] -- 0:00:30 519000 -- (-1412.813) [-1411.898] (-1413.162) (-1412.616) * (-1413.703) [-1412.123] (-1411.984) (-1414.090) -- 0:00:30 519500 -- [-1413.950] (-1413.223) (-1414.717) (-1414.516) * (-1414.749) [-1412.348] (-1414.196) (-1420.051) -- 0:00:30 520000 -- (-1413.365) (-1412.585) (-1415.048) [-1413.745] * (-1411.609) (-1414.790) (-1418.812) [-1411.914] -- 0:00:30 Average standard deviation of split frequencies: 0.008202 520500 -- (-1416.761) (-1412.825) (-1414.666) [-1412.024] * (-1411.448) (-1413.097) (-1417.095) [-1414.346] -- 0:00:30 521000 -- (-1413.665) (-1411.698) (-1411.654) [-1411.463] * (-1413.589) (-1413.220) (-1413.675) [-1413.749] -- 0:00:30 521500 -- (-1413.050) [-1411.997] (-1414.088) (-1415.170) * (-1412.873) (-1414.750) (-1416.403) [-1413.900] -- 0:00:30 522000 -- [-1411.442] (-1412.216) (-1416.822) (-1411.527) * [-1415.369] (-1414.019) (-1412.441) (-1419.907) -- 0:00:30 522500 -- (-1413.717) [-1412.361] (-1412.592) (-1411.799) * (-1414.044) (-1414.907) [-1411.947] (-1417.220) -- 0:00:30 523000 -- (-1413.684) (-1413.794) [-1415.593] (-1412.667) * (-1413.180) (-1413.232) [-1411.831] (-1414.879) -- 0:00:30 523500 -- (-1414.479) (-1413.801) (-1415.012) [-1413.038] * (-1418.762) (-1412.399) [-1412.363] (-1418.813) -- 0:00:30 524000 -- (-1413.171) (-1413.221) (-1414.152) [-1412.172] * (-1415.082) [-1412.944] (-1413.023) (-1412.892) -- 0:00:29 524500 -- (-1413.228) (-1412.804) (-1413.485) [-1412.951] * (-1415.364) (-1412.545) [-1412.586] (-1412.891) -- 0:00:29 525000 -- [-1412.636] (-1412.133) (-1411.452) (-1412.386) * (-1413.339) (-1416.013) [-1416.655] (-1412.026) -- 0:00:29 Average standard deviation of split frequencies: 0.008804 525500 -- (-1413.235) (-1412.451) (-1412.895) [-1417.482] * (-1412.736) (-1419.441) [-1412.334] (-1412.586) -- 0:00:29 526000 -- (-1413.478) (-1412.253) [-1412.648] (-1418.472) * [-1413.923] (-1412.469) (-1412.794) (-1412.263) -- 0:00:29 526500 -- (-1411.276) (-1416.624) [-1413.633] (-1416.310) * (-1412.763) (-1412.201) [-1413.004] (-1411.520) -- 0:00:29 527000 -- [-1415.858] (-1419.933) (-1412.763) (-1414.520) * [-1412.262] (-1413.291) (-1415.418) (-1411.499) -- 0:00:29 527500 -- (-1414.837) (-1412.401) (-1412.680) [-1411.305] * (-1413.720) (-1415.883) [-1412.842] (-1411.751) -- 0:00:29 528000 -- [-1414.798] (-1413.477) (-1413.180) (-1412.827) * (-1413.682) [-1417.379] (-1416.502) (-1411.956) -- 0:00:29 528500 -- [-1412.312] (-1413.504) (-1413.239) (-1413.067) * (-1414.916) (-1414.110) (-1416.126) [-1410.938] -- 0:00:29 529000 -- (-1413.760) (-1412.402) [-1416.904] (-1411.533) * (-1413.757) (-1415.713) (-1415.079) [-1410.971] -- 0:00:29 529500 -- (-1412.974) (-1412.734) (-1412.285) [-1413.508] * (-1414.921) (-1413.164) [-1420.162] (-1412.672) -- 0:00:29 530000 -- (-1414.748) [-1412.571] (-1412.291) (-1414.693) * (-1417.521) (-1415.599) (-1415.671) [-1414.026] -- 0:00:29 Average standard deviation of split frequencies: 0.008517 530500 -- [-1413.207] (-1412.352) (-1412.145) (-1414.693) * (-1415.463) (-1418.242) (-1416.680) [-1412.798] -- 0:00:30 531000 -- (-1419.194) (-1411.960) [-1412.267] (-1416.320) * (-1413.044) (-1414.652) (-1411.391) [-1412.839] -- 0:00:30 531500 -- (-1414.140) [-1412.922] (-1414.788) (-1412.573) * (-1415.165) (-1415.180) [-1412.286] (-1412.708) -- 0:00:29 532000 -- (-1413.058) (-1414.410) (-1413.780) [-1413.096] * (-1414.033) (-1413.880) [-1411.988] (-1417.560) -- 0:00:29 532500 -- (-1413.514) (-1414.392) [-1412.296] (-1415.027) * (-1412.338) (-1414.176) [-1416.338] (-1426.418) -- 0:00:29 533000 -- (-1415.679) [-1413.578] (-1411.628) (-1414.658) * (-1413.199) (-1419.758) (-1416.785) [-1413.690] -- 0:00:29 533500 -- (-1414.659) [-1414.185] (-1414.372) (-1414.458) * (-1414.112) (-1415.518) [-1413.492] (-1415.280) -- 0:00:29 534000 -- (-1414.339) (-1415.894) [-1415.319] (-1412.878) * (-1414.787) (-1415.775) (-1413.258) [-1414.872] -- 0:00:29 534500 -- [-1414.098] (-1415.933) (-1413.605) (-1415.503) * (-1414.556) [-1412.519] (-1412.552) (-1411.833) -- 0:00:29 535000 -- (-1413.600) [-1413.942] (-1413.645) (-1416.536) * [-1413.382] (-1411.800) (-1415.279) (-1414.931) -- 0:00:29 Average standard deviation of split frequencies: 0.007860 535500 -- (-1412.586) [-1412.586] (-1412.381) (-1414.585) * (-1413.202) (-1411.800) [-1412.777] (-1414.190) -- 0:00:29 536000 -- (-1412.656) (-1413.104) (-1415.713) [-1413.802] * (-1412.459) (-1411.434) [-1412.745] (-1414.238) -- 0:00:29 536500 -- (-1413.701) (-1412.982) (-1410.966) [-1414.038] * (-1419.037) (-1415.463) (-1411.900) [-1413.486] -- 0:00:29 537000 -- (-1411.368) (-1414.881) (-1413.639) [-1412.295] * (-1418.336) (-1417.155) [-1412.017] (-1418.151) -- 0:00:29 537500 -- [-1413.045] (-1412.456) (-1414.053) (-1411.890) * (-1415.754) (-1417.753) (-1413.828) [-1415.671] -- 0:00:29 538000 -- (-1414.331) (-1412.398) [-1413.921] (-1421.668) * (-1411.604) (-1414.866) (-1411.651) [-1413.460] -- 0:00:29 538500 -- [-1413.757] (-1414.247) (-1415.606) (-1412.887) * (-1413.325) [-1413.196] (-1412.532) (-1412.503) -- 0:00:29 539000 -- [-1414.628] (-1412.910) (-1418.680) (-1413.656) * (-1412.417) [-1414.121] (-1412.985) (-1412.956) -- 0:00:29 539500 -- (-1412.037) (-1411.748) [-1412.506] (-1412.067) * (-1411.385) (-1414.009) (-1414.981) [-1411.346] -- 0:00:29 540000 -- [-1412.824] (-1414.354) (-1413.432) (-1412.964) * (-1414.662) (-1412.290) [-1412.808] (-1412.565) -- 0:00:28 Average standard deviation of split frequencies: 0.008120 540500 -- [-1411.477] (-1412.089) (-1411.333) (-1412.372) * [-1414.469] (-1416.796) (-1413.562) (-1413.198) -- 0:00:28 541000 -- [-1411.477] (-1412.802) (-1412.794) (-1416.466) * (-1411.774) (-1412.626) (-1417.119) [-1413.195] -- 0:00:28 541500 -- (-1413.479) (-1414.870) (-1412.420) [-1413.685] * (-1411.336) [-1411.726] (-1411.602) (-1415.397) -- 0:00:28 542000 -- (-1412.484) (-1414.720) (-1413.851) [-1412.408] * [-1412.623] (-1414.717) (-1412.439) (-1413.849) -- 0:00:28 542500 -- (-1416.294) (-1417.374) (-1413.631) [-1415.184] * (-1412.041) (-1416.767) [-1414.053] (-1414.725) -- 0:00:28 543000 -- (-1416.118) (-1416.369) (-1412.987) [-1415.608] * [-1411.839] (-1413.736) (-1414.825) (-1415.420) -- 0:00:28 543500 -- (-1416.365) (-1413.674) (-1413.293) [-1415.630] * (-1411.411) (-1415.118) (-1411.767) [-1414.153] -- 0:00:28 544000 -- [-1412.140] (-1412.240) (-1412.939) (-1413.674) * (-1412.772) [-1414.738] (-1414.200) (-1417.311) -- 0:00:28 544500 -- (-1414.896) (-1413.590) [-1413.758] (-1413.991) * [-1412.405] (-1412.957) (-1414.289) (-1414.340) -- 0:00:28 545000 -- [-1416.635] (-1413.821) (-1414.054) (-1420.042) * (-1411.213) [-1413.252] (-1415.298) (-1417.044) -- 0:00:28 Average standard deviation of split frequencies: 0.007932 545500 -- [-1413.065] (-1413.910) (-1415.657) (-1418.352) * (-1413.649) (-1418.639) [-1413.102] (-1418.282) -- 0:00:28 546000 -- (-1417.161) (-1416.967) [-1415.076] (-1413.329) * [-1414.572] (-1418.216) (-1414.773) (-1416.096) -- 0:00:28 546500 -- [-1413.285] (-1418.408) (-1411.917) (-1423.353) * (-1417.079) (-1418.583) [-1413.050] (-1412.381) -- 0:00:29 547000 -- (-1414.295) (-1414.453) [-1413.483] (-1414.961) * (-1412.707) (-1414.862) (-1414.637) [-1412.171] -- 0:00:28 547500 -- (-1413.555) (-1412.401) [-1412.166] (-1414.693) * [-1412.244] (-1414.923) (-1415.677) (-1415.781) -- 0:00:28 548000 -- [-1416.533] (-1412.290) (-1414.389) (-1413.544) * [-1413.249] (-1415.240) (-1415.043) (-1416.859) -- 0:00:28 548500 -- (-1415.729) (-1412.290) [-1415.358] (-1412.341) * (-1412.497) (-1414.293) (-1413.652) [-1413.978] -- 0:00:28 549000 -- (-1412.620) (-1412.311) (-1416.043) [-1414.026] * [-1415.671] (-1412.095) (-1414.177) (-1412.646) -- 0:00:28 549500 -- [-1414.247] (-1414.495) (-1415.281) (-1412.081) * (-1413.166) [-1414.224] (-1413.431) (-1414.421) -- 0:00:28 550000 -- (-1413.967) (-1413.880) (-1414.417) [-1413.642] * (-1411.935) (-1416.105) [-1414.411] (-1418.212) -- 0:00:28 Average standard deviation of split frequencies: 0.008400 550500 -- [-1414.539] (-1414.384) (-1415.196) (-1415.639) * (-1418.688) (-1417.554) [-1412.759] (-1414.361) -- 0:00:28 551000 -- [-1414.324] (-1417.447) (-1413.953) (-1412.303) * (-1412.419) (-1417.017) [-1413.348] (-1413.656) -- 0:00:28 551500 -- (-1418.077) [-1415.467] (-1413.683) (-1411.447) * (-1411.371) (-1416.306) (-1412.825) [-1415.101] -- 0:00:28 552000 -- (-1414.043) (-1413.337) [-1417.567] (-1412.942) * (-1411.793) [-1417.176] (-1412.140) (-1412.019) -- 0:00:28 552500 -- [-1415.626] (-1411.445) (-1417.960) (-1412.611) * (-1411.018) [-1413.695] (-1415.289) (-1411.025) -- 0:00:28 553000 -- (-1415.633) (-1411.680) [-1415.907] (-1414.436) * [-1411.610] (-1415.989) (-1413.189) (-1411.391) -- 0:00:28 553500 -- (-1412.433) (-1413.178) [-1414.726] (-1413.932) * (-1411.192) (-1414.920) (-1414.891) [-1411.957] -- 0:00:28 554000 -- (-1412.117) (-1411.500) [-1419.037] (-1412.200) * [-1412.685] (-1414.506) (-1414.501) (-1414.860) -- 0:00:28 554500 -- (-1414.722) (-1414.036) (-1412.214) [-1414.032] * [-1414.343] (-1418.251) (-1414.719) (-1413.498) -- 0:00:28 555000 -- (-1413.187) (-1413.424) (-1414.761) [-1411.810] * (-1412.665) [-1414.848] (-1412.726) (-1411.501) -- 0:00:28 Average standard deviation of split frequencies: 0.008320 555500 -- (-1413.737) (-1415.239) (-1416.145) [-1413.627] * (-1414.035) (-1413.464) [-1414.805] (-1413.837) -- 0:00:28 556000 -- (-1414.231) (-1415.043) [-1413.235] (-1412.409) * (-1413.305) [-1414.303] (-1414.158) (-1414.618) -- 0:00:27 556500 -- (-1412.199) (-1414.197) (-1413.763) [-1412.436] * (-1414.844) (-1414.952) (-1415.480) [-1411.548] -- 0:00:27 557000 -- (-1411.576) (-1417.467) (-1414.886) [-1413.167] * (-1412.424) (-1411.567) (-1413.823) [-1412.951] -- 0:00:27 557500 -- (-1411.568) (-1411.699) [-1412.192] (-1412.218) * (-1416.838) (-1411.634) (-1414.055) [-1412.265] -- 0:00:27 558000 -- [-1411.957] (-1414.834) (-1412.121) (-1413.240) * [-1411.977] (-1414.727) (-1412.681) (-1411.720) -- 0:00:27 558500 -- (-1415.069) [-1411.390] (-1412.410) (-1413.436) * [-1412.639] (-1413.930) (-1414.679) (-1411.914) -- 0:00:27 559000 -- (-1414.627) [-1411.244] (-1411.646) (-1412.823) * (-1417.648) [-1413.845] (-1413.142) (-1416.663) -- 0:00:27 559500 -- (-1412.275) (-1412.785) [-1412.317] (-1412.382) * (-1412.947) (-1413.788) (-1413.228) [-1414.707] -- 0:00:27 560000 -- (-1413.851) (-1413.652) (-1413.147) [-1412.757] * (-1412.843) (-1415.051) [-1414.798] (-1411.763) -- 0:00:27 Average standard deviation of split frequencies: 0.008576 560500 -- (-1412.745) (-1411.237) [-1412.538] (-1412.178) * (-1413.614) (-1421.301) (-1414.867) [-1414.986] -- 0:00:27 561000 -- (-1413.291) (-1411.390) (-1412.354) [-1411.808] * (-1416.609) (-1412.745) (-1413.059) [-1412.987] -- 0:00:27 561500 -- (-1411.853) (-1412.727) (-1411.407) [-1411.988] * [-1416.234] (-1413.358) (-1414.358) (-1414.111) -- 0:00:27 562000 -- (-1413.962) (-1414.368) [-1411.350] (-1411.322) * [-1413.577] (-1413.195) (-1412.720) (-1417.626) -- 0:00:27 562500 -- [-1412.295] (-1412.004) (-1413.757) (-1412.027) * (-1414.729) (-1416.336) [-1413.579] (-1417.936) -- 0:00:28 563000 -- (-1413.785) (-1411.685) [-1413.927] (-1414.055) * (-1417.892) (-1412.595) [-1412.312] (-1418.056) -- 0:00:27 563500 -- (-1415.928) (-1414.298) [-1413.294] (-1416.933) * (-1417.749) (-1412.424) [-1411.590] (-1415.585) -- 0:00:27 564000 -- [-1414.217] (-1414.423) (-1415.657) (-1414.229) * (-1413.354) (-1414.576) [-1413.459] (-1414.235) -- 0:00:27 564500 -- [-1416.147] (-1414.404) (-1413.699) (-1412.529) * (-1413.924) [-1413.540] (-1413.185) (-1413.229) -- 0:00:27 565000 -- (-1415.229) (-1411.840) (-1412.076) [-1416.378] * [-1414.154] (-1414.705) (-1414.405) (-1416.359) -- 0:00:27 Average standard deviation of split frequencies: 0.008016 565500 -- (-1417.917) (-1414.514) (-1413.499) [-1412.987] * [-1411.900] (-1413.361) (-1414.067) (-1416.448) -- 0:00:27 566000 -- (-1418.433) (-1412.702) [-1412.833] (-1412.245) * [-1412.507] (-1413.558) (-1416.178) (-1416.079) -- 0:00:27 566500 -- (-1414.641) [-1412.519] (-1414.895) (-1415.226) * (-1411.891) (-1418.474) [-1413.019] (-1413.990) -- 0:00:27 567000 -- (-1411.734) [-1411.297] (-1412.809) (-1414.246) * (-1416.030) (-1411.469) (-1411.081) [-1413.724] -- 0:00:27 567500 -- [-1412.767] (-1412.952) (-1412.520) (-1411.675) * [-1412.649] (-1414.589) (-1413.911) (-1414.237) -- 0:00:27 568000 -- [-1411.726] (-1414.077) (-1412.759) (-1412.264) * (-1412.966) (-1413.711) [-1414.776] (-1413.917) -- 0:00:27 568500 -- (-1412.691) (-1414.012) [-1414.364] (-1411.886) * (-1416.342) (-1413.711) (-1414.814) [-1411.755] -- 0:00:27 569000 -- [-1413.385] (-1417.778) (-1414.490) (-1412.352) * [-1413.019] (-1414.449) (-1418.814) (-1413.323) -- 0:00:27 569500 -- (-1411.132) (-1420.273) (-1412.018) [-1411.941] * [-1412.380] (-1416.781) (-1413.745) (-1416.041) -- 0:00:27 570000 -- (-1411.087) (-1416.736) (-1412.957) [-1411.362] * (-1414.854) (-1412.420) [-1414.447] (-1415.891) -- 0:00:27 Average standard deviation of split frequencies: 0.008674 570500 -- (-1415.092) (-1416.496) [-1411.723] (-1413.788) * (-1415.533) (-1412.981) (-1415.848) [-1414.885] -- 0:00:27 571000 -- (-1414.288) [-1412.824] (-1415.149) (-1414.933) * (-1414.817) (-1413.020) (-1413.642) [-1415.598] -- 0:00:27 571500 -- [-1412.081] (-1412.769) (-1412.755) (-1415.320) * (-1413.381) (-1414.330) [-1411.437] (-1413.720) -- 0:00:26 572000 -- (-1412.068) (-1411.977) (-1411.906) [-1412.915] * (-1413.716) [-1412.044] (-1412.371) (-1412.257) -- 0:00:26 572500 -- (-1411.932) (-1418.150) (-1413.226) [-1411.113] * (-1413.787) [-1412.163] (-1413.451) (-1416.048) -- 0:00:26 573000 -- (-1411.340) (-1412.399) (-1411.685) [-1411.868] * (-1411.897) [-1412.516] (-1411.968) (-1411.940) -- 0:00:26 573500 -- (-1413.958) [-1412.774] (-1414.501) (-1414.251) * (-1414.945) (-1414.242) [-1412.886] (-1412.164) -- 0:00:26 574000 -- [-1416.082] (-1416.615) (-1413.689) (-1414.314) * (-1415.869) (-1412.029) (-1412.841) [-1411.300] -- 0:00:26 574500 -- (-1411.213) (-1413.315) (-1414.198) [-1414.618] * [-1414.244] (-1412.750) (-1414.746) (-1412.762) -- 0:00:26 575000 -- [-1414.234] (-1412.070) (-1414.159) (-1415.309) * (-1414.339) (-1414.769) (-1413.260) [-1415.552] -- 0:00:26 Average standard deviation of split frequencies: 0.008900 575500 -- (-1411.624) [-1415.489] (-1413.755) (-1414.494) * (-1418.613) (-1413.811) (-1412.076) [-1412.498] -- 0:00:26 576000 -- (-1412.067) (-1414.503) [-1413.857] (-1415.804) * (-1414.433) (-1413.308) (-1413.373) [-1414.394] -- 0:00:26 576500 -- (-1414.260) [-1412.513] (-1413.215) (-1420.381) * (-1416.835) [-1413.826] (-1415.746) (-1414.537) -- 0:00:26 577000 -- (-1412.613) (-1414.621) (-1412.171) [-1417.766] * [-1413.359] (-1415.226) (-1412.839) (-1415.056) -- 0:00:26 577500 -- (-1415.347) (-1411.782) (-1417.127) [-1411.789] * [-1414.570] (-1419.796) (-1413.921) (-1411.925) -- 0:00:26 578000 -- (-1417.146) [-1414.756] (-1418.310) (-1414.376) * (-1414.077) (-1411.664) [-1415.324] (-1412.306) -- 0:00:26 578500 -- [-1414.053] (-1416.539) (-1421.497) (-1413.243) * (-1415.252) [-1414.062] (-1415.425) (-1413.463) -- 0:00:26 579000 -- (-1418.100) [-1416.639] (-1411.839) (-1412.797) * (-1414.118) (-1412.535) (-1414.124) [-1414.305] -- 0:00:26 579500 -- [-1413.583] (-1417.001) (-1414.308) (-1413.082) * [-1411.358] (-1412.061) (-1415.560) (-1411.634) -- 0:00:26 580000 -- (-1412.068) (-1412.069) [-1414.820] (-1417.783) * (-1413.847) [-1412.443] (-1413.195) (-1411.505) -- 0:00:26 Average standard deviation of split frequencies: 0.008930 580500 -- [-1411.435] (-1414.601) (-1414.972) (-1413.500) * [-1411.581] (-1415.472) (-1414.874) (-1412.045) -- 0:00:26 581000 -- (-1412.802) [-1414.575] (-1411.335) (-1413.401) * (-1412.602) (-1412.728) (-1412.059) [-1416.896] -- 0:00:26 581500 -- (-1411.247) [-1413.427] (-1411.274) (-1413.411) * (-1412.779) (-1411.880) [-1412.163] (-1413.273) -- 0:00:26 582000 -- [-1413.748] (-1411.411) (-1413.031) (-1413.199) * (-1414.996) (-1412.378) (-1413.862) [-1413.234] -- 0:00:26 582500 -- (-1418.840) [-1411.307] (-1411.584) (-1413.781) * (-1413.272) (-1415.413) (-1412.382) [-1411.766] -- 0:00:26 583000 -- (-1415.773) (-1413.338) [-1411.686] (-1414.044) * (-1412.760) (-1414.001) (-1412.292) [-1413.409] -- 0:00:26 583500 -- (-1414.741) [-1415.391] (-1411.609) (-1414.301) * (-1412.223) (-1413.792) [-1411.455] (-1412.819) -- 0:00:26 584000 -- (-1414.600) (-1411.737) (-1411.348) [-1414.338] * [-1411.997] (-1413.616) (-1412.636) (-1412.819) -- 0:00:26 584500 -- (-1416.012) (-1411.655) (-1414.086) [-1416.194] * (-1413.421) (-1414.571) [-1411.668] (-1411.676) -- 0:00:26 585000 -- (-1416.688) (-1411.573) [-1412.052] (-1415.235) * (-1413.720) (-1415.665) [-1411.531] (-1412.983) -- 0:00:26 Average standard deviation of split frequencies: 0.008949 585500 -- (-1418.705) (-1412.733) (-1412.987) [-1413.530] * (-1417.869) (-1411.733) [-1412.599] (-1414.506) -- 0:00:26 586000 -- (-1415.089) (-1414.278) [-1411.539] (-1415.450) * (-1412.455) (-1414.290) (-1415.604) [-1414.205] -- 0:00:26 586500 -- (-1416.199) (-1411.597) (-1411.434) [-1412.864] * (-1411.474) (-1414.599) (-1412.625) [-1414.530] -- 0:00:26 587000 -- (-1412.015) (-1412.431) (-1418.585) [-1411.862] * (-1412.042) (-1415.093) [-1411.741] (-1412.401) -- 0:00:26 587500 -- [-1413.081] (-1413.529) (-1416.846) (-1412.725) * (-1412.867) [-1412.654] (-1411.856) (-1414.330) -- 0:00:25 588000 -- (-1417.745) [-1415.222] (-1414.776) (-1412.600) * (-1414.048) (-1414.894) [-1414.257] (-1412.121) -- 0:00:25 588500 -- (-1416.180) (-1418.923) (-1414.235) [-1414.180] * (-1414.032) (-1413.279) (-1417.041) [-1412.714] -- 0:00:25 589000 -- (-1412.354) (-1420.692) (-1414.308) [-1414.199] * (-1414.601) (-1413.306) (-1417.232) [-1415.908] -- 0:00:25 589500 -- [-1412.622] (-1413.315) (-1413.847) (-1412.619) * [-1413.280] (-1413.793) (-1415.235) (-1413.960) -- 0:00:25 590000 -- (-1412.399) [-1412.074] (-1416.234) (-1411.514) * (-1413.278) [-1415.113] (-1413.131) (-1417.685) -- 0:00:25 Average standard deviation of split frequencies: 0.009228 590500 -- (-1413.961) (-1414.259) (-1413.745) [-1411.800] * (-1414.390) [-1414.365] (-1413.950) (-1420.220) -- 0:00:25 591000 -- (-1414.962) (-1411.555) [-1412.644] (-1411.863) * (-1414.357) (-1411.653) [-1414.950] (-1414.627) -- 0:00:25 591500 -- (-1412.595) (-1412.438) [-1414.527] (-1413.074) * (-1411.365) [-1413.781] (-1414.562) (-1415.766) -- 0:00:25 592000 -- [-1414.282] (-1413.932) (-1411.285) (-1415.012) * (-1411.471) [-1414.435] (-1412.868) (-1412.331) -- 0:00:25 592500 -- (-1412.514) [-1417.128] (-1417.123) (-1419.247) * (-1412.094) (-1411.197) [-1413.192] (-1412.857) -- 0:00:25 593000 -- (-1411.900) [-1413.682] (-1416.128) (-1412.271) * (-1411.704) (-1411.869) (-1413.416) [-1411.914] -- 0:00:25 593500 -- (-1413.620) [-1414.074] (-1414.263) (-1414.319) * (-1413.481) [-1415.463] (-1412.052) (-1412.950) -- 0:00:25 594000 -- [-1413.506] (-1412.290) (-1416.068) (-1414.869) * (-1415.665) (-1412.074) [-1411.173] (-1414.162) -- 0:00:25 594500 -- (-1415.191) (-1413.504) [-1412.883] (-1413.946) * (-1411.981) (-1411.578) [-1414.412] (-1413.439) -- 0:00:25 595000 -- (-1415.155) (-1417.364) (-1412.110) [-1415.431] * (-1413.413) [-1411.511] (-1414.562) (-1411.986) -- 0:00:25 Average standard deviation of split frequencies: 0.009343 595500 -- [-1414.166] (-1414.168) (-1412.304) (-1413.332) * (-1417.214) (-1411.703) [-1417.376] (-1412.193) -- 0:00:25 596000 -- (-1413.867) [-1413.903] (-1412.367) (-1412.886) * (-1412.605) (-1411.792) [-1416.875] (-1411.723) -- 0:00:25 596500 -- (-1415.260) [-1415.254] (-1411.917) (-1415.882) * (-1413.435) (-1411.634) [-1413.947] (-1412.753) -- 0:00:25 597000 -- [-1413.520] (-1412.846) (-1413.772) (-1414.778) * [-1413.290] (-1411.634) (-1412.664) (-1412.563) -- 0:00:25 597500 -- (-1412.526) (-1413.709) [-1413.921] (-1417.622) * (-1411.805) (-1413.897) [-1412.418] (-1415.643) -- 0:00:25 598000 -- (-1415.890) (-1411.846) [-1411.876] (-1414.923) * (-1411.443) [-1411.795] (-1414.479) (-1414.838) -- 0:00:25 598500 -- (-1412.111) (-1413.505) [-1412.399] (-1416.776) * [-1412.339] (-1412.246) (-1414.486) (-1413.409) -- 0:00:25 599000 -- (-1412.578) (-1412.729) (-1415.251) [-1414.116] * (-1412.797) (-1414.199) [-1413.472] (-1413.812) -- 0:00:25 599500 -- [-1413.771] (-1412.864) (-1415.854) (-1413.227) * (-1416.384) (-1415.923) [-1412.626] (-1411.748) -- 0:00:25 600000 -- (-1411.854) [-1412.598] (-1413.809) (-1414.464) * (-1416.465) (-1415.404) [-1413.070] (-1415.177) -- 0:00:25 Average standard deviation of split frequencies: 0.009369 600500 -- [-1411.946] (-1413.518) (-1412.829) (-1413.744) * (-1416.906) [-1416.064] (-1412.921) (-1412.611) -- 0:00:25 601000 -- (-1412.550) [-1417.882] (-1412.561) (-1415.662) * (-1418.899) (-1411.876) (-1412.890) [-1411.458] -- 0:00:25 601500 -- (-1419.106) (-1413.323) [-1412.561] (-1413.791) * (-1414.767) (-1412.152) (-1414.422) [-1414.416] -- 0:00:25 602000 -- (-1421.062) (-1411.096) (-1412.891) [-1415.942] * (-1411.416) [-1414.211] (-1411.802) (-1414.770) -- 0:00:25 602500 -- [-1415.521] (-1412.310) (-1411.275) (-1415.784) * (-1412.063) [-1411.941] (-1411.310) (-1412.692) -- 0:00:25 603000 -- (-1412.203) [-1413.610] (-1414.407) (-1416.671) * (-1412.656) (-1414.185) [-1412.716] (-1420.681) -- 0:00:25 603500 -- [-1415.121] (-1412.147) (-1414.263) (-1413.515) * (-1413.418) (-1414.791) (-1412.339) [-1413.106] -- 0:00:24 604000 -- (-1412.334) (-1414.149) [-1412.169] (-1416.421) * (-1414.226) [-1414.553] (-1414.573) (-1414.473) -- 0:00:24 604500 -- (-1417.572) (-1416.851) [-1411.886] (-1419.139) * (-1412.355) [-1415.281] (-1412.631) (-1412.290) -- 0:00:24 605000 -- (-1412.435) (-1414.031) (-1411.796) [-1414.368] * [-1412.577] (-1414.407) (-1411.886) (-1412.758) -- 0:00:24 Average standard deviation of split frequencies: 0.009383 605500 -- [-1414.431] (-1414.454) (-1412.123) (-1413.880) * [-1412.344] (-1414.939) (-1414.479) (-1412.041) -- 0:00:24 606000 -- (-1413.904) [-1413.881] (-1411.553) (-1411.508) * (-1413.627) (-1415.079) (-1416.048) [-1411.937] -- 0:00:24 606500 -- [-1413.724] (-1413.904) (-1413.233) (-1413.442) * [-1414.616] (-1416.019) (-1416.768) (-1412.492) -- 0:00:24 607000 -- (-1411.988) (-1412.954) (-1414.489) [-1413.198] * (-1416.300) [-1413.005] (-1413.953) (-1414.022) -- 0:00:24 607500 -- (-1413.012) (-1414.521) [-1413.601] (-1415.570) * (-1412.997) (-1413.250) (-1413.586) [-1413.577] -- 0:00:24 608000 -- (-1416.813) [-1412.333] (-1415.190) (-1413.143) * [-1415.734] (-1413.436) (-1415.075) (-1413.612) -- 0:00:24 608500 -- (-1419.584) (-1415.153) (-1414.860) [-1412.480] * (-1417.013) [-1417.147] (-1416.628) (-1413.921) -- 0:00:24 609000 -- (-1414.513) (-1414.779) (-1416.428) [-1415.027] * (-1413.499) (-1413.438) [-1411.831] (-1412.791) -- 0:00:24 609500 -- (-1412.937) [-1414.068] (-1416.127) (-1412.678) * (-1413.398) [-1412.541] (-1412.286) (-1412.654) -- 0:00:24 610000 -- [-1412.903] (-1421.008) (-1413.571) (-1421.156) * [-1412.632] (-1412.406) (-1414.304) (-1412.983) -- 0:00:24 Average standard deviation of split frequencies: 0.009891 610500 -- (-1414.536) (-1414.309) (-1415.874) [-1412.520] * (-1413.473) [-1412.010] (-1416.297) (-1413.207) -- 0:00:24 611000 -- (-1415.781) (-1416.369) [-1412.224] (-1412.722) * [-1411.736] (-1412.546) (-1411.395) (-1412.957) -- 0:00:24 611500 -- (-1413.385) (-1412.628) [-1412.507] (-1414.400) * (-1412.786) [-1412.148] (-1411.393) (-1414.255) -- 0:00:24 612000 -- [-1412.025] (-1416.072) (-1413.679) (-1413.155) * [-1413.411] (-1414.007) (-1411.536) (-1412.713) -- 0:00:24 612500 -- (-1414.050) (-1411.126) (-1415.865) [-1415.393] * (-1416.044) (-1414.691) (-1413.823) [-1416.530] -- 0:00:24 613000 -- (-1415.675) [-1413.107] (-1414.785) (-1415.156) * [-1411.554] (-1412.613) (-1414.161) (-1415.235) -- 0:00:24 613500 -- [-1418.264] (-1415.993) (-1416.603) (-1412.703) * (-1411.974) (-1412.709) (-1412.621) [-1414.459] -- 0:00:24 614000 -- [-1413.899] (-1417.113) (-1412.580) (-1411.033) * [-1411.520] (-1417.838) (-1412.763) (-1412.927) -- 0:00:24 614500 -- (-1412.090) (-1411.427) [-1413.033] (-1413.166) * (-1411.710) (-1415.471) [-1414.606] (-1414.727) -- 0:00:24 615000 -- (-1413.634) [-1412.340] (-1414.758) (-1414.154) * (-1412.660) [-1413.191] (-1414.001) (-1413.190) -- 0:00:24 Average standard deviation of split frequencies: 0.009709 615500 -- (-1412.283) [-1412.534] (-1417.110) (-1414.158) * [-1414.206] (-1413.095) (-1412.789) (-1413.510) -- 0:00:24 616000 -- [-1411.225] (-1414.373) (-1416.192) (-1418.779) * (-1412.513) [-1415.429] (-1413.329) (-1413.668) -- 0:00:24 616500 -- (-1411.699) [-1412.353] (-1412.057) (-1413.612) * (-1413.842) (-1414.545) (-1412.036) [-1412.345] -- 0:00:24 617000 -- (-1414.235) (-1412.519) (-1415.723) [-1412.835] * (-1413.380) (-1413.236) [-1412.248] (-1414.512) -- 0:00:24 617500 -- (-1413.989) [-1413.318] (-1412.571) (-1412.694) * [-1412.774] (-1413.366) (-1414.739) (-1413.768) -- 0:00:24 618000 -- (-1417.063) (-1417.014) (-1413.576) [-1413.776] * [-1414.016] (-1411.429) (-1411.714) (-1412.623) -- 0:00:24 618500 -- (-1416.414) [-1412.555] (-1416.127) (-1413.447) * [-1415.048] (-1412.815) (-1414.274) (-1413.686) -- 0:00:24 619000 -- (-1415.119) (-1412.189) (-1412.888) [-1413.192] * (-1416.797) (-1416.137) (-1413.711) [-1414.020] -- 0:00:24 619500 -- (-1416.197) [-1411.630] (-1411.486) (-1412.392) * (-1414.855) [-1412.317] (-1411.865) (-1412.564) -- 0:00:23 620000 -- (-1413.143) [-1413.247] (-1415.589) (-1411.668) * (-1415.957) [-1412.043] (-1419.668) (-1415.774) -- 0:00:23 Average standard deviation of split frequencies: 0.009304 620500 -- (-1414.019) (-1411.527) (-1413.520) [-1412.289] * (-1415.449) (-1412.845) [-1413.146] (-1414.573) -- 0:00:23 621000 -- (-1416.059) (-1415.681) [-1417.454] (-1415.846) * (-1415.320) [-1414.468] (-1415.391) (-1413.004) -- 0:00:23 621500 -- [-1414.260] (-1412.822) (-1417.752) (-1416.470) * (-1413.105) (-1413.891) (-1413.492) [-1415.592] -- 0:00:23 622000 -- (-1416.156) (-1414.181) [-1411.777] (-1413.955) * [-1414.108] (-1413.559) (-1414.424) (-1414.781) -- 0:00:23 622500 -- (-1412.017) (-1412.925) (-1412.230) [-1411.711] * (-1415.612) (-1411.813) [-1412.497] (-1413.524) -- 0:00:23 623000 -- [-1414.388] (-1411.876) (-1416.914) (-1413.629) * (-1414.222) [-1412.025] (-1416.021) (-1414.386) -- 0:00:23 623500 -- (-1412.544) [-1411.949] (-1414.529) (-1413.924) * (-1412.189) [-1414.233] (-1414.545) (-1413.056) -- 0:00:23 624000 -- [-1412.244] (-1414.151) (-1415.308) (-1411.996) * (-1416.949) [-1413.769] (-1413.653) (-1413.141) -- 0:00:23 624500 -- [-1412.921] (-1415.174) (-1414.065) (-1412.968) * [-1413.986] (-1412.707) (-1414.016) (-1413.551) -- 0:00:23 625000 -- [-1413.898] (-1414.607) (-1414.023) (-1413.281) * [-1413.019] (-1414.309) (-1411.894) (-1412.764) -- 0:00:23 Average standard deviation of split frequencies: 0.009084 625500 -- [-1415.191] (-1416.588) (-1414.394) (-1413.281) * (-1412.518) (-1411.549) (-1412.526) [-1415.225] -- 0:00:23 626000 -- (-1412.236) [-1414.148] (-1411.955) (-1412.346) * (-1413.694) (-1413.789) [-1411.943] (-1412.890) -- 0:00:23 626500 -- (-1412.616) (-1417.120) [-1412.014] (-1414.897) * (-1416.149) [-1412.102] (-1412.753) (-1412.784) -- 0:00:23 627000 -- (-1412.226) [-1413.095] (-1414.283) (-1414.544) * (-1413.764) [-1412.469] (-1415.295) (-1412.356) -- 0:00:23 627500 -- (-1414.247) (-1414.019) (-1414.209) [-1412.130] * (-1414.046) (-1415.522) [-1413.487] (-1413.203) -- 0:00:23 628000 -- (-1414.236) (-1414.510) (-1413.863) [-1414.575] * [-1414.076] (-1412.225) (-1412.308) (-1416.265) -- 0:00:23 628500 -- (-1411.486) (-1411.933) (-1415.237) [-1412.942] * (-1411.030) (-1412.993) [-1413.478] (-1417.433) -- 0:00:23 629000 -- [-1412.026] (-1413.575) (-1413.730) (-1412.532) * [-1411.431] (-1412.102) (-1412.602) (-1413.054) -- 0:00:23 629500 -- (-1412.219) (-1414.052) [-1412.995] (-1413.354) * (-1413.187) (-1411.547) [-1414.251] (-1412.071) -- 0:00:23 630000 -- (-1411.972) (-1418.247) (-1414.595) [-1413.466] * [-1411.524] (-1412.333) (-1414.961) (-1414.200) -- 0:00:23 Average standard deviation of split frequencies: 0.009577 630500 -- (-1414.209) (-1418.623) (-1416.756) [-1415.487] * (-1411.364) (-1412.092) [-1412.686] (-1413.669) -- 0:00:23 631000 -- (-1414.546) [-1415.815] (-1413.444) (-1413.550) * (-1414.710) (-1412.220) [-1412.436] (-1414.730) -- 0:00:23 631500 -- (-1412.025) [-1414.397] (-1412.374) (-1412.453) * (-1413.968) [-1414.224] (-1413.568) (-1413.991) -- 0:00:23 632000 -- [-1411.302] (-1413.864) (-1413.335) (-1412.407) * (-1413.366) [-1414.151] (-1413.736) (-1416.240) -- 0:00:23 632500 -- (-1414.402) (-1411.978) [-1414.021] (-1412.338) * (-1412.115) [-1414.128] (-1413.525) (-1418.778) -- 0:00:23 633000 -- (-1413.200) (-1416.264) [-1414.836] (-1411.617) * (-1414.063) (-1416.866) (-1413.662) [-1412.865] -- 0:00:23 633500 -- (-1413.647) [-1414.347] (-1415.229) (-1415.254) * [-1413.494] (-1414.697) (-1416.090) (-1413.995) -- 0:00:23 634000 -- [-1415.418] (-1412.763) (-1412.296) (-1413.085) * [-1411.596] (-1414.368) (-1414.233) (-1415.105) -- 0:00:23 634500 -- [-1413.367] (-1414.157) (-1417.561) (-1414.915) * (-1411.818) (-1412.220) [-1415.770] (-1414.372) -- 0:00:23 635000 -- [-1411.957] (-1417.890) (-1413.996) (-1417.319) * (-1416.853) (-1417.049) (-1417.204) [-1413.210] -- 0:00:22 Average standard deviation of split frequencies: 0.008987 635500 -- [-1415.662] (-1416.794) (-1413.347) (-1414.179) * [-1413.606] (-1415.168) (-1411.876) (-1411.971) -- 0:00:22 636000 -- (-1416.913) [-1414.493] (-1412.901) (-1413.159) * [-1411.237] (-1413.701) (-1412.532) (-1413.445) -- 0:00:22 636500 -- [-1412.894] (-1419.367) (-1414.985) (-1415.984) * [-1412.863] (-1414.312) (-1412.820) (-1411.430) -- 0:00:22 637000 -- [-1414.725] (-1412.280) (-1414.822) (-1414.685) * (-1413.736) (-1413.092) [-1413.271] (-1413.293) -- 0:00:22 637500 -- (-1415.087) (-1412.306) (-1418.606) [-1414.234] * (-1415.894) (-1412.582) (-1413.386) [-1412.951] -- 0:00:22 638000 -- (-1415.318) (-1413.632) [-1413.996] (-1420.024) * (-1413.966) (-1411.961) (-1412.930) [-1414.533] -- 0:00:22 638500 -- (-1414.393) (-1413.652) [-1412.409] (-1417.367) * (-1416.204) [-1412.909] (-1414.561) (-1411.411) -- 0:00:22 639000 -- (-1412.691) (-1413.026) [-1412.210] (-1413.329) * (-1413.712) [-1413.739] (-1414.821) (-1411.669) -- 0:00:22 639500 -- (-1413.220) [-1411.966] (-1411.677) (-1413.338) * (-1413.725) [-1412.522] (-1412.379) (-1414.441) -- 0:00:22 640000 -- [-1411.255] (-1412.765) (-1411.640) (-1413.121) * (-1413.516) (-1412.004) [-1412.056] (-1412.368) -- 0:00:22 Average standard deviation of split frequencies: 0.008370 640500 -- (-1414.727) (-1411.284) (-1411.807) [-1412.302] * (-1418.493) (-1412.255) [-1411.103] (-1416.683) -- 0:00:22 641000 -- (-1411.731) (-1415.025) [-1415.748] (-1412.362) * (-1412.968) [-1411.736] (-1411.750) (-1413.218) -- 0:00:22 641500 -- [-1412.720] (-1416.021) (-1414.620) (-1412.257) * (-1412.873) (-1414.638) [-1412.282] (-1414.544) -- 0:00:22 642000 -- [-1414.108] (-1413.016) (-1412.323) (-1412.259) * (-1412.950) [-1412.807] (-1412.272) (-1413.200) -- 0:00:22 642500 -- (-1418.317) (-1412.751) (-1411.693) [-1414.994] * (-1411.567) (-1415.191) (-1412.755) [-1416.487] -- 0:00:22 643000 -- (-1411.781) (-1415.785) [-1412.071] (-1414.982) * [-1414.136] (-1417.128) (-1416.406) (-1413.307) -- 0:00:22 643500 -- (-1414.961) [-1413.822] (-1412.052) (-1412.554) * (-1412.519) (-1415.282) [-1414.373] (-1413.775) -- 0:00:22 644000 -- (-1419.576) (-1412.008) (-1416.625) [-1411.801] * [-1411.619] (-1414.706) (-1414.238) (-1416.348) -- 0:00:22 644500 -- (-1414.147) (-1411.631) (-1415.573) [-1412.151] * (-1415.242) [-1414.210] (-1413.877) (-1415.974) -- 0:00:22 645000 -- [-1411.259] (-1415.156) (-1414.084) (-1415.348) * [-1411.495] (-1413.456) (-1413.325) (-1412.473) -- 0:00:22 Average standard deviation of split frequencies: 0.008711 645500 -- (-1411.247) (-1412.674) (-1415.624) [-1413.591] * [-1412.208] (-1413.145) (-1414.329) (-1413.469) -- 0:00:22 646000 -- (-1412.282) [-1413.972] (-1415.571) (-1412.515) * (-1413.005) (-1413.921) [-1414.073] (-1411.935) -- 0:00:22 646500 -- (-1413.328) [-1415.466] (-1412.327) (-1413.493) * [-1413.898] (-1411.167) (-1412.793) (-1414.411) -- 0:00:22 647000 -- (-1414.309) (-1413.878) (-1415.034) [-1413.152] * (-1413.627) [-1411.183] (-1415.157) (-1412.208) -- 0:00:22 647500 -- (-1412.854) (-1412.610) (-1417.358) [-1413.394] * (-1413.366) (-1411.528) [-1412.615] (-1417.708) -- 0:00:22 648000 -- (-1411.853) (-1412.007) (-1412.750) [-1413.890] * (-1416.275) [-1416.027] (-1411.980) (-1418.656) -- 0:00:22 648500 -- [-1414.929] (-1414.042) (-1412.095) (-1412.680) * (-1414.260) [-1412.147] (-1414.889) (-1413.404) -- 0:00:22 649000 -- [-1414.803] (-1413.405) (-1412.597) (-1417.378) * [-1412.933] (-1415.843) (-1411.836) (-1411.965) -- 0:00:22 649500 -- (-1412.601) [-1416.341] (-1412.461) (-1412.337) * (-1413.567) (-1415.347) [-1412.334] (-1412.087) -- 0:00:22 650000 -- [-1411.785] (-1418.872) (-1418.103) (-1413.075) * (-1415.015) (-1413.324) (-1412.629) [-1412.755] -- 0:00:22 Average standard deviation of split frequencies: 0.008920 650500 -- [-1411.810] (-1411.726) (-1413.633) (-1413.117) * (-1414.766) [-1413.258] (-1411.826) (-1411.980) -- 0:00:22 651000 -- (-1418.825) (-1412.899) (-1414.904) [-1411.994] * (-1413.086) (-1412.591) (-1413.793) [-1413.465] -- 0:00:21 651500 -- (-1412.707) (-1412.514) (-1412.922) [-1411.761] * (-1414.642) [-1412.399] (-1418.039) (-1413.250) -- 0:00:21 652000 -- (-1412.999) (-1412.165) (-1413.899) [-1413.249] * (-1413.664) (-1414.593) (-1416.073) [-1412.085] -- 0:00:21 652500 -- [-1413.836] (-1412.937) (-1413.064) (-1413.951) * (-1413.568) (-1416.954) (-1414.450) [-1413.299] -- 0:00:21 653000 -- (-1413.527) (-1413.367) [-1411.580] (-1414.670) * (-1415.181) (-1413.312) (-1415.212) [-1412.935] -- 0:00:21 653500 -- (-1415.063) (-1413.518) [-1411.922] (-1413.558) * (-1413.977) (-1412.434) [-1413.972] (-1418.054) -- 0:00:21 654000 -- [-1413.166] (-1414.416) (-1413.331) (-1412.615) * (-1412.005) (-1413.222) (-1412.657) [-1412.278] -- 0:00:21 654500 -- (-1414.962) (-1417.995) (-1416.017) [-1412.104] * [-1416.359] (-1412.440) (-1412.105) (-1411.565) -- 0:00:21 655000 -- [-1412.524] (-1412.359) (-1413.470) (-1412.049) * (-1415.392) [-1411.688] (-1422.524) (-1411.518) -- 0:00:21 Average standard deviation of split frequencies: 0.009162 655500 -- (-1418.706) [-1412.792] (-1413.454) (-1412.014) * (-1420.305) (-1411.377) [-1412.926] (-1414.109) -- 0:00:21 656000 -- (-1420.272) (-1412.486) [-1414.237] (-1411.560) * (-1415.440) (-1415.152) [-1414.370] (-1415.656) -- 0:00:21 656500 -- [-1411.191] (-1412.896) (-1412.846) (-1411.969) * (-1411.796) (-1412.212) [-1414.003] (-1414.889) -- 0:00:21 657000 -- (-1414.825) (-1414.339) (-1417.361) [-1411.272] * (-1417.123) (-1413.943) (-1415.375) [-1414.915] -- 0:00:21 657500 -- (-1416.080) (-1412.951) (-1417.660) [-1413.117] * (-1412.989) (-1414.045) [-1415.970] (-1413.711) -- 0:00:21 658000 -- (-1414.913) [-1411.793] (-1414.828) (-1411.682) * (-1415.559) [-1412.383] (-1414.025) (-1414.253) -- 0:00:21 658500 -- (-1413.614) (-1415.205) [-1414.650] (-1413.061) * (-1411.733) (-1415.389) [-1412.487] (-1412.721) -- 0:00:21 659000 -- (-1411.433) (-1414.319) [-1413.730] (-1414.197) * (-1412.408) [-1413.324] (-1412.674) (-1412.861) -- 0:00:21 659500 -- (-1416.123) (-1412.177) [-1414.453] (-1411.547) * (-1415.023) [-1412.926] (-1412.860) (-1412.685) -- 0:00:21 660000 -- (-1413.969) [-1411.965] (-1412.067) (-1411.602) * (-1415.136) [-1413.069] (-1411.352) (-1413.263) -- 0:00:21 Average standard deviation of split frequencies: 0.009097 660500 -- (-1413.119) (-1411.432) (-1413.431) [-1412.563] * (-1412.268) [-1411.650] (-1412.357) (-1418.401) -- 0:00:21 661000 -- (-1411.278) [-1412.450] (-1412.428) (-1414.590) * (-1414.450) (-1413.604) (-1412.279) [-1412.496] -- 0:00:21 661500 -- [-1415.121] (-1415.012) (-1414.076) (-1415.547) * (-1416.266) (-1413.556) (-1412.233) [-1415.260] -- 0:00:21 662000 -- (-1417.345) (-1413.118) (-1412.209) [-1413.907] * (-1411.994) [-1413.312] (-1413.305) (-1415.832) -- 0:00:21 662500 -- (-1413.350) [-1412.102] (-1416.491) (-1412.606) * (-1412.099) (-1413.809) (-1413.789) [-1413.893] -- 0:00:21 663000 -- (-1412.952) (-1412.292) [-1417.531] (-1414.275) * (-1412.099) (-1414.376) [-1413.445] (-1413.365) -- 0:00:21 663500 -- (-1411.717) (-1412.333) (-1413.507) [-1412.950] * (-1412.885) (-1416.647) (-1412.992) [-1411.144] -- 0:00:21 664000 -- (-1411.674) (-1412.583) [-1411.822] (-1412.950) * (-1414.706) (-1415.261) (-1412.882) [-1411.144] -- 0:00:21 664500 -- (-1414.043) (-1413.643) [-1411.694] (-1412.309) * (-1414.859) (-1411.253) (-1415.824) [-1411.382] -- 0:00:21 665000 -- (-1413.362) (-1412.489) [-1412.639] (-1412.368) * (-1415.510) (-1412.917) [-1412.269] (-1411.762) -- 0:00:21 Average standard deviation of split frequencies: 0.008803 665500 -- [-1412.594] (-1412.032) (-1412.043) (-1416.472) * [-1415.055] (-1417.620) (-1411.843) (-1412.013) -- 0:00:21 666000 -- (-1416.242) (-1411.436) (-1413.255) [-1415.021] * (-1421.270) [-1413.247] (-1417.379) (-1413.399) -- 0:00:21 666500 -- [-1412.828] (-1412.340) (-1413.454) (-1412.819) * (-1411.551) (-1417.808) [-1412.669] (-1418.979) -- 0:00:21 667000 -- (-1411.546) (-1412.340) [-1414.231] (-1412.018) * (-1412.755) (-1413.124) (-1414.171) [-1412.696] -- 0:00:20 667500 -- (-1413.774) (-1418.086) [-1414.960] (-1413.682) * [-1415.443] (-1414.229) (-1414.045) (-1413.397) -- 0:00:20 668000 -- (-1416.388) [-1414.316] (-1412.513) (-1412.708) * (-1415.758) [-1413.933] (-1415.683) (-1413.935) -- 0:00:20 668500 -- (-1415.582) (-1416.650) [-1412.474] (-1415.955) * (-1415.428) [-1412.095] (-1413.318) (-1413.384) -- 0:00:20 669000 -- (-1413.253) [-1412.456] (-1412.265) (-1413.866) * [-1413.941] (-1412.412) (-1413.971) (-1411.401) -- 0:00:20 669500 -- [-1412.392] (-1414.840) (-1412.440) (-1414.267) * (-1412.675) (-1411.352) (-1419.987) [-1411.792] -- 0:00:20 670000 -- (-1412.452) (-1413.082) (-1414.276) [-1411.868] * (-1413.875) (-1412.027) [-1418.834] (-1415.858) -- 0:00:20 Average standard deviation of split frequencies: 0.008742 670500 -- [-1412.453] (-1412.966) (-1415.259) (-1411.786) * (-1412.679) (-1411.868) [-1411.371] (-1412.137) -- 0:00:20 671000 -- (-1412.393) [-1413.962] (-1413.560) (-1412.143) * (-1413.464) [-1411.461] (-1413.442) (-1414.275) -- 0:00:20 671500 -- (-1413.357) (-1411.750) (-1414.697) [-1411.754] * (-1416.228) [-1411.720] (-1415.230) (-1418.495) -- 0:00:20 672000 -- (-1413.449) (-1416.010) (-1415.199) [-1413.801] * (-1413.422) [-1412.409] (-1415.019) (-1418.142) -- 0:00:20 672500 -- (-1413.471) (-1412.028) (-1412.827) [-1412.953] * (-1415.834) (-1414.663) [-1413.286] (-1415.276) -- 0:00:20 673000 -- (-1416.528) (-1411.957) [-1411.787] (-1413.870) * (-1413.973) (-1413.641) [-1413.431] (-1413.893) -- 0:00:20 673500 -- (-1414.052) [-1411.825] (-1414.220) (-1412.818) * (-1414.421) [-1413.327] (-1412.992) (-1413.680) -- 0:00:20 674000 -- (-1413.246) (-1411.647) (-1412.108) [-1412.004] * (-1415.204) [-1417.331] (-1415.024) (-1412.458) -- 0:00:20 674500 -- (-1415.253) (-1413.990) [-1413.666] (-1419.582) * (-1419.713) (-1415.957) [-1413.941] (-1418.816) -- 0:00:20 675000 -- (-1418.159) [-1413.601] (-1412.220) (-1419.360) * (-1418.628) (-1412.798) [-1416.997] (-1415.587) -- 0:00:20 Average standard deviation of split frequencies: 0.009371 675500 -- [-1415.639] (-1413.293) (-1413.539) (-1416.633) * (-1415.174) [-1412.926] (-1412.203) (-1415.960) -- 0:00:20 676000 -- (-1414.498) (-1417.180) [-1414.058] (-1415.164) * (-1413.877) (-1414.942) [-1413.196] (-1412.975) -- 0:00:20 676500 -- (-1412.933) (-1417.850) [-1413.807] (-1412.011) * (-1412.572) [-1413.368] (-1412.955) (-1417.089) -- 0:00:20 677000 -- (-1413.163) [-1414.675] (-1414.748) (-1414.673) * (-1412.909) [-1411.731] (-1413.248) (-1413.855) -- 0:00:20 677500 -- [-1415.876] (-1412.955) (-1415.633) (-1415.903) * (-1411.696) (-1411.693) (-1412.716) [-1412.976] -- 0:00:20 678000 -- (-1413.680) (-1420.898) (-1414.874) [-1417.934] * (-1417.419) (-1411.423) [-1413.014] (-1412.347) -- 0:00:20 678500 -- (-1414.259) (-1412.453) [-1412.554] (-1412.444) * (-1416.298) (-1412.313) (-1413.420) [-1412.427] -- 0:00:20 679000 -- (-1416.533) (-1414.070) [-1413.048] (-1412.171) * [-1412.076] (-1413.837) (-1415.940) (-1414.057) -- 0:00:20 679500 -- (-1417.566) (-1417.448) (-1412.940) [-1414.901] * [-1412.779] (-1412.601) (-1414.365) (-1413.214) -- 0:00:20 680000 -- (-1414.330) [-1414.966] (-1411.421) (-1412.755) * (-1413.192) (-1412.414) (-1412.851) [-1411.473] -- 0:00:20 Average standard deviation of split frequencies: 0.009566 680500 -- (-1414.370) (-1413.085) [-1411.427] (-1413.368) * (-1413.129) (-1412.278) [-1412.745] (-1414.228) -- 0:00:20 681000 -- (-1414.570) (-1411.470) [-1414.140] (-1413.168) * (-1413.393) (-1412.387) (-1415.928) [-1411.894] -- 0:00:20 681500 -- (-1413.570) (-1411.767) (-1411.762) [-1413.336] * (-1413.004) (-1412.288) (-1418.817) [-1412.627] -- 0:00:20 682000 -- (-1414.932) (-1412.739) (-1413.642) [-1413.142] * (-1411.860) [-1413.176] (-1412.523) (-1411.265) -- 0:00:20 682500 -- (-1415.232) (-1412.125) [-1412.469] (-1416.103) * (-1412.988) [-1412.372] (-1412.444) (-1411.877) -- 0:00:20 683000 -- (-1416.372) (-1411.611) (-1417.659) [-1413.228] * (-1415.673) (-1417.002) (-1414.252) [-1414.031] -- 0:00:19 683500 -- [-1415.670] (-1416.557) (-1414.623) (-1413.719) * (-1412.574) [-1412.253] (-1417.145) (-1414.168) -- 0:00:19 684000 -- (-1418.410) [-1411.614] (-1415.635) (-1411.731) * [-1415.416] (-1412.243) (-1413.247) (-1414.167) -- 0:00:19 684500 -- (-1414.214) (-1411.845) [-1412.028] (-1413.027) * (-1413.155) (-1412.988) (-1412.244) [-1413.855] -- 0:00:19 685000 -- (-1413.456) [-1411.539] (-1411.843) (-1413.934) * [-1415.542] (-1415.354) (-1413.214) (-1414.664) -- 0:00:19 Average standard deviation of split frequencies: 0.009535 685500 -- (-1414.412) [-1411.677] (-1412.850) (-1411.664) * (-1412.792) (-1412.668) (-1413.092) [-1414.307] -- 0:00:19 686000 -- (-1414.302) (-1411.499) [-1412.775] (-1412.284) * (-1412.847) [-1412.047] (-1412.867) (-1413.530) -- 0:00:19 686500 -- [-1413.174] (-1411.604) (-1412.200) (-1413.523) * (-1413.399) [-1411.900] (-1412.676) (-1413.027) -- 0:00:19 687000 -- [-1412.906] (-1413.671) (-1412.721) (-1415.014) * (-1410.991) [-1411.387] (-1413.465) (-1414.941) -- 0:00:19 687500 -- (-1412.920) (-1415.461) (-1417.445) [-1416.414] * (-1416.129) [-1413.931] (-1413.448) (-1411.382) -- 0:00:19 688000 -- (-1411.955) (-1412.391) [-1415.031] (-1414.863) * (-1416.354) (-1413.804) (-1412.500) [-1411.266] -- 0:00:19 688500 -- (-1413.469) (-1413.517) [-1413.729] (-1413.542) * (-1418.091) [-1413.313] (-1413.063) (-1412.010) -- 0:00:19 689000 -- (-1412.273) (-1412.160) [-1413.288] (-1414.995) * (-1414.141) (-1414.846) [-1412.903] (-1418.161) -- 0:00:19 689500 -- (-1421.042) [-1412.221] (-1412.549) (-1418.405) * [-1412.133] (-1411.887) (-1412.697) (-1411.971) -- 0:00:19 690000 -- (-1413.524) (-1414.097) [-1414.216] (-1414.961) * [-1416.266] (-1412.780) (-1412.838) (-1413.251) -- 0:00:19 Average standard deviation of split frequencies: 0.009555 690500 -- (-1413.605) [-1414.374] (-1414.757) (-1416.266) * (-1415.775) (-1416.074) [-1413.686] (-1414.953) -- 0:00:19 691000 -- [-1414.062] (-1414.237) (-1414.087) (-1417.528) * [-1414.196] (-1415.028) (-1416.706) (-1416.623) -- 0:00:19 691500 -- [-1415.197] (-1411.943) (-1413.142) (-1414.605) * [-1412.065] (-1415.405) (-1413.054) (-1415.751) -- 0:00:19 692000 -- (-1414.924) (-1411.252) (-1414.238) [-1412.992] * (-1412.063) (-1411.940) [-1413.196] (-1416.079) -- 0:00:19 692500 -- (-1412.557) (-1412.575) (-1412.888) [-1412.219] * (-1414.854) (-1413.398) [-1415.401] (-1413.780) -- 0:00:19 693000 -- (-1417.551) [-1415.731] (-1413.598) (-1413.118) * (-1412.346) [-1412.755] (-1419.706) (-1413.817) -- 0:00:19 693500 -- (-1413.364) (-1412.463) (-1411.681) [-1413.247] * (-1416.698) (-1417.163) (-1415.129) [-1413.596] -- 0:00:19 694000 -- [-1413.741] (-1415.519) (-1412.977) (-1415.024) * (-1413.281) (-1413.927) [-1416.175] (-1413.141) -- 0:00:19 694500 -- (-1412.192) (-1416.628) (-1411.727) [-1414.502] * (-1412.499) (-1413.757) (-1414.194) [-1416.313] -- 0:00:19 695000 -- [-1411.998] (-1413.587) (-1412.465) (-1413.682) * [-1412.251] (-1413.484) (-1414.142) (-1417.467) -- 0:00:19 Average standard deviation of split frequencies: 0.009652 695500 -- (-1411.605) (-1412.634) (-1413.951) [-1413.295] * (-1412.528) [-1413.739] (-1415.938) (-1415.617) -- 0:00:19 696000 -- (-1414.859) [-1411.670] (-1412.694) (-1415.977) * (-1412.527) (-1411.982) (-1412.419) [-1413.209] -- 0:00:19 696500 -- [-1412.771] (-1414.372) (-1414.542) (-1412.465) * (-1412.957) (-1413.201) (-1416.114) [-1411.958] -- 0:00:19 697000 -- (-1414.098) (-1414.523) (-1414.848) [-1412.514] * (-1411.743) [-1412.768] (-1415.245) (-1415.183) -- 0:00:19 697500 -- [-1413.230] (-1415.416) (-1412.351) (-1419.632) * [-1413.636] (-1413.790) (-1412.173) (-1414.284) -- 0:00:19 698000 -- (-1414.836) (-1412.133) [-1412.562] (-1412.713) * [-1412.514] (-1415.124) (-1417.213) (-1412.711) -- 0:00:19 698500 -- (-1414.030) (-1414.372) (-1413.804) [-1412.480] * (-1411.112) [-1412.261] (-1420.637) (-1411.160) -- 0:00:18 699000 -- [-1411.893] (-1414.592) (-1411.597) (-1411.732) * (-1411.680) (-1411.792) (-1413.510) [-1411.160] -- 0:00:18 699500 -- (-1412.439) (-1411.858) (-1415.459) [-1413.518] * (-1411.973) (-1423.842) (-1413.881) [-1411.790] -- 0:00:18 700000 -- (-1411.815) (-1412.829) [-1412.519] (-1412.321) * (-1414.270) (-1415.926) [-1414.767] (-1411.923) -- 0:00:18 Average standard deviation of split frequencies: 0.009924 700500 -- [-1412.023] (-1414.315) (-1414.520) (-1415.264) * (-1411.987) (-1417.689) (-1412.365) [-1412.401] -- 0:00:18 701000 -- (-1415.727) (-1411.998) [-1413.083] (-1417.028) * (-1414.014) (-1413.340) [-1411.797] (-1412.594) -- 0:00:18 701500 -- (-1412.458) (-1414.749) (-1411.146) [-1412.800] * (-1416.748) (-1417.329) [-1411.827] (-1411.693) -- 0:00:18 702000 -- (-1413.828) (-1413.956) [-1411.091] (-1412.773) * [-1416.571] (-1412.385) (-1411.724) (-1414.879) -- 0:00:18 702500 -- [-1411.878] (-1416.701) (-1412.082) (-1413.137) * (-1412.952) (-1413.954) (-1416.227) [-1414.563] -- 0:00:18 703000 -- (-1412.124) (-1413.842) (-1412.222) [-1414.203] * (-1414.871) [-1412.288] (-1415.060) (-1413.859) -- 0:00:18 703500 -- (-1414.682) [-1414.627] (-1415.233) (-1417.146) * (-1412.329) (-1412.332) (-1412.935) [-1416.951] -- 0:00:18 704000 -- (-1412.455) (-1415.368) (-1417.465) [-1413.935] * (-1415.635) [-1412.911] (-1411.894) (-1412.063) -- 0:00:18 704500 -- (-1413.021) (-1414.558) [-1411.672] (-1414.803) * [-1416.319] (-1412.770) (-1413.947) (-1413.473) -- 0:00:18 705000 -- [-1412.542] (-1412.093) (-1411.785) (-1416.994) * (-1413.301) (-1413.621) [-1414.393] (-1416.314) -- 0:00:18 Average standard deviation of split frequencies: 0.009515 705500 -- [-1414.493] (-1412.725) (-1412.719) (-1417.532) * (-1411.906) (-1415.403) (-1413.138) [-1413.608] -- 0:00:18 706000 -- (-1416.739) (-1415.236) [-1413.107] (-1413.232) * (-1412.703) (-1413.875) (-1413.900) [-1412.484] -- 0:00:18 706500 -- (-1414.055) (-1412.552) (-1419.150) [-1413.254] * (-1413.349) (-1413.610) (-1413.587) [-1413.487] -- 0:00:18 707000 -- (-1415.446) (-1413.469) [-1413.447] (-1416.922) * (-1414.526) [-1411.693] (-1412.112) (-1412.534) -- 0:00:18 707500 -- [-1413.869] (-1412.115) (-1414.044) (-1415.535) * (-1412.311) (-1411.958) (-1414.417) [-1415.185] -- 0:00:18 708000 -- (-1414.270) [-1413.956] (-1413.813) (-1417.208) * [-1413.003] (-1414.725) (-1410.959) (-1413.856) -- 0:00:18 708500 -- (-1414.762) [-1414.956] (-1412.212) (-1412.602) * (-1413.034) [-1411.176] (-1412.323) (-1413.819) -- 0:00:18 709000 -- (-1413.584) (-1414.375) [-1412.553] (-1411.621) * (-1412.085) [-1415.234] (-1413.961) (-1412.317) -- 0:00:18 709500 -- (-1414.657) (-1416.459) (-1411.772) [-1411.919] * (-1418.599) (-1414.736) (-1413.123) [-1414.560] -- 0:00:18 710000 -- [-1415.266] (-1414.550) (-1412.200) (-1411.450) * (-1415.931) (-1411.535) [-1413.234] (-1414.800) -- 0:00:18 Average standard deviation of split frequencies: 0.008789 710500 -- (-1413.537) (-1413.237) [-1412.158] (-1411.417) * [-1414.976] (-1412.065) (-1414.874) (-1414.881) -- 0:00:18 711000 -- (-1412.604) (-1412.649) [-1415.057] (-1411.382) * (-1413.355) (-1416.324) [-1411.608] (-1412.827) -- 0:00:18 711500 -- (-1412.300) (-1417.453) (-1413.677) [-1418.017] * [-1413.221] (-1415.520) (-1417.663) (-1412.836) -- 0:00:18 712000 -- [-1412.185] (-1422.738) (-1413.159) (-1416.244) * (-1414.992) [-1411.877] (-1414.410) (-1413.453) -- 0:00:18 712500 -- [-1412.895] (-1415.939) (-1410.925) (-1419.151) * (-1412.707) (-1413.973) (-1417.649) [-1412.002] -- 0:00:18 713000 -- (-1412.694) [-1412.279] (-1411.599) (-1420.169) * [-1412.876] (-1411.444) (-1413.722) (-1411.635) -- 0:00:18 713500 -- (-1412.262) (-1412.169) (-1413.691) [-1414.653] * (-1415.366) (-1411.428) [-1414.799] (-1413.374) -- 0:00:18 714000 -- [-1415.336] (-1413.155) (-1413.677) (-1412.019) * (-1412.328) (-1415.588) [-1411.976] (-1421.735) -- 0:00:18 714500 -- (-1412.005) (-1413.989) [-1412.495] (-1414.929) * (-1411.680) [-1411.965] (-1411.820) (-1412.400) -- 0:00:17 715000 -- (-1412.905) (-1411.109) [-1412.532] (-1413.179) * [-1413.239] (-1413.107) (-1412.490) (-1414.451) -- 0:00:17 Average standard deviation of split frequencies: 0.008714 715500 -- (-1413.334) [-1412.148] (-1413.348) (-1415.126) * (-1416.976) [-1411.892] (-1414.735) (-1413.054) -- 0:00:17 716000 -- (-1413.101) (-1411.765) [-1414.463] (-1411.538) * (-1417.870) (-1412.885) [-1416.232] (-1412.740) -- 0:00:17 716500 -- [-1411.528] (-1411.765) (-1417.491) (-1412.214) * (-1416.574) (-1412.128) (-1411.815) [-1417.869] -- 0:00:17 717000 -- (-1415.216) (-1412.316) (-1414.769) [-1413.241] * (-1413.546) (-1413.602) [-1412.329] (-1413.207) -- 0:00:17 717500 -- (-1411.587) (-1413.667) [-1415.072] (-1413.880) * (-1415.536) (-1414.562) [-1412.000] (-1412.783) -- 0:00:17 718000 -- (-1412.573) (-1412.275) [-1413.960] (-1412.854) * (-1412.715) (-1414.776) (-1412.883) [-1412.193] -- 0:00:17 718500 -- (-1412.679) (-1412.131) (-1412.010) [-1417.129] * (-1416.232) (-1412.666) (-1411.960) [-1412.770] -- 0:00:17 719000 -- (-1413.529) (-1412.738) (-1412.178) [-1413.050] * (-1413.745) (-1413.987) [-1411.651] (-1411.917) -- 0:00:17 719500 -- (-1412.604) [-1414.937] (-1412.904) (-1416.109) * (-1415.799) (-1414.069) [-1411.494] (-1413.834) -- 0:00:17 720000 -- [-1416.029] (-1416.995) (-1413.928) (-1415.905) * (-1412.669) (-1411.677) [-1411.424] (-1412.143) -- 0:00:17 Average standard deviation of split frequencies: 0.008994 720500 -- (-1415.775) [-1413.698] (-1413.011) (-1414.217) * (-1413.134) (-1415.408) (-1411.648) [-1411.621] -- 0:00:17 721000 -- [-1414.069] (-1412.184) (-1411.546) (-1418.141) * (-1411.921) (-1418.833) [-1415.623] (-1411.621) -- 0:00:17 721500 -- (-1416.406) (-1415.485) (-1413.256) [-1412.586] * (-1412.668) [-1418.348] (-1415.618) (-1411.421) -- 0:00:17 722000 -- (-1414.216) [-1412.382] (-1412.158) (-1412.288) * (-1412.669) (-1412.515) [-1415.680] (-1415.161) -- 0:00:17 722500 -- [-1412.846] (-1412.305) (-1411.876) (-1412.884) * [-1414.220] (-1411.956) (-1413.457) (-1412.281) -- 0:00:17 723000 -- (-1414.819) [-1412.793] (-1412.298) (-1412.437) * (-1412.886) (-1411.947) (-1412.586) [-1416.358] -- 0:00:17 723500 -- [-1412.178] (-1414.317) (-1411.183) (-1411.718) * (-1412.930) (-1412.075) (-1413.481) [-1413.325] -- 0:00:17 724000 -- (-1414.342) (-1414.929) (-1411.474) [-1411.958] * (-1411.390) [-1414.908] (-1413.580) (-1412.897) -- 0:00:17 724500 -- (-1414.848) (-1418.336) (-1413.531) [-1412.577] * [-1412.320] (-1415.835) (-1413.911) (-1413.522) -- 0:00:17 725000 -- (-1413.317) [-1415.009] (-1413.654) (-1412.670) * (-1415.436) (-1416.841) [-1412.888] (-1414.403) -- 0:00:17 Average standard deviation of split frequencies: 0.009253 725500 -- (-1412.381) (-1413.025) [-1411.840] (-1411.923) * (-1414.595) (-1412.334) (-1413.112) [-1415.092] -- 0:00:17 726000 -- [-1412.849] (-1411.644) (-1412.040) (-1411.545) * (-1413.138) (-1412.570) (-1412.722) [-1411.693] -- 0:00:17 726500 -- (-1413.637) [-1413.392] (-1413.054) (-1411.580) * (-1414.673) [-1412.252] (-1418.099) (-1414.724) -- 0:00:17 727000 -- (-1413.245) [-1413.152] (-1414.590) (-1412.340) * (-1413.669) [-1411.500] (-1414.186) (-1414.342) -- 0:00:17 727500 -- (-1413.002) (-1412.302) (-1416.909) [-1411.800] * (-1416.169) (-1412.096) (-1416.111) [-1413.231] -- 0:00:17 728000 -- (-1412.703) (-1411.797) [-1414.606] (-1413.548) * (-1414.478) (-1412.719) [-1415.530] (-1412.343) -- 0:00:17 728500 -- [-1411.972] (-1413.662) (-1415.478) (-1415.897) * (-1415.018) [-1412.575] (-1412.574) (-1412.700) -- 0:00:17 729000 -- (-1414.534) [-1413.926] (-1416.291) (-1419.350) * (-1416.797) [-1413.931] (-1413.274) (-1413.469) -- 0:00:17 729500 -- [-1412.779] (-1415.288) (-1415.250) (-1414.530) * (-1416.644) (-1411.640) (-1415.373) [-1411.758] -- 0:00:17 730000 -- [-1414.881] (-1415.712) (-1413.052) (-1415.273) * [-1414.398] (-1413.519) (-1414.084) (-1414.444) -- 0:00:17 Average standard deviation of split frequencies: 0.009194 730500 -- (-1415.263) [-1416.207] (-1413.288) (-1412.537) * (-1413.693) (-1412.471) (-1414.681) [-1413.965] -- 0:00:16 731000 -- [-1412.520] (-1411.684) (-1415.780) (-1412.558) * (-1412.630) (-1411.755) [-1412.050] (-1411.677) -- 0:00:16 731500 -- (-1413.103) (-1416.589) [-1415.532] (-1412.458) * [-1411.491] (-1411.120) (-1414.460) (-1414.557) -- 0:00:16 732000 -- (-1417.062) [-1411.864] (-1416.269) (-1413.834) * (-1417.008) [-1411.656] (-1416.292) (-1416.733) -- 0:00:16 732500 -- (-1414.512) [-1413.215] (-1414.571) (-1412.265) * (-1414.942) [-1413.084] (-1416.003) (-1411.543) -- 0:00:16 733000 -- (-1412.003) [-1414.624] (-1412.094) (-1413.186) * (-1414.986) (-1413.231) (-1413.111) [-1412.727] -- 0:00:16 733500 -- [-1411.722] (-1413.256) (-1412.300) (-1412.010) * (-1416.532) (-1414.976) [-1412.486] (-1412.949) -- 0:00:16 734000 -- [-1412.063] (-1414.615) (-1412.101) (-1414.165) * [-1419.945] (-1413.061) (-1411.318) (-1413.401) -- 0:00:16 734500 -- (-1412.540) (-1415.764) [-1415.936] (-1413.412) * [-1411.931] (-1411.926) (-1413.548) (-1412.624) -- 0:00:16 735000 -- (-1413.315) (-1412.834) [-1415.077] (-1412.126) * [-1413.733] (-1412.284) (-1413.975) (-1413.804) -- 0:00:16 Average standard deviation of split frequencies: 0.009268 735500 -- (-1413.278) (-1414.048) (-1412.512) [-1411.914] * (-1412.485) (-1414.429) [-1413.930] (-1413.073) -- 0:00:16 736000 -- (-1412.861) [-1416.725] (-1413.218) (-1412.333) * [-1411.940] (-1413.176) (-1414.444) (-1412.240) -- 0:00:16 736500 -- (-1415.538) (-1417.219) [-1413.375] (-1412.083) * (-1411.683) (-1412.878) [-1418.024] (-1412.646) -- 0:00:16 737000 -- (-1413.861) (-1412.394) [-1412.944] (-1413.728) * (-1416.167) (-1412.518) (-1415.193) [-1411.439] -- 0:00:16 737500 -- (-1415.340) (-1412.130) (-1412.562) [-1410.962] * (-1412.533) [-1411.824] (-1411.855) (-1412.264) -- 0:00:16 738000 -- (-1416.613) (-1412.504) [-1411.064] (-1411.731) * (-1413.698) (-1411.462) [-1413.499] (-1412.232) -- 0:00:16 738500 -- (-1412.170) (-1413.884) [-1412.018] (-1412.866) * (-1416.695) (-1411.643) (-1413.990) [-1413.340] -- 0:00:16 739000 -- (-1414.888) [-1411.589] (-1411.535) (-1412.403) * (-1416.220) (-1414.739) [-1417.300] (-1414.678) -- 0:00:16 739500 -- (-1413.304) (-1411.939) [-1413.339] (-1413.064) * [-1417.043] (-1414.135) (-1416.037) (-1413.406) -- 0:00:16 740000 -- (-1411.927) (-1415.186) (-1411.864) [-1412.615] * [-1411.745] (-1413.707) (-1411.861) (-1411.454) -- 0:00:16 Average standard deviation of split frequencies: 0.009360 740500 -- (-1413.218) (-1412.010) [-1411.690] (-1412.389) * [-1414.170] (-1415.412) (-1414.613) (-1411.323) -- 0:00:16 741000 -- (-1419.517) (-1412.202) [-1413.896] (-1415.206) * (-1414.224) (-1412.780) (-1414.073) [-1412.292] -- 0:00:16 741500 -- (-1414.244) [-1413.742] (-1412.028) (-1413.363) * (-1412.021) (-1411.981) (-1416.038) [-1413.098] -- 0:00:16 742000 -- [-1415.079] (-1413.621) (-1411.429) (-1423.776) * (-1411.270) (-1414.424) (-1412.683) [-1412.873] -- 0:00:16 742500 -- (-1414.676) [-1414.903] (-1412.320) (-1412.772) * (-1411.255) (-1417.079) (-1416.815) [-1412.381] -- 0:00:16 743000 -- (-1414.296) [-1413.410] (-1413.399) (-1414.538) * (-1414.725) [-1414.118] (-1418.209) (-1413.081) -- 0:00:16 743500 -- [-1414.248] (-1414.876) (-1414.727) (-1417.778) * (-1418.802) (-1411.932) [-1417.033] (-1413.219) -- 0:00:16 744000 -- (-1412.013) [-1412.218] (-1411.658) (-1419.975) * (-1413.384) (-1411.444) (-1413.405) [-1415.603] -- 0:00:16 744500 -- (-1412.125) [-1411.761] (-1412.794) (-1417.999) * (-1413.188) (-1415.538) (-1412.988) [-1412.374] -- 0:00:16 745000 -- (-1415.414) (-1415.221) [-1413.249] (-1413.571) * (-1413.450) (-1413.325) (-1411.415) [-1412.908] -- 0:00:16 Average standard deviation of split frequencies: 0.009739 745500 -- (-1413.670) (-1412.336) [-1414.753] (-1413.455) * (-1413.465) (-1412.952) [-1412.127] (-1413.848) -- 0:00:16 746000 -- (-1412.622) [-1414.753] (-1413.994) (-1413.949) * (-1414.425) [-1411.630] (-1411.678) (-1414.585) -- 0:00:16 746500 -- (-1412.633) (-1414.631) [-1413.104] (-1412.502) * (-1413.761) [-1411.278] (-1412.389) (-1413.900) -- 0:00:15 747000 -- (-1414.969) (-1413.586) (-1414.028) [-1412.598] * [-1414.082] (-1412.184) (-1414.373) (-1413.506) -- 0:00:15 747500 -- (-1413.706) [-1413.827] (-1413.790) (-1413.056) * [-1415.610] (-1414.403) (-1413.477) (-1412.580) -- 0:00:15 748000 -- [-1414.045] (-1415.786) (-1412.992) (-1414.309) * (-1412.203) (-1412.284) [-1413.446] (-1413.947) -- 0:00:15 748500 -- (-1416.223) (-1420.342) (-1414.255) [-1413.278] * (-1416.517) (-1413.631) [-1412.139] (-1414.313) -- 0:00:15 749000 -- (-1411.870) [-1415.473] (-1416.451) (-1412.648) * [-1411.692] (-1412.728) (-1412.698) (-1413.180) -- 0:00:15 749500 -- (-1411.392) (-1416.774) (-1411.820) [-1413.465] * (-1416.408) (-1419.035) [-1414.128] (-1414.207) -- 0:00:15 750000 -- (-1413.101) [-1414.718] (-1414.425) (-1412.631) * (-1412.973) (-1413.171) [-1414.713] (-1413.555) -- 0:00:15 Average standard deviation of split frequencies: 0.009302 750500 -- (-1412.483) (-1414.450) (-1412.701) [-1411.344] * [-1411.784] (-1413.065) (-1413.340) (-1412.860) -- 0:00:15 751000 -- [-1411.088] (-1417.615) (-1412.192) (-1412.233) * [-1413.939] (-1412.591) (-1415.176) (-1412.201) -- 0:00:15 751500 -- [-1412.393] (-1415.095) (-1412.881) (-1411.995) * (-1412.089) (-1413.250) [-1411.524] (-1413.376) -- 0:00:15 752000 -- (-1414.173) (-1414.016) [-1412.039] (-1413.394) * (-1414.166) (-1412.438) [-1411.653] (-1416.806) -- 0:00:15 752500 -- (-1412.638) (-1412.459) (-1411.933) [-1411.348] * [-1413.760] (-1412.047) (-1415.889) (-1414.048) -- 0:00:15 753000 -- (-1411.576) (-1412.555) [-1415.263] (-1412.162) * (-1413.828) (-1415.683) (-1411.737) [-1411.418] -- 0:00:15 753500 -- (-1413.832) [-1412.590] (-1419.687) (-1412.056) * (-1418.619) (-1416.680) [-1412.081] (-1411.860) -- 0:00:15 754000 -- (-1411.773) (-1414.461) (-1416.699) [-1413.327] * (-1414.849) (-1414.487) (-1412.079) [-1413.239] -- 0:00:15 754500 -- [-1412.243] (-1414.008) (-1412.291) (-1412.446) * (-1416.465) [-1412.085] (-1417.522) (-1413.153) -- 0:00:15 755000 -- (-1411.734) (-1413.853) (-1413.257) [-1412.256] * (-1411.740) [-1411.768] (-1417.607) (-1413.949) -- 0:00:15 Average standard deviation of split frequencies: 0.009236 755500 -- (-1420.225) (-1413.533) [-1411.544] (-1414.530) * (-1411.786) (-1411.222) [-1412.540] (-1418.740) -- 0:00:15 756000 -- [-1413.614] (-1414.670) (-1412.765) (-1416.394) * (-1412.621) (-1411.098) [-1415.991] (-1416.460) -- 0:00:15 756500 -- (-1412.780) [-1415.592] (-1416.135) (-1413.905) * (-1412.396) (-1413.788) [-1412.863] (-1411.806) -- 0:00:15 757000 -- (-1411.598) (-1416.853) [-1413.885] (-1413.999) * [-1415.150] (-1412.405) (-1413.121) (-1412.910) -- 0:00:15 757500 -- [-1412.517] (-1416.685) (-1415.235) (-1413.988) * [-1416.204] (-1412.572) (-1413.222) (-1420.273) -- 0:00:15 758000 -- (-1413.017) [-1414.696] (-1415.490) (-1419.076) * (-1416.755) (-1411.807) (-1411.630) [-1413.707] -- 0:00:15 758500 -- [-1412.303] (-1415.301) (-1415.170) (-1414.138) * (-1414.325) [-1415.611] (-1413.579) (-1413.721) -- 0:00:15 759000 -- (-1411.683) (-1413.525) (-1412.619) [-1412.568] * [-1413.448] (-1412.862) (-1413.385) (-1413.430) -- 0:00:15 759500 -- [-1412.975] (-1413.780) (-1414.177) (-1413.395) * (-1412.878) (-1413.602) (-1413.967) [-1416.359] -- 0:00:15 760000 -- (-1412.642) (-1413.275) [-1412.435] (-1414.546) * (-1416.246) [-1414.275] (-1415.344) (-1415.085) -- 0:00:15 Average standard deviation of split frequencies: 0.009180 760500 -- [-1412.204] (-1414.843) (-1413.337) (-1411.855) * (-1415.488) [-1413.064] (-1422.787) (-1414.291) -- 0:00:15 761000 -- (-1413.033) [-1411.859] (-1412.978) (-1413.433) * (-1418.294) [-1412.981] (-1412.971) (-1417.353) -- 0:00:15 761500 -- (-1413.073) [-1413.730] (-1414.268) (-1414.315) * (-1413.423) (-1416.936) (-1416.498) [-1415.288] -- 0:00:15 762000 -- (-1414.881) [-1411.775] (-1411.979) (-1416.559) * (-1412.275) (-1418.182) [-1412.651] (-1411.660) -- 0:00:14 762500 -- [-1412.768] (-1414.139) (-1414.864) (-1413.074) * (-1413.418) (-1414.243) (-1415.553) [-1414.207] -- 0:00:14 763000 -- (-1413.173) [-1415.758] (-1416.150) (-1411.595) * (-1412.174) (-1413.196) (-1413.668) [-1414.728] -- 0:00:14 763500 -- [-1413.267] (-1414.363) (-1412.888) (-1414.795) * [-1413.153] (-1411.386) (-1414.345) (-1413.931) -- 0:00:14 764000 -- (-1412.595) (-1419.135) [-1412.907] (-1412.921) * [-1417.665] (-1411.590) (-1412.284) (-1413.602) -- 0:00:14 764500 -- (-1412.120) [-1412.421] (-1411.634) (-1412.840) * (-1413.488) (-1411.967) (-1412.260) [-1412.348] -- 0:00:14 765000 -- (-1415.824) [-1412.301] (-1411.996) (-1415.679) * (-1411.982) (-1414.056) (-1412.955) [-1414.696] -- 0:00:14 Average standard deviation of split frequencies: 0.009539 765500 -- (-1413.777) (-1411.563) [-1417.011] (-1412.048) * (-1413.664) [-1412.507] (-1413.577) (-1413.401) -- 0:00:14 766000 -- (-1414.069) (-1412.459) (-1415.996) [-1413.533] * (-1416.370) [-1414.136] (-1412.481) (-1418.710) -- 0:00:14 766500 -- (-1412.741) (-1411.797) [-1413.245] (-1412.999) * (-1413.127) (-1415.190) (-1412.098) [-1415.343] -- 0:00:14 767000 -- (-1417.902) [-1411.855] (-1415.030) (-1411.841) * [-1413.182] (-1411.914) (-1411.488) (-1411.122) -- 0:00:14 767500 -- (-1413.160) (-1414.863) [-1413.591] (-1412.086) * [-1411.853] (-1413.786) (-1411.425) (-1411.597) -- 0:00:14 768000 -- (-1413.302) [-1411.894] (-1412.623) (-1412.783) * (-1418.745) [-1412.262] (-1411.613) (-1413.003) -- 0:00:14 768500 -- (-1413.541) [-1413.395] (-1412.342) (-1414.215) * (-1417.149) [-1411.356] (-1412.643) (-1414.129) -- 0:00:14 769000 -- [-1412.535] (-1413.726) (-1411.851) (-1412.926) * (-1415.135) [-1411.191] (-1412.168) (-1412.543) -- 0:00:14 769500 -- (-1413.245) (-1413.289) (-1413.647) [-1413.092] * (-1412.573) (-1416.993) [-1412.374] (-1413.363) -- 0:00:14 770000 -- (-1413.111) (-1413.459) (-1413.085) [-1412.098] * (-1414.206) (-1413.132) (-1411.369) [-1415.181] -- 0:00:14 Average standard deviation of split frequencies: 0.009749 770500 -- (-1413.709) (-1412.450) [-1412.256] (-1413.679) * (-1417.559) (-1413.161) (-1413.273) [-1411.364] -- 0:00:14 771000 -- (-1411.822) (-1413.858) (-1414.460) [-1412.712] * (-1415.141) [-1412.966] (-1413.899) (-1414.892) -- 0:00:14 771500 -- (-1411.825) (-1412.144) (-1416.426) [-1411.684] * (-1414.614) (-1414.554) [-1413.153] (-1414.279) -- 0:00:14 772000 -- (-1412.322) (-1413.694) [-1412.803] (-1411.711) * (-1411.911) [-1413.845] (-1411.786) (-1415.195) -- 0:00:14 772500 -- (-1411.668) (-1413.423) (-1412.013) [-1413.256] * (-1412.900) (-1412.874) (-1414.882) [-1412.932] -- 0:00:14 773000 -- [-1412.905] (-1413.418) (-1412.104) (-1413.379) * (-1411.966) (-1412.651) (-1412.579) [-1413.285] -- 0:00:14 773500 -- (-1413.185) [-1414.371] (-1412.014) (-1419.376) * (-1416.711) [-1411.011] (-1412.853) (-1413.603) -- 0:00:14 774000 -- (-1413.518) [-1413.463] (-1412.195) (-1411.338) * (-1412.482) [-1412.055] (-1417.458) (-1416.819) -- 0:00:14 774500 -- [-1414.574] (-1414.128) (-1412.490) (-1412.524) * [-1414.820] (-1412.057) (-1413.203) (-1412.850) -- 0:00:14 775000 -- (-1413.494) (-1413.705) (-1413.684) [-1413.721] * (-1414.149) (-1414.504) [-1413.942] (-1415.145) -- 0:00:14 Average standard deviation of split frequencies: 0.010213 775500 -- (-1413.607) (-1414.206) [-1414.302] (-1414.103) * [-1412.251] (-1412.733) (-1414.107) (-1413.103) -- 0:00:14 776000 -- (-1412.783) (-1412.962) [-1414.886] (-1416.519) * [-1412.756] (-1414.672) (-1413.383) (-1417.886) -- 0:00:14 776500 -- (-1412.030) (-1414.155) [-1413.716] (-1416.341) * (-1414.481) (-1413.354) [-1412.830] (-1411.665) -- 0:00:14 777000 -- [-1411.594] (-1414.610) (-1413.586) (-1412.203) * (-1415.016) [-1418.106] (-1414.831) (-1415.306) -- 0:00:14 777500 -- (-1415.050) [-1413.346] (-1412.529) (-1413.397) * (-1413.204) (-1413.326) [-1415.099] (-1413.874) -- 0:00:14 778000 -- (-1412.523) [-1414.323] (-1412.134) (-1414.671) * (-1411.097) [-1411.902] (-1412.929) (-1413.010) -- 0:00:13 778500 -- (-1412.139) (-1413.937) (-1414.109) [-1410.980] * (-1411.046) [-1412.507] (-1413.122) (-1414.246) -- 0:00:13 779000 -- (-1411.569) [-1411.446] (-1416.103) (-1410.982) * (-1411.532) [-1413.454] (-1411.991) (-1417.194) -- 0:00:13 779500 -- (-1412.337) (-1414.581) [-1413.566] (-1411.714) * (-1413.136) [-1415.532] (-1412.029) (-1417.959) -- 0:00:13 780000 -- [-1412.070] (-1413.557) (-1413.101) (-1413.370) * (-1413.600) [-1414.200] (-1412.816) (-1412.718) -- 0:00:13 Average standard deviation of split frequencies: 0.010507 780500 -- (-1411.589) (-1414.282) [-1414.720] (-1412.468) * (-1412.625) (-1413.788) (-1414.044) [-1419.688] -- 0:00:13 781000 -- (-1411.810) [-1415.001] (-1415.424) (-1412.572) * [-1411.675] (-1412.011) (-1414.899) (-1416.126) -- 0:00:13 781500 -- (-1414.668) [-1411.931] (-1414.506) (-1414.206) * (-1411.278) [-1412.137] (-1412.217) (-1414.183) -- 0:00:13 782000 -- (-1411.634) (-1411.793) [-1413.957] (-1414.129) * (-1411.861) (-1414.718) (-1412.156) [-1415.471] -- 0:00:13 782500 -- (-1414.047) (-1411.854) [-1413.201] (-1416.165) * (-1415.924) [-1412.605] (-1416.466) (-1414.475) -- 0:00:13 783000 -- [-1413.438] (-1413.405) (-1418.792) (-1413.294) * (-1415.067) (-1411.928) [-1415.145] (-1413.309) -- 0:00:13 783500 -- (-1411.939) (-1413.903) (-1415.505) [-1414.160] * [-1413.145] (-1411.172) (-1412.373) (-1413.602) -- 0:00:13 784000 -- [-1412.120] (-1412.960) (-1415.643) (-1413.492) * [-1413.797] (-1411.247) (-1412.471) (-1411.858) -- 0:00:13 784500 -- (-1411.636) [-1412.336] (-1420.356) (-1413.048) * (-1411.436) [-1412.346] (-1412.383) (-1411.749) -- 0:00:13 785000 -- (-1411.291) (-1415.011) [-1412.384] (-1413.149) * [-1411.425] (-1415.708) (-1413.615) (-1413.140) -- 0:00:13 Average standard deviation of split frequencies: 0.010046 785500 -- (-1411.899) (-1415.988) [-1411.555] (-1411.259) * (-1412.309) (-1413.307) (-1412.902) [-1413.064] -- 0:00:13 786000 -- (-1411.881) (-1419.774) [-1411.508] (-1411.270) * (-1411.380) (-1415.094) (-1411.469) [-1413.832] -- 0:00:13 786500 -- (-1415.098) (-1416.760) [-1412.520] (-1413.288) * (-1411.349) (-1413.242) (-1411.176) [-1412.792] -- 0:00:13 787000 -- (-1413.538) (-1412.162) (-1411.317) [-1412.820] * [-1412.757] (-1413.774) (-1413.150) (-1412.578) -- 0:00:13 787500 -- (-1413.776) [-1413.941] (-1420.518) (-1412.185) * (-1413.835) (-1412.828) (-1413.296) [-1412.890] -- 0:00:13 788000 -- [-1414.903] (-1413.460) (-1419.191) (-1412.575) * (-1412.463) [-1412.685] (-1415.209) (-1415.051) -- 0:00:13 788500 -- [-1416.812] (-1413.388) (-1413.215) (-1415.548) * (-1411.722) (-1413.343) [-1412.478] (-1415.921) -- 0:00:13 789000 -- [-1418.443] (-1416.456) (-1412.835) (-1419.601) * (-1412.861) (-1414.991) (-1412.466) [-1412.006] -- 0:00:13 789500 -- (-1413.655) (-1415.036) [-1414.237] (-1414.983) * [-1413.963] (-1416.874) (-1412.918) (-1413.458) -- 0:00:13 790000 -- (-1415.117) (-1413.458) [-1412.259] (-1415.114) * (-1414.388) (-1414.981) (-1411.591) [-1415.258] -- 0:00:13 Average standard deviation of split frequencies: 0.009987 790500 -- (-1415.296) [-1412.699] (-1411.871) (-1414.103) * (-1414.383) (-1414.948) (-1413.071) [-1412.770] -- 0:00:13 791000 -- (-1415.296) (-1412.037) (-1411.323) [-1412.807] * [-1412.543] (-1414.574) (-1413.990) (-1412.641) -- 0:00:13 791500 -- (-1417.306) (-1413.395) (-1411.474) [-1414.863] * (-1415.312) [-1414.063] (-1414.115) (-1411.897) -- 0:00:13 792000 -- (-1415.328) (-1411.677) (-1414.319) [-1413.438] * (-1419.165) (-1413.510) (-1416.792) [-1412.824] -- 0:00:13 792500 -- (-1413.241) (-1412.113) [-1412.341] (-1411.952) * (-1419.182) (-1414.689) (-1415.807) [-1411.720] -- 0:00:13 793000 -- [-1414.920] (-1412.991) (-1413.074) (-1412.823) * [-1414.118] (-1414.689) (-1415.219) (-1411.375) -- 0:00:13 793500 -- [-1412.202] (-1411.509) (-1414.364) (-1412.928) * (-1411.563) (-1412.180) (-1413.667) [-1412.302] -- 0:00:13 794000 -- [-1411.682] (-1412.105) (-1414.860) (-1411.268) * (-1415.563) (-1412.825) (-1418.237) [-1414.036] -- 0:00:12 794500 -- (-1412.091) (-1412.371) (-1416.258) [-1412.195] * (-1416.422) (-1414.333) [-1414.687] (-1412.668) -- 0:00:12 795000 -- (-1413.511) (-1415.168) [-1414.366] (-1413.395) * (-1417.223) (-1411.886) (-1416.222) [-1411.964] -- 0:00:12 Average standard deviation of split frequencies: 0.009994 795500 -- (-1413.378) (-1412.711) (-1413.357) [-1412.858] * (-1414.682) (-1413.232) [-1415.847] (-1412.305) -- 0:00:12 796000 -- (-1415.765) (-1412.185) (-1414.532) [-1412.047] * (-1413.704) (-1415.278) (-1414.915) [-1411.791] -- 0:00:12 796500 -- (-1416.779) (-1411.723) (-1413.024) [-1411.651] * (-1412.413) (-1416.300) (-1412.661) [-1412.337] -- 0:00:12 797000 -- (-1414.514) (-1412.447) (-1411.534) [-1411.288] * (-1412.195) (-1413.142) (-1411.769) [-1412.927] -- 0:00:12 797500 -- (-1411.727) (-1411.921) (-1412.734) [-1411.289] * (-1412.183) [-1412.687] (-1412.617) (-1412.709) -- 0:00:12 798000 -- [-1412.949] (-1414.249) (-1414.610) (-1411.982) * (-1411.735) (-1411.825) [-1414.543] (-1412.797) -- 0:00:12 798500 -- (-1412.967) (-1415.567) (-1415.405) [-1413.695] * (-1411.583) (-1412.741) (-1411.946) [-1413.410] -- 0:00:12 799000 -- (-1413.258) (-1413.673) [-1411.428] (-1412.498) * (-1412.690) (-1412.626) [-1412.043] (-1414.187) -- 0:00:12 799500 -- (-1414.177) (-1416.641) [-1411.428] (-1415.243) * [-1412.269] (-1413.867) (-1411.986) (-1414.061) -- 0:00:12 800000 -- (-1411.293) [-1412.612] (-1415.160) (-1416.950) * (-1414.368) (-1413.106) (-1411.912) [-1414.855] -- 0:00:12 Average standard deviation of split frequencies: 0.010303 800500 -- (-1412.385) [-1417.231] (-1417.188) (-1413.355) * (-1412.382) [-1412.208] (-1412.156) (-1411.995) -- 0:00:12 801000 -- (-1412.256) [-1411.653] (-1416.826) (-1413.709) * (-1412.663) (-1412.134) [-1412.636] (-1413.594) -- 0:00:12 801500 -- [-1412.706] (-1414.243) (-1417.779) (-1412.881) * (-1413.028) [-1411.910] (-1414.985) (-1412.068) -- 0:00:12 802000 -- [-1411.832] (-1412.610) (-1414.016) (-1413.982) * (-1411.667) [-1411.922] (-1414.637) (-1411.833) -- 0:00:12 802500 -- (-1411.985) (-1411.804) (-1412.964) [-1414.133] * [-1411.827] (-1415.744) (-1415.223) (-1413.914) -- 0:00:12 803000 -- (-1414.864) (-1411.301) (-1415.820) [-1413.631] * (-1420.819) [-1413.867] (-1414.220) (-1413.445) -- 0:00:12 803500 -- [-1411.795] (-1413.966) (-1417.915) (-1413.632) * (-1417.578) (-1411.713) (-1413.400) [-1412.997] -- 0:00:12 804000 -- (-1412.418) [-1414.988] (-1413.773) (-1415.211) * [-1412.026] (-1413.758) (-1412.272) (-1413.755) -- 0:00:12 804500 -- (-1412.805) [-1413.108] (-1412.559) (-1414.110) * (-1411.329) (-1413.919) [-1412.346] (-1412.982) -- 0:00:12 805000 -- (-1413.156) (-1420.191) (-1413.094) [-1412.400] * [-1412.967] (-1413.402) (-1415.086) (-1416.489) -- 0:00:12 Average standard deviation of split frequencies: 0.010016 805500 -- (-1413.453) (-1414.427) (-1412.401) [-1416.291] * (-1412.522) [-1411.741] (-1414.984) (-1413.155) -- 0:00:12 806000 -- (-1415.517) [-1418.024] (-1413.887) (-1414.996) * (-1415.659) (-1411.504) (-1414.481) [-1412.854] -- 0:00:12 806500 -- [-1414.216] (-1415.003) (-1411.679) (-1419.719) * [-1416.059] (-1414.010) (-1411.224) (-1412.417) -- 0:00:12 807000 -- [-1413.991] (-1414.861) (-1412.027) (-1414.699) * (-1413.381) (-1412.067) (-1411.296) [-1412.548] -- 0:00:12 807500 -- (-1413.998) [-1413.713] (-1413.177) (-1414.654) * (-1413.952) (-1414.239) (-1412.475) [-1411.487] -- 0:00:12 808000 -- (-1412.494) [-1415.339] (-1415.098) (-1413.362) * (-1411.514) [-1413.040] (-1411.894) (-1415.926) -- 0:00:12 808500 -- (-1412.456) (-1412.849) (-1417.423) [-1415.268] * (-1411.646) [-1414.686] (-1413.431) (-1414.192) -- 0:00:12 809000 -- [-1413.603] (-1411.786) (-1412.237) (-1416.267) * (-1411.302) (-1417.285) (-1414.661) [-1413.808] -- 0:00:12 809500 -- [-1411.408] (-1411.630) (-1412.509) (-1413.266) * (-1412.252) [-1411.337] (-1411.664) (-1420.369) -- 0:00:12 810000 -- (-1413.646) [-1412.274] (-1411.659) (-1411.720) * [-1411.724] (-1411.772) (-1414.866) (-1414.715) -- 0:00:11 Average standard deviation of split frequencies: 0.010249 810500 -- (-1413.203) (-1413.793) [-1411.541] (-1412.313) * (-1416.776) [-1414.860] (-1412.421) (-1413.239) -- 0:00:11 811000 -- [-1413.503] (-1413.084) (-1411.541) (-1411.882) * (-1411.997) (-1414.979) [-1411.902] (-1412.686) -- 0:00:11 811500 -- (-1417.241) (-1411.985) [-1411.420] (-1412.386) * [-1414.786] (-1411.516) (-1417.829) (-1413.781) -- 0:00:11 812000 -- (-1414.577) (-1413.977) [-1413.144] (-1412.287) * (-1416.685) (-1414.391) (-1413.797) [-1412.569] -- 0:00:11 812500 -- (-1413.110) (-1412.884) [-1413.238] (-1414.428) * [-1414.143] (-1414.231) (-1419.469) (-1415.837) -- 0:00:11 813000 -- (-1412.532) [-1413.907] (-1416.277) (-1413.676) * (-1412.673) [-1414.419] (-1414.441) (-1415.981) -- 0:00:11 813500 -- (-1412.037) (-1415.191) (-1417.283) [-1413.476] * (-1415.834) (-1413.302) (-1415.520) [-1411.975] -- 0:00:11 814000 -- [-1414.128] (-1411.080) (-1416.826) (-1412.838) * [-1411.412] (-1415.839) (-1413.244) (-1412.823) -- 0:00:11 814500 -- (-1413.790) (-1411.670) (-1413.729) [-1413.697] * (-1414.566) (-1413.382) (-1414.316) [-1412.283] -- 0:00:11 815000 -- (-1415.021) (-1414.839) (-1414.378) [-1412.284] * (-1414.460) (-1415.779) (-1412.836) [-1411.994] -- 0:00:11 Average standard deviation of split frequencies: 0.010704 815500 -- (-1416.334) [-1414.270] (-1415.637) (-1417.330) * [-1412.801] (-1413.684) (-1415.712) (-1415.408) -- 0:00:11 816000 -- (-1415.820) (-1415.016) (-1413.504) [-1413.837] * [-1412.755] (-1414.660) (-1411.768) (-1412.086) -- 0:00:11 816500 -- (-1412.857) (-1416.772) [-1411.474] (-1411.493) * (-1415.043) [-1415.499] (-1415.404) (-1415.051) -- 0:00:11 817000 -- (-1415.485) (-1418.575) [-1413.629] (-1411.428) * [-1413.199] (-1412.739) (-1412.740) (-1412.876) -- 0:00:11 817500 -- (-1415.318) (-1415.110) [-1414.994] (-1411.582) * (-1414.294) [-1413.734] (-1414.106) (-1413.470) -- 0:00:11 818000 -- (-1417.481) (-1413.522) [-1414.296] (-1411.522) * (-1417.213) (-1414.500) [-1412.623] (-1414.952) -- 0:00:11 818500 -- (-1411.764) [-1411.585] (-1413.638) (-1416.569) * (-1413.052) (-1414.620) (-1412.768) [-1413.326] -- 0:00:11 819000 -- [-1415.514] (-1411.834) (-1410.993) (-1412.332) * [-1413.005] (-1414.705) (-1415.799) (-1412.417) -- 0:00:11 819500 -- (-1417.045) (-1414.112) (-1411.231) [-1416.612] * [-1413.232] (-1415.205) (-1411.338) (-1412.535) -- 0:00:11 820000 -- (-1411.323) (-1412.581) [-1412.049] (-1415.231) * (-1413.473) (-1416.730) (-1411.544) [-1414.866] -- 0:00:11 Average standard deviation of split frequencies: 0.011455 820500 -- (-1413.232) (-1412.049) (-1413.227) [-1413.574] * (-1413.073) [-1413.819] (-1413.272) (-1414.480) -- 0:00:11 821000 -- [-1413.537] (-1412.005) (-1412.279) (-1416.844) * (-1414.344) (-1411.268) (-1413.752) [-1412.422] -- 0:00:11 821500 -- [-1412.847] (-1416.528) (-1411.532) (-1413.265) * [-1413.878] (-1411.867) (-1415.232) (-1411.764) -- 0:00:11 822000 -- (-1412.739) (-1412.771) [-1413.595] (-1414.938) * (-1411.307) (-1414.467) [-1413.023] (-1415.749) -- 0:00:11 822500 -- (-1411.987) (-1414.205) (-1416.002) [-1414.287] * [-1412.501] (-1415.422) (-1411.911) (-1412.732) -- 0:00:11 823000 -- [-1412.963] (-1412.849) (-1411.593) (-1412.286) * (-1413.033) (-1418.380) [-1414.499] (-1413.127) -- 0:00:11 823500 -- [-1415.983] (-1413.310) (-1414.143) (-1414.779) * (-1415.455) (-1413.916) (-1413.317) [-1412.068] -- 0:00:11 824000 -- (-1411.927) (-1412.058) [-1412.522] (-1415.009) * (-1414.686) [-1414.080] (-1413.327) (-1414.498) -- 0:00:11 824500 -- [-1414.353] (-1413.248) (-1412.800) (-1416.266) * (-1412.912) (-1416.805) (-1412.747) [-1414.468] -- 0:00:11 825000 -- (-1415.738) (-1417.614) (-1414.160) [-1414.810] * (-1412.808) (-1413.656) (-1413.618) [-1413.913] -- 0:00:11 Average standard deviation of split frequencies: 0.011347 825500 -- (-1412.963) (-1412.913) [-1411.755] (-1416.113) * (-1412.727) (-1413.074) (-1413.995) [-1413.778] -- 0:00:10 826000 -- (-1413.730) (-1414.971) [-1413.059] (-1414.557) * (-1415.359) (-1414.257) (-1414.734) [-1412.660] -- 0:00:10 826500 -- (-1413.749) (-1415.804) (-1416.840) [-1412.922] * (-1417.128) [-1414.939] (-1413.884) (-1418.318) -- 0:00:10 827000 -- (-1413.731) (-1414.815) [-1411.767] (-1412.547) * (-1414.270) (-1414.002) (-1416.432) [-1414.316] -- 0:00:10 827500 -- (-1412.167) (-1415.191) (-1412.866) [-1414.243] * [-1414.914] (-1412.677) (-1413.051) (-1416.924) -- 0:00:10 828000 -- [-1411.595] (-1412.536) (-1412.688) (-1415.028) * (-1412.993) [-1419.141] (-1413.395) (-1417.457) -- 0:00:10 828500 -- (-1411.485) (-1413.821) [-1412.499] (-1414.783) * [-1416.298] (-1416.325) (-1412.649) (-1413.967) -- 0:00:10 829000 -- (-1412.102) (-1411.933) [-1412.535] (-1414.897) * (-1416.869) (-1417.410) (-1413.894) [-1411.779] -- 0:00:10 829500 -- (-1411.910) (-1416.768) [-1413.186] (-1416.314) * [-1414.983] (-1416.784) (-1413.442) (-1414.197) -- 0:00:10 830000 -- (-1413.678) (-1417.373) (-1411.467) [-1412.182] * [-1411.631] (-1420.211) (-1417.482) (-1415.484) -- 0:00:10 Average standard deviation of split frequencies: 0.011016 830500 -- (-1413.931) (-1411.840) (-1411.400) [-1412.587] * (-1411.529) (-1415.268) (-1411.883) [-1414.137] -- 0:00:10 831000 -- (-1412.677) [-1412.955] (-1411.669) (-1414.520) * (-1413.564) (-1414.708) [-1412.802] (-1413.962) -- 0:00:10 831500 -- (-1413.299) (-1411.713) (-1412.695) [-1412.352] * (-1413.978) (-1416.160) (-1415.341) [-1415.158] -- 0:00:10 832000 -- [-1414.299] (-1411.924) (-1414.062) (-1413.996) * (-1416.504) (-1411.479) (-1417.736) [-1417.083] -- 0:00:10 832500 -- (-1413.749) (-1417.328) (-1415.180) [-1413.218] * [-1417.587] (-1412.182) (-1415.569) (-1415.525) -- 0:00:10 833000 -- [-1412.772] (-1416.301) (-1415.270) (-1417.621) * (-1411.651) (-1414.955) (-1413.135) [-1414.992] -- 0:00:10 833500 -- [-1411.681] (-1421.158) (-1417.365) (-1412.140) * (-1414.097) [-1413.307] (-1414.377) (-1419.021) -- 0:00:10 834000 -- [-1411.754] (-1418.875) (-1416.606) (-1412.552) * [-1415.993] (-1413.869) (-1412.997) (-1417.459) -- 0:00:10 834500 -- (-1411.805) (-1417.682) [-1413.988] (-1412.730) * (-1413.369) [-1412.876] (-1413.120) (-1411.786) -- 0:00:10 835000 -- [-1412.273] (-1412.363) (-1413.709) (-1412.369) * (-1415.516) [-1414.961] (-1413.611) (-1414.063) -- 0:00:10 Average standard deviation of split frequencies: 0.011079 835500 -- (-1416.966) (-1411.694) (-1414.582) [-1413.555] * [-1414.002] (-1413.550) (-1413.320) (-1412.024) -- 0:00:10 836000 -- (-1415.536) [-1414.642] (-1411.925) (-1412.378) * (-1414.557) (-1420.572) [-1414.879] (-1412.024) -- 0:00:10 836500 -- [-1413.516] (-1412.104) (-1413.535) (-1413.637) * (-1413.260) [-1413.178] (-1415.600) (-1412.464) -- 0:00:10 837000 -- (-1414.208) [-1412.717] (-1413.358) (-1414.514) * (-1412.911) (-1414.155) (-1414.878) [-1413.118] -- 0:00:10 837500 -- (-1414.452) (-1417.056) [-1414.020] (-1411.537) * (-1417.830) [-1414.721] (-1413.488) (-1414.040) -- 0:00:10 838000 -- (-1414.185) (-1414.415) (-1413.788) [-1411.235] * (-1419.702) [-1415.042] (-1412.430) (-1414.057) -- 0:00:10 838500 -- [-1412.118] (-1414.315) (-1411.740) (-1412.903) * (-1414.897) (-1414.809) [-1414.394] (-1412.065) -- 0:00:10 839000 -- (-1417.288) (-1414.646) [-1413.752] (-1413.645) * [-1413.427] (-1417.142) (-1417.745) (-1412.569) -- 0:00:10 839500 -- (-1414.824) (-1413.885) (-1413.946) [-1414.660] * [-1413.394] (-1414.191) (-1413.235) (-1412.689) -- 0:00:10 840000 -- (-1413.394) (-1412.775) [-1411.431] (-1414.548) * (-1411.395) [-1412.577] (-1414.561) (-1412.658) -- 0:00:10 Average standard deviation of split frequencies: 0.011215 840500 -- (-1414.060) (-1412.578) [-1413.312] (-1412.485) * (-1412.419) (-1411.953) (-1415.898) [-1411.393] -- 0:00:10 841000 -- (-1412.702) (-1415.710) [-1412.475] (-1411.384) * (-1413.717) (-1413.912) (-1417.796) [-1414.462] -- 0:00:10 841500 -- (-1414.898) (-1418.408) [-1411.521] (-1411.804) * (-1412.381) (-1411.324) [-1414.387] (-1412.977) -- 0:00:09 842000 -- [-1412.574] (-1416.514) (-1413.949) (-1414.143) * (-1415.435) [-1412.801] (-1412.807) (-1415.066) -- 0:00:09 842500 -- (-1411.842) [-1411.624] (-1418.086) (-1416.552) * (-1416.014) (-1413.210) [-1415.488] (-1414.254) -- 0:00:09 843000 -- (-1413.539) (-1412.655) [-1416.194] (-1413.273) * [-1413.205] (-1415.817) (-1412.468) (-1414.112) -- 0:00:09 843500 -- (-1415.686) (-1412.622) (-1413.265) [-1412.621] * (-1412.796) [-1413.981] (-1413.353) (-1413.058) -- 0:00:09 844000 -- (-1417.179) [-1412.709] (-1414.160) (-1415.389) * (-1412.179) (-1412.126) (-1411.787) [-1411.644] -- 0:00:09 844500 -- (-1418.510) (-1412.224) (-1414.163) [-1412.349] * [-1411.924] (-1414.904) (-1415.605) (-1414.837) -- 0:00:09 845000 -- (-1417.406) (-1411.528) (-1417.052) [-1411.826] * (-1412.169) (-1415.632) [-1413.702] (-1412.258) -- 0:00:09 Average standard deviation of split frequencies: 0.011275 845500 -- (-1413.249) (-1414.350) [-1414.266] (-1412.169) * [-1414.677] (-1419.763) (-1414.430) (-1412.689) -- 0:00:09 846000 -- (-1413.265) (-1413.397) [-1414.177] (-1412.149) * (-1412.475) [-1412.206] (-1413.122) (-1411.501) -- 0:00:09 846500 -- [-1413.478] (-1413.728) (-1412.589) (-1413.690) * [-1413.491] (-1414.640) (-1414.504) (-1411.860) -- 0:00:09 847000 -- (-1413.524) (-1412.253) [-1412.653] (-1412.857) * (-1414.230) [-1415.509] (-1414.495) (-1413.415) -- 0:00:09 847500 -- (-1412.847) (-1413.113) (-1412.797) [-1411.978] * (-1411.960) [-1414.312] (-1414.567) (-1415.602) -- 0:00:09 848000 -- (-1419.197) (-1417.505) [-1413.786] (-1412.941) * [-1411.960] (-1415.289) (-1413.327) (-1414.985) -- 0:00:09 848500 -- (-1417.706) [-1414.718] (-1412.121) (-1415.595) * (-1411.274) (-1414.162) [-1412.143] (-1414.479) -- 0:00:09 849000 -- (-1413.556) (-1415.549) (-1412.772) [-1413.091] * [-1413.633] (-1412.374) (-1419.277) (-1412.084) -- 0:00:09 849500 -- [-1413.027] (-1412.867) (-1412.423) (-1414.015) * (-1411.373) (-1416.020) [-1415.032] (-1413.109) -- 0:00:09 850000 -- (-1414.941) (-1412.688) [-1412.553] (-1413.795) * (-1412.716) (-1412.101) (-1412.715) [-1414.613] -- 0:00:09 Average standard deviation of split frequencies: 0.010692 850500 -- (-1411.974) (-1414.494) [-1415.592] (-1419.406) * (-1412.030) (-1412.135) [-1413.273] (-1414.215) -- 0:00:09 851000 -- (-1418.056) (-1414.803) (-1416.920) [-1413.261] * [-1411.852] (-1413.765) (-1415.362) (-1412.239) -- 0:00:09 851500 -- (-1414.482) (-1412.098) (-1416.358) [-1415.875] * (-1412.025) (-1418.496) (-1420.509) [-1412.270] -- 0:00:09 852000 -- [-1413.710] (-1412.382) (-1415.281) (-1412.410) * [-1413.134] (-1416.833) (-1414.050) (-1413.737) -- 0:00:09 852500 -- (-1414.193) (-1412.615) [-1412.751] (-1414.416) * [-1412.402] (-1419.560) (-1414.513) (-1415.416) -- 0:00:09 853000 -- [-1412.702] (-1413.371) (-1413.279) (-1416.597) * (-1414.103) (-1424.222) (-1413.009) [-1412.709] -- 0:00:09 853500 -- (-1412.579) (-1414.616) [-1413.594] (-1413.201) * (-1412.136) [-1414.346] (-1413.188) (-1413.075) -- 0:00:09 854000 -- [-1412.051] (-1415.552) (-1412.223) (-1415.420) * (-1414.254) [-1415.871] (-1411.914) (-1412.182) -- 0:00:09 854500 -- (-1412.827) (-1417.155) [-1411.490] (-1413.195) * [-1413.624] (-1413.782) (-1412.651) (-1412.248) -- 0:00:09 855000 -- [-1412.771] (-1415.382) (-1419.554) (-1414.031) * [-1412.717] (-1411.952) (-1413.739) (-1413.685) -- 0:00:09 Average standard deviation of split frequencies: 0.010690 855500 -- [-1416.582] (-1415.994) (-1411.665) (-1413.733) * [-1413.548] (-1415.684) (-1412.391) (-1413.344) -- 0:00:09 856000 -- (-1412.685) (-1413.615) [-1413.234] (-1413.709) * (-1414.410) [-1411.965] (-1412.726) (-1412.345) -- 0:00:09 856500 -- (-1413.884) [-1414.566] (-1412.767) (-1413.903) * [-1414.603] (-1413.238) (-1412.349) (-1411.865) -- 0:00:09 857000 -- (-1412.433) (-1414.566) (-1411.609) [-1413.233] * [-1413.033] (-1412.326) (-1413.443) (-1412.541) -- 0:00:09 857500 -- (-1414.065) (-1414.353) (-1413.912) [-1413.879] * (-1413.989) (-1412.263) [-1413.852] (-1412.848) -- 0:00:08 858000 -- [-1413.235] (-1413.837) (-1413.551) (-1413.025) * (-1412.371) (-1413.470) (-1414.357) [-1414.009] -- 0:00:08 858500 -- (-1416.468) (-1417.901) [-1414.518] (-1414.177) * (-1413.662) (-1415.792) (-1415.245) [-1417.044] -- 0:00:08 859000 -- (-1416.380) (-1417.706) (-1411.997) [-1414.826] * (-1413.335) (-1414.784) [-1413.136] (-1415.935) -- 0:00:08 859500 -- (-1414.468) [-1413.772] (-1414.425) (-1414.150) * (-1414.464) (-1412.214) (-1415.666) [-1414.730] -- 0:00:08 860000 -- (-1413.385) [-1413.189] (-1413.187) (-1413.523) * (-1413.631) [-1414.516] (-1411.884) (-1413.236) -- 0:00:08 Average standard deviation of split frequencies: 0.010922 860500 -- (-1412.035) (-1414.513) [-1412.485] (-1413.063) * [-1413.394] (-1412.041) (-1412.387) (-1414.002) -- 0:00:08 861000 -- (-1412.045) (-1412.819) [-1413.024] (-1414.183) * [-1412.405] (-1412.139) (-1412.167) (-1414.041) -- 0:00:08 861500 -- (-1412.388) (-1412.329) [-1411.425] (-1415.108) * (-1414.837) (-1412.094) [-1412.560] (-1416.485) -- 0:00:08 862000 -- (-1416.761) (-1412.331) [-1413.516] (-1411.109) * [-1414.281] (-1413.404) (-1414.764) (-1411.803) -- 0:00:08 862500 -- (-1412.804) [-1415.898] (-1412.160) (-1419.088) * [-1414.287] (-1414.438) (-1413.418) (-1413.695) -- 0:00:08 863000 -- [-1412.427] (-1416.596) (-1411.431) (-1412.957) * (-1412.583) (-1418.711) (-1412.969) [-1411.129] -- 0:00:08 863500 -- [-1413.685] (-1412.398) (-1417.480) (-1412.429) * (-1411.157) (-1416.246) (-1414.739) [-1412.934] -- 0:00:08 864000 -- (-1412.384) (-1413.578) (-1411.950) [-1412.586] * (-1412.095) (-1418.010) (-1414.886) [-1413.137] -- 0:00:08 864500 -- (-1413.526) (-1416.217) [-1413.189] (-1415.600) * [-1413.917] (-1412.974) (-1415.398) (-1416.976) -- 0:00:08 865000 -- [-1412.693] (-1414.470) (-1412.458) (-1413.404) * (-1415.481) [-1411.283] (-1414.668) (-1417.842) -- 0:00:08 Average standard deviation of split frequencies: 0.010727 865500 -- (-1412.152) (-1413.462) [-1411.481] (-1413.745) * (-1420.398) (-1412.729) (-1415.186) [-1417.120] -- 0:00:08 866000 -- (-1412.840) (-1413.424) (-1412.297) [-1413.585] * (-1413.563) (-1412.096) (-1416.198) [-1413.934] -- 0:00:08 866500 -- (-1412.665) (-1413.717) [-1412.469] (-1412.589) * (-1415.310) (-1412.459) [-1411.954] (-1413.036) -- 0:00:08 867000 -- (-1412.301) (-1413.424) [-1411.892] (-1411.114) * [-1416.239] (-1416.310) (-1412.176) (-1411.581) -- 0:00:08 867500 -- (-1413.565) (-1418.489) (-1414.152) [-1411.092] * [-1411.699] (-1415.313) (-1412.190) (-1412.444) -- 0:00:08 868000 -- (-1413.390) [-1412.066] (-1413.909) (-1412.895) * [-1414.784] (-1415.473) (-1413.696) (-1412.407) -- 0:00:08 868500 -- (-1415.732) (-1411.046) (-1414.523) [-1411.753] * (-1417.115) (-1411.518) [-1413.481] (-1412.457) -- 0:00:08 869000 -- (-1417.376) (-1412.417) (-1415.230) [-1411.647] * (-1414.066) (-1412.143) [-1413.910] (-1413.126) -- 0:00:08 869500 -- [-1412.176] (-1417.319) (-1415.857) (-1414.491) * (-1417.059) [-1412.547] (-1412.222) (-1415.088) -- 0:00:08 870000 -- [-1411.962] (-1412.252) (-1418.723) (-1411.847) * (-1415.389) (-1415.403) (-1413.320) [-1415.955] -- 0:00:08 Average standard deviation of split frequencies: 0.010956 870500 -- [-1411.375] (-1413.364) (-1418.276) (-1413.894) * (-1411.433) [-1412.035] (-1412.133) (-1412.117) -- 0:00:08 871000 -- (-1415.336) (-1413.682) [-1412.523] (-1413.982) * [-1413.240] (-1413.257) (-1417.824) (-1411.707) -- 0:00:08 871500 -- (-1412.907) (-1412.837) [-1412.108] (-1413.194) * (-1413.996) [-1412.455] (-1415.897) (-1415.074) -- 0:00:08 872000 -- (-1412.895) [-1412.232] (-1412.297) (-1412.763) * (-1412.312) (-1413.999) (-1414.526) [-1411.765] -- 0:00:08 872500 -- (-1415.276) (-1415.268) (-1413.446) [-1411.398] * (-1411.450) (-1412.550) [-1411.960] (-1417.838) -- 0:00:08 873000 -- (-1414.964) [-1412.418] (-1416.008) (-1413.747) * (-1413.490) (-1415.042) (-1412.018) [-1413.427] -- 0:00:08 873500 -- (-1415.203) (-1416.337) [-1411.755] (-1418.495) * (-1414.687) (-1417.068) (-1412.391) [-1413.509] -- 0:00:07 874000 -- (-1411.582) [-1413.198] (-1412.343) (-1414.427) * (-1414.039) (-1415.362) [-1411.613] (-1413.767) -- 0:00:07 874500 -- [-1413.979] (-1411.114) (-1415.483) (-1412.440) * (-1413.797) (-1416.275) [-1413.814] (-1413.898) -- 0:00:07 875000 -- (-1417.694) [-1414.028] (-1417.552) (-1412.482) * (-1412.715) [-1415.735] (-1413.981) (-1413.177) -- 0:00:07 Average standard deviation of split frequencies: 0.010953 875500 -- (-1418.268) [-1412.196] (-1416.337) (-1411.264) * (-1412.930) (-1417.081) [-1411.433] (-1412.575) -- 0:00:07 876000 -- (-1413.782) (-1412.233) (-1418.304) [-1412.411] * (-1417.968) (-1414.378) (-1414.370) [-1413.441] -- 0:00:07 876500 -- (-1413.133) [-1411.953] (-1413.714) (-1413.408) * [-1412.676] (-1413.509) (-1415.116) (-1411.959) -- 0:00:07 877000 -- (-1412.856) (-1412.102) [-1419.018] (-1413.668) * (-1411.394) (-1412.639) (-1413.603) [-1413.057] -- 0:00:07 877500 -- (-1412.788) (-1412.396) [-1414.948] (-1413.631) * [-1411.490] (-1413.573) (-1413.317) (-1415.944) -- 0:00:07 878000 -- (-1412.496) (-1418.273) [-1414.439] (-1414.154) * [-1412.343] (-1413.155) (-1413.282) (-1411.994) -- 0:00:07 878500 -- (-1412.377) [-1412.940] (-1412.974) (-1417.149) * (-1412.136) [-1413.164] (-1415.369) (-1412.982) -- 0:00:07 879000 -- (-1413.359) (-1413.710) (-1412.244) [-1412.544] * (-1411.961) (-1416.551) (-1415.432) [-1414.454] -- 0:00:07 879500 -- (-1416.725) [-1412.301] (-1411.916) (-1417.713) * (-1414.044) (-1412.836) [-1413.475] (-1416.709) -- 0:00:07 880000 -- (-1414.698) (-1413.406) (-1412.647) [-1411.645] * (-1413.053) [-1413.188] (-1412.089) (-1414.249) -- 0:00:07 Average standard deviation of split frequencies: 0.011335 880500 -- [-1413.642] (-1411.065) (-1413.759) (-1412.818) * (-1413.769) [-1414.063] (-1411.618) (-1414.949) -- 0:00:07 881000 -- (-1413.607) [-1411.070] (-1414.622) (-1413.233) * (-1418.473) (-1413.568) (-1412.455) [-1412.563] -- 0:00:07 881500 -- [-1414.327] (-1411.887) (-1414.217) (-1414.399) * [-1414.324] (-1412.965) (-1412.461) (-1413.858) -- 0:00:07 882000 -- (-1414.443) (-1413.988) [-1413.531] (-1412.536) * [-1412.113] (-1413.082) (-1413.033) (-1415.865) -- 0:00:07 882500 -- (-1415.476) (-1413.547) (-1412.624) [-1412.752] * (-1413.390) [-1415.666] (-1412.274) (-1416.392) -- 0:00:07 883000 -- [-1414.880] (-1412.894) (-1419.362) (-1411.063) * (-1414.334) (-1412.907) (-1412.294) [-1415.152] -- 0:00:07 883500 -- (-1413.797) (-1414.971) (-1414.374) [-1411.082] * [-1413.844] (-1417.163) (-1415.968) (-1413.673) -- 0:00:07 884000 -- (-1412.570) (-1415.091) (-1415.788) [-1411.554] * [-1413.380] (-1415.050) (-1416.715) (-1420.208) -- 0:00:07 884500 -- (-1412.417) (-1415.611) [-1413.698] (-1413.715) * [-1414.698] (-1416.226) (-1414.437) (-1418.284) -- 0:00:07 885000 -- [-1412.891] (-1414.459) (-1412.678) (-1413.735) * [-1413.461] (-1413.859) (-1413.145) (-1412.069) -- 0:00:07 Average standard deviation of split frequencies: 0.011267 885500 -- [-1414.883] (-1416.723) (-1411.296) (-1414.273) * (-1419.657) (-1413.370) (-1412.459) [-1411.618] -- 0:00:07 886000 -- [-1414.464] (-1412.677) (-1413.283) (-1412.040) * [-1413.877] (-1413.149) (-1413.703) (-1413.246) -- 0:00:07 886500 -- [-1416.776] (-1411.524) (-1412.518) (-1412.871) * [-1414.631] (-1412.639) (-1412.488) (-1411.857) -- 0:00:07 887000 -- [-1415.338] (-1415.423) (-1415.632) (-1413.237) * (-1418.131) (-1417.620) (-1412.730) [-1414.211] -- 0:00:07 887500 -- (-1416.381) (-1415.181) [-1412.852] (-1411.929) * (-1416.067) (-1412.856) [-1412.723] (-1412.737) -- 0:00:07 888000 -- (-1414.819) (-1413.063) (-1414.793) [-1412.921] * [-1415.521] (-1414.029) (-1412.088) (-1413.235) -- 0:00:07 888500 -- (-1414.876) [-1415.076] (-1415.264) (-1412.283) * [-1416.538] (-1414.566) (-1414.637) (-1414.777) -- 0:00:07 889000 -- (-1412.750) (-1415.006) [-1411.726] (-1416.213) * (-1414.404) (-1415.605) (-1416.050) [-1413.221] -- 0:00:06 889500 -- (-1414.806) (-1413.551) [-1412.477] (-1412.951) * (-1415.743) (-1412.945) [-1414.536] (-1413.812) -- 0:00:06 890000 -- (-1412.536) [-1414.772] (-1411.661) (-1413.438) * [-1411.458] (-1413.619) (-1420.095) (-1411.391) -- 0:00:06 Average standard deviation of split frequencies: 0.011280 890500 -- (-1411.837) (-1413.985) [-1413.425] (-1414.309) * (-1411.488) (-1413.997) [-1413.787] (-1413.896) -- 0:00:06 891000 -- [-1413.107] (-1415.079) (-1415.789) (-1412.070) * [-1414.577] (-1413.164) (-1412.979) (-1411.097) -- 0:00:06 891500 -- (-1414.430) [-1412.464] (-1411.533) (-1412.918) * [-1413.062] (-1416.129) (-1413.224) (-1412.875) -- 0:00:06 892000 -- (-1418.129) (-1413.131) [-1415.149] (-1418.706) * (-1416.459) (-1414.288) [-1415.144] (-1415.499) -- 0:00:06 892500 -- (-1416.408) (-1412.356) [-1414.419] (-1412.266) * [-1411.701] (-1418.002) (-1417.682) (-1412.684) -- 0:00:06 893000 -- (-1415.768) [-1411.174] (-1412.598) (-1412.244) * (-1412.653) (-1415.265) (-1415.095) [-1412.449] -- 0:00:06 893500 -- (-1415.573) [-1411.555] (-1411.935) (-1412.488) * [-1412.872] (-1412.075) (-1414.390) (-1414.178) -- 0:00:06 894000 -- (-1414.814) (-1413.638) [-1411.964] (-1412.864) * (-1412.973) (-1412.150) [-1412.489] (-1414.006) -- 0:00:06 894500 -- (-1415.914) [-1413.581] (-1412.413) (-1413.104) * (-1412.759) (-1413.873) [-1414.882] (-1413.332) -- 0:00:06 895000 -- (-1417.182) (-1414.522) [-1412.915] (-1417.339) * [-1411.389] (-1413.066) (-1415.308) (-1411.485) -- 0:00:06 Average standard deviation of split frequencies: 0.011147 895500 -- [-1413.893] (-1416.517) (-1413.253) (-1411.830) * (-1411.557) (-1412.476) (-1418.709) [-1412.618] -- 0:00:06 896000 -- [-1413.352] (-1413.741) (-1412.008) (-1414.438) * (-1417.438) (-1415.230) [-1412.209] (-1412.304) -- 0:00:06 896500 -- [-1413.566] (-1415.178) (-1414.062) (-1419.912) * (-1413.893) (-1412.030) (-1414.578) [-1412.693] -- 0:00:06 897000 -- (-1415.085) (-1411.645) (-1411.040) [-1413.237] * (-1412.306) (-1411.973) [-1412.672] (-1415.922) -- 0:00:06 897500 -- (-1412.702) (-1412.377) [-1411.800] (-1413.460) * (-1413.050) [-1411.926] (-1413.658) (-1412.363) -- 0:00:06 898000 -- (-1415.279) (-1411.568) (-1414.342) [-1413.275] * (-1412.595) (-1414.831) [-1412.796] (-1412.204) -- 0:00:06 898500 -- (-1416.161) (-1411.861) [-1413.614] (-1411.266) * (-1412.639) [-1411.761] (-1415.244) (-1412.124) -- 0:00:06 899000 -- (-1412.908) (-1413.928) (-1413.099) [-1411.806] * (-1412.296) (-1411.747) (-1412.571) [-1412.198] -- 0:00:06 899500 -- (-1411.635) (-1414.097) [-1411.044] (-1412.240) * (-1411.819) (-1412.160) [-1414.897] (-1414.539) -- 0:00:06 900000 -- (-1411.511) (-1411.629) (-1417.046) [-1414.072] * (-1417.008) [-1411.702] (-1415.086) (-1415.826) -- 0:00:06 Average standard deviation of split frequencies: 0.011220 900500 -- (-1413.865) [-1413.847] (-1413.163) (-1415.630) * (-1413.212) (-1415.347) (-1413.154) [-1415.961] -- 0:00:06 901000 -- (-1414.964) (-1413.735) [-1413.954] (-1415.383) * (-1417.026) (-1411.585) [-1413.014] (-1414.976) -- 0:00:06 901500 -- (-1411.385) [-1413.264] (-1414.377) (-1412.365) * [-1413.072] (-1413.674) (-1413.986) (-1415.561) -- 0:00:06 902000 -- (-1413.018) (-1414.809) (-1414.464) [-1412.175] * (-1413.714) (-1414.743) [-1414.592] (-1412.428) -- 0:00:06 902500 -- (-1413.425) [-1413.694] (-1412.626) (-1413.337) * (-1413.592) (-1414.385) (-1414.557) [-1413.484] -- 0:00:06 903000 -- (-1418.816) [-1413.061] (-1414.914) (-1414.226) * (-1413.507) [-1410.972] (-1413.610) (-1413.129) -- 0:00:06 903500 -- [-1416.670] (-1414.280) (-1413.723) (-1413.790) * [-1411.955] (-1416.031) (-1412.759) (-1411.764) -- 0:00:06 904000 -- (-1412.430) [-1412.253] (-1415.895) (-1412.091) * (-1413.657) (-1414.326) [-1414.665] (-1411.897) -- 0:00:06 904500 -- (-1413.691) [-1412.660] (-1415.966) (-1412.342) * (-1412.963) (-1411.925) (-1412.990) [-1413.052] -- 0:00:06 905000 -- [-1413.340] (-1412.674) (-1413.189) (-1415.229) * (-1412.412) (-1411.585) [-1411.994] (-1413.692) -- 0:00:05 Average standard deviation of split frequencies: 0.011187 905500 -- [-1411.547] (-1413.036) (-1413.315) (-1418.117) * (-1417.437) [-1412.203] (-1414.069) (-1415.707) -- 0:00:05 906000 -- (-1412.140) [-1412.953] (-1411.169) (-1418.452) * (-1410.981) (-1414.259) (-1413.317) [-1412.573] -- 0:00:05 906500 -- (-1412.489) [-1416.305] (-1411.655) (-1415.564) * (-1411.901) (-1415.138) (-1413.721) [-1411.104] -- 0:00:05 907000 -- [-1412.305] (-1412.796) (-1412.344) (-1413.546) * [-1411.291] (-1413.354) (-1413.868) (-1411.148) -- 0:00:05 907500 -- [-1411.745] (-1413.943) (-1413.582) (-1413.688) * (-1411.686) (-1413.466) [-1415.233] (-1411.461) -- 0:00:05 908000 -- (-1412.640) (-1414.403) (-1413.377) [-1413.314] * (-1412.906) (-1412.815) [-1416.466] (-1412.278) -- 0:00:05 908500 -- (-1416.688) (-1412.677) [-1411.447] (-1413.986) * (-1411.809) (-1413.617) [-1411.766] (-1411.934) -- 0:00:05 909000 -- (-1413.849) (-1415.426) [-1412.607] (-1413.156) * (-1414.929) (-1413.572) (-1411.451) [-1412.280] -- 0:00:05 909500 -- [-1412.129] (-1412.272) (-1415.933) (-1412.159) * (-1413.458) [-1412.555] (-1413.979) (-1412.096) -- 0:00:05 910000 -- [-1413.341] (-1413.446) (-1412.599) (-1412.598) * [-1413.091] (-1411.835) (-1415.435) (-1412.576) -- 0:00:05 Average standard deviation of split frequencies: 0.010903 910500 -- (-1414.186) (-1414.188) [-1412.721] (-1412.533) * (-1416.137) (-1414.547) (-1414.946) [-1412.584] -- 0:00:05 911000 -- [-1414.536] (-1413.619) (-1417.442) (-1412.666) * (-1412.971) (-1415.186) [-1415.947] (-1412.245) -- 0:00:05 911500 -- [-1412.151] (-1413.323) (-1418.470) (-1414.541) * (-1411.074) (-1413.513) [-1414.193] (-1414.867) -- 0:00:05 912000 -- (-1414.764) (-1413.838) (-1414.911) [-1418.335] * [-1413.744] (-1413.498) (-1413.471) (-1415.238) -- 0:00:05 912500 -- (-1413.238) (-1412.450) [-1413.989] (-1420.018) * (-1412.988) [-1412.923] (-1416.466) (-1417.938) -- 0:00:05 913000 -- [-1413.100] (-1412.958) (-1412.643) (-1415.813) * (-1412.730) (-1415.036) (-1417.991) [-1415.221] -- 0:00:05 913500 -- [-1414.165] (-1414.206) (-1412.489) (-1411.453) * (-1414.138) [-1412.417] (-1413.792) (-1414.452) -- 0:00:05 914000 -- (-1417.034) [-1411.388] (-1412.637) (-1414.936) * (-1414.282) (-1414.890) (-1412.596) [-1412.701] -- 0:00:05 914500 -- [-1416.050] (-1413.901) (-1414.750) (-1412.070) * (-1412.091) (-1412.727) [-1411.677] (-1413.698) -- 0:00:05 915000 -- (-1416.191) (-1412.785) [-1411.153] (-1411.809) * [-1413.420] (-1412.307) (-1412.932) (-1411.779) -- 0:00:05 Average standard deviation of split frequencies: 0.011000 915500 -- (-1413.232) [-1413.633] (-1413.836) (-1413.447) * [-1412.957] (-1414.086) (-1413.335) (-1414.687) -- 0:00:05 916000 -- (-1412.707) [-1413.777] (-1412.202) (-1413.295) * (-1412.050) [-1415.134] (-1412.726) (-1415.047) -- 0:00:05 916500 -- (-1414.661) (-1412.773) [-1412.706] (-1412.533) * (-1411.577) (-1411.501) [-1414.750] (-1412.447) -- 0:00:05 917000 -- [-1415.204] (-1414.920) (-1415.186) (-1415.647) * (-1411.633) [-1412.646] (-1414.616) (-1413.437) -- 0:00:05 917500 -- (-1413.953) [-1413.480] (-1412.288) (-1414.401) * (-1417.615) (-1416.025) [-1415.576] (-1413.971) -- 0:00:05 918000 -- [-1411.257] (-1411.424) (-1412.429) (-1415.036) * (-1414.869) [-1414.689] (-1415.389) (-1413.881) -- 0:00:05 918500 -- [-1412.352] (-1411.041) (-1411.036) (-1412.427) * (-1412.928) [-1412.362] (-1414.396) (-1416.825) -- 0:00:05 919000 -- [-1412.783] (-1412.532) (-1412.038) (-1411.957) * (-1414.952) (-1412.767) (-1412.515) [-1414.485] -- 0:00:05 919500 -- [-1412.889] (-1415.096) (-1415.028) (-1411.232) * [-1416.772] (-1412.063) (-1415.575) (-1413.853) -- 0:00:05 920000 -- (-1413.550) [-1413.845] (-1420.106) (-1413.077) * [-1415.295] (-1414.521) (-1414.741) (-1412.995) -- 0:00:05 Average standard deviation of split frequencies: 0.010529 920500 -- (-1414.689) (-1412.541) (-1414.302) [-1412.487] * (-1412.131) [-1413.612] (-1411.252) (-1412.152) -- 0:00:05 921000 -- (-1414.824) (-1412.086) (-1412.676) [-1412.542] * (-1414.601) (-1416.403) [-1411.490] (-1414.706) -- 0:00:04 921500 -- (-1412.323) (-1412.502) [-1413.377] (-1413.584) * [-1412.833] (-1414.887) (-1417.160) (-1413.309) -- 0:00:04 922000 -- (-1414.923) (-1412.312) (-1412.996) [-1411.991] * (-1411.867) (-1413.806) (-1412.927) [-1413.719] -- 0:00:04 922500 -- [-1414.197] (-1411.487) (-1414.051) (-1413.106) * [-1411.396] (-1411.344) (-1413.095) (-1411.932) -- 0:00:04 923000 -- [-1413.904] (-1411.569) (-1411.586) (-1415.813) * (-1411.392) [-1412.460] (-1414.789) (-1412.583) -- 0:00:04 923500 -- [-1412.502] (-1412.995) (-1411.423) (-1413.553) * (-1411.547) (-1414.135) [-1413.323] (-1413.024) -- 0:00:04 924000 -- [-1412.276] (-1414.297) (-1412.442) (-1414.319) * [-1412.584] (-1413.599) (-1413.587) (-1412.281) -- 0:00:04 924500 -- [-1412.779] (-1414.632) (-1415.467) (-1413.167) * (-1412.673) [-1413.325] (-1413.428) (-1412.308) -- 0:00:04 925000 -- (-1417.413) (-1413.161) [-1412.245] (-1413.637) * (-1414.064) (-1413.193) (-1412.098) [-1412.353] -- 0:00:04 Average standard deviation of split frequencies: 0.010691 925500 -- (-1413.812) (-1411.890) (-1411.831) [-1412.839] * [-1414.763] (-1414.912) (-1411.781) (-1412.506) -- 0:00:04 926000 -- [-1414.216] (-1415.324) (-1414.025) (-1413.842) * [-1412.029] (-1414.567) (-1414.726) (-1412.062) -- 0:00:04 926500 -- [-1414.556] (-1414.915) (-1416.204) (-1414.399) * (-1412.031) (-1417.198) [-1412.464] (-1414.458) -- 0:00:04 927000 -- (-1414.177) (-1412.246) [-1411.161] (-1415.523) * [-1413.375] (-1415.757) (-1413.610) (-1413.541) -- 0:00:04 927500 -- (-1415.238) [-1412.348] (-1422.652) (-1416.570) * (-1412.625) [-1411.956] (-1422.352) (-1412.185) -- 0:00:04 928000 -- [-1415.133] (-1412.047) (-1413.220) (-1412.170) * (-1416.573) (-1412.386) (-1413.028) [-1412.497] -- 0:00:04 928500 -- (-1418.901) (-1412.121) [-1413.772] (-1413.944) * (-1412.708) (-1412.110) [-1412.280] (-1418.655) -- 0:00:04 929000 -- (-1414.019) (-1415.958) [-1412.950] (-1414.062) * (-1414.531) (-1414.118) [-1416.653] (-1413.352) -- 0:00:04 929500 -- (-1413.471) (-1412.346) [-1412.262] (-1412.498) * (-1412.717) (-1413.211) [-1413.892] (-1412.764) -- 0:00:04 930000 -- (-1413.640) (-1413.074) (-1413.125) [-1412.249] * (-1414.966) (-1414.095) [-1410.920] (-1412.503) -- 0:00:04 Average standard deviation of split frequencies: 0.010607 930500 -- (-1413.004) (-1414.748) [-1414.015] (-1416.132) * (-1413.599) (-1413.468) [-1410.897] (-1413.960) -- 0:00:04 931000 -- (-1415.627) (-1413.192) [-1414.315] (-1412.532) * (-1412.558) (-1412.347) [-1410.897] (-1415.399) -- 0:00:04 931500 -- [-1415.211] (-1413.551) (-1412.491) (-1416.059) * (-1412.674) (-1415.058) (-1410.946) [-1413.677] -- 0:00:04 932000 -- (-1413.452) (-1414.332) [-1413.388] (-1416.142) * (-1411.129) (-1414.921) [-1411.428] (-1412.901) -- 0:00:04 932500 -- (-1412.904) (-1412.620) [-1413.016] (-1413.337) * (-1416.989) [-1416.325] (-1412.717) (-1412.787) -- 0:00:04 933000 -- (-1411.394) [-1411.789] (-1413.435) (-1413.443) * (-1413.605) (-1413.809) [-1414.665] (-1416.490) -- 0:00:04 933500 -- (-1411.082) [-1411.504] (-1417.593) (-1417.195) * (-1415.218) (-1411.889) [-1416.472] (-1414.432) -- 0:00:04 934000 -- (-1411.122) (-1411.766) (-1411.215) [-1413.242] * (-1414.120) (-1412.320) [-1414.384] (-1412.613) -- 0:00:04 934500 -- (-1416.840) (-1411.842) [-1415.595] (-1414.132) * (-1414.676) [-1411.543] (-1416.098) (-1411.623) -- 0:00:04 935000 -- (-1412.731) (-1412.279) (-1419.614) [-1412.232] * (-1413.331) (-1411.947) [-1415.519] (-1411.607) -- 0:00:04 Average standard deviation of split frequencies: 0.010482 935500 -- (-1411.391) (-1414.722) (-1414.016) [-1412.751] * (-1416.902) [-1413.345] (-1414.037) (-1413.803) -- 0:00:04 936000 -- (-1414.763) (-1412.665) [-1414.483] (-1411.803) * (-1411.881) (-1415.073) (-1416.829) [-1412.775] -- 0:00:04 936500 -- (-1412.943) [-1412.370] (-1413.445) (-1412.894) * (-1413.649) (-1412.523) (-1412.546) [-1413.470] -- 0:00:04 937000 -- (-1412.318) (-1413.505) (-1416.847) [-1414.079] * [-1413.375] (-1412.032) (-1417.889) (-1414.739) -- 0:00:03 937500 -- (-1413.054) [-1413.412] (-1412.761) (-1415.722) * [-1411.960] (-1417.363) (-1418.761) (-1414.718) -- 0:00:03 938000 -- [-1412.062] (-1413.776) (-1413.530) (-1420.725) * (-1413.348) (-1412.219) [-1417.206] (-1413.970) -- 0:00:03 938500 -- (-1414.915) (-1412.087) [-1414.688] (-1413.962) * (-1413.337) (-1416.086) (-1412.172) [-1414.283] -- 0:00:03 939000 -- (-1412.986) (-1414.370) (-1413.478) [-1412.613] * (-1414.116) (-1417.715) (-1415.267) [-1413.982] -- 0:00:03 939500 -- (-1412.316) (-1415.530) (-1411.389) [-1415.346] * (-1416.999) (-1416.311) [-1411.746] (-1412.875) -- 0:00:03 940000 -- [-1414.035] (-1412.729) (-1412.994) (-1415.919) * [-1412.433] (-1415.396) (-1414.592) (-1414.204) -- 0:00:03 Average standard deviation of split frequencies: 0.010357 940500 -- (-1413.052) (-1412.599) [-1411.361] (-1414.889) * (-1411.862) (-1413.914) (-1414.444) [-1412.641] -- 0:00:03 941000 -- (-1414.785) (-1414.922) [-1411.584] (-1415.862) * (-1413.041) (-1413.487) (-1413.438) [-1413.135] -- 0:00:03 941500 -- (-1413.981) (-1417.743) [-1413.000] (-1416.540) * (-1412.517) [-1413.748] (-1416.012) (-1414.812) -- 0:00:03 942000 -- (-1413.404) [-1415.129] (-1412.129) (-1412.077) * (-1411.847) [-1411.933] (-1412.624) (-1411.825) -- 0:00:03 942500 -- (-1415.802) [-1414.485] (-1411.904) (-1411.378) * (-1414.104) [-1411.833] (-1415.980) (-1412.691) -- 0:00:03 943000 -- [-1412.294] (-1416.197) (-1412.886) (-1412.068) * (-1411.717) (-1413.066) (-1411.767) [-1413.784] -- 0:00:03 943500 -- [-1412.680] (-1413.394) (-1412.059) (-1411.907) * (-1413.105) [-1415.753] (-1413.041) (-1412.106) -- 0:00:03 944000 -- [-1411.799] (-1416.711) (-1412.590) (-1416.113) * (-1415.828) (-1419.860) [-1415.697] (-1417.224) -- 0:00:03 944500 -- (-1412.333) (-1416.623) (-1411.783) [-1411.705] * (-1414.191) (-1415.289) (-1414.411) [-1416.194] -- 0:00:03 945000 -- (-1415.474) [-1413.802] (-1413.596) (-1411.594) * (-1414.136) (-1417.366) [-1412.304] (-1412.223) -- 0:00:03 Average standard deviation of split frequencies: 0.010309 945500 -- (-1415.484) (-1414.767) (-1414.899) [-1412.553] * (-1415.681) (-1413.658) [-1411.495] (-1412.454) -- 0:00:03 946000 -- (-1413.006) [-1412.757] (-1412.806) (-1414.102) * (-1414.438) (-1411.803) [-1411.719] (-1414.579) -- 0:00:03 946500 -- (-1415.308) [-1412.878] (-1413.233) (-1416.623) * (-1411.250) (-1413.701) [-1413.812] (-1414.521) -- 0:00:03 947000 -- [-1415.017] (-1412.467) (-1412.691) (-1413.195) * (-1412.456) (-1414.043) [-1413.084] (-1413.368) -- 0:00:03 947500 -- (-1418.202) (-1411.232) [-1412.664] (-1414.298) * (-1414.839) (-1416.560) [-1414.165] (-1414.259) -- 0:00:03 948000 -- [-1414.234] (-1412.960) (-1411.656) (-1414.674) * (-1414.285) (-1419.998) [-1414.801] (-1413.808) -- 0:00:03 948500 -- (-1413.420) [-1411.210] (-1412.587) (-1415.722) * (-1414.526) (-1415.372) (-1412.920) [-1413.607] -- 0:00:03 949000 -- [-1411.706] (-1414.078) (-1415.252) (-1412.235) * [-1413.924] (-1411.843) (-1411.325) (-1415.963) -- 0:00:03 949500 -- (-1412.766) [-1411.627] (-1411.746) (-1414.760) * (-1419.845) (-1412.237) [-1411.385] (-1415.264) -- 0:00:03 950000 -- (-1419.455) (-1415.759) [-1412.032] (-1416.665) * (-1414.132) [-1412.472] (-1413.816) (-1412.674) -- 0:00:03 Average standard deviation of split frequencies: 0.009886 950500 -- (-1417.001) (-1415.714) [-1412.752] (-1412.664) * [-1412.040] (-1412.448) (-1415.578) (-1412.672) -- 0:00:03 951000 -- (-1412.836) (-1412.749) [-1412.847] (-1413.702) * (-1415.570) [-1415.013] (-1416.682) (-1414.657) -- 0:00:03 951500 -- (-1412.529) [-1413.118] (-1414.750) (-1414.715) * [-1413.176] (-1416.333) (-1415.804) (-1415.648) -- 0:00:03 952000 -- (-1413.441) (-1412.846) [-1413.323] (-1415.147) * (-1412.985) (-1414.866) [-1416.304] (-1417.125) -- 0:00:03 952500 -- (-1413.362) (-1413.364) [-1413.112] (-1414.325) * (-1411.873) (-1414.442) (-1414.609) [-1412.609] -- 0:00:02 953000 -- [-1412.334] (-1411.952) (-1413.957) (-1415.328) * [-1412.167] (-1412.717) (-1413.050) (-1411.619) -- 0:00:02 953500 -- [-1411.265] (-1424.440) (-1418.109) (-1413.322) * (-1412.607) (-1412.122) (-1412.733) [-1413.252] -- 0:00:02 954000 -- (-1412.850) (-1412.570) (-1413.450) [-1414.760] * (-1411.123) [-1411.964] (-1416.005) (-1412.566) -- 0:00:02 954500 -- [-1413.536] (-1413.717) (-1412.106) (-1412.470) * [-1415.050] (-1413.430) (-1412.587) (-1412.568) -- 0:00:02 955000 -- (-1414.157) (-1415.077) (-1415.195) [-1412.665] * (-1411.794) [-1416.808] (-1413.212) (-1415.401) -- 0:00:02 Average standard deviation of split frequencies: 0.009862 955500 -- (-1414.252) (-1413.433) [-1412.042] (-1412.545) * (-1412.822) [-1414.915] (-1414.052) (-1413.410) -- 0:00:02 956000 -- (-1412.444) [-1412.357] (-1411.753) (-1411.188) * (-1414.947) (-1412.609) (-1412.901) [-1411.411] -- 0:00:02 956500 -- (-1413.451) (-1412.416) [-1411.755] (-1411.933) * [-1412.691] (-1412.184) (-1412.101) (-1413.854) -- 0:00:02 957000 -- [-1413.078] (-1413.945) (-1412.312) (-1411.091) * (-1412.824) (-1411.484) [-1414.548] (-1418.824) -- 0:00:02 957500 -- (-1412.736) [-1413.169] (-1412.713) (-1414.869) * [-1413.773] (-1411.100) (-1414.361) (-1420.208) -- 0:00:02 958000 -- (-1414.684) (-1413.039) (-1412.948) [-1414.022] * [-1413.136] (-1412.015) (-1411.914) (-1412.984) -- 0:00:02 958500 -- (-1412.477) [-1414.719] (-1412.914) (-1415.125) * (-1412.220) (-1412.011) [-1413.591] (-1413.117) -- 0:00:02 959000 -- (-1414.139) (-1413.478) [-1414.095] (-1416.101) * (-1413.408) (-1412.437) (-1417.233) [-1413.156] -- 0:00:02 959500 -- (-1414.161) [-1414.035] (-1413.353) (-1413.857) * [-1412.461] (-1411.984) (-1416.147) (-1413.309) -- 0:00:02 960000 -- (-1411.833) (-1413.278) [-1413.188] (-1412.881) * (-1414.530) (-1412.278) [-1412.627] (-1413.737) -- 0:00:02 Average standard deviation of split frequencies: 0.010174 960500 -- (-1413.068) [-1413.560] (-1411.473) (-1412.611) * (-1411.623) [-1414.237] (-1413.497) (-1416.774) -- 0:00:02 961000 -- [-1413.025] (-1418.164) (-1413.135) (-1412.579) * (-1413.790) (-1412.039) [-1416.465] (-1412.595) -- 0:00:02 961500 -- (-1413.624) (-1412.792) (-1411.802) [-1412.114] * [-1415.118] (-1412.578) (-1414.947) (-1413.610) -- 0:00:02 962000 -- [-1413.786] (-1415.479) (-1413.249) (-1415.756) * (-1412.390) [-1411.802] (-1415.182) (-1414.554) -- 0:00:02 962500 -- (-1411.089) (-1413.257) [-1411.993] (-1418.622) * [-1412.221] (-1413.647) (-1413.550) (-1413.173) -- 0:00:02 963000 -- [-1413.662] (-1417.743) (-1413.221) (-1418.381) * (-1411.732) (-1415.450) (-1414.886) [-1412.682] -- 0:00:02 963500 -- [-1413.600] (-1414.177) (-1414.272) (-1412.214) * (-1411.828) [-1411.954] (-1414.098) (-1414.336) -- 0:00:02 964000 -- (-1416.648) (-1412.642) [-1412.919] (-1413.611) * (-1413.162) (-1411.355) (-1415.368) [-1416.022] -- 0:00:02 964500 -- (-1417.580) [-1412.564] (-1412.928) (-1419.766) * [-1412.602] (-1411.486) (-1416.095) (-1413.126) -- 0:00:02 965000 -- (-1413.058) (-1412.339) (-1413.606) [-1412.351] * [-1412.119] (-1415.521) (-1414.193) (-1417.351) -- 0:00:02 Average standard deviation of split frequencies: 0.009851 965500 -- (-1411.861) [-1412.264] (-1417.923) (-1412.784) * (-1412.246) (-1417.069) (-1412.997) [-1415.663] -- 0:00:02 966000 -- [-1411.942] (-1415.138) (-1415.228) (-1411.940) * [-1412.562] (-1414.225) (-1413.178) (-1414.398) -- 0:00:02 966500 -- [-1416.509] (-1415.428) (-1415.306) (-1413.292) * (-1413.517) (-1412.941) (-1413.612) [-1412.686] -- 0:00:02 967000 -- (-1417.878) (-1416.173) [-1412.928] (-1413.760) * (-1415.520) (-1414.074) [-1413.929] (-1412.810) -- 0:00:02 967500 -- (-1412.619) (-1414.035) (-1414.882) [-1411.872] * (-1412.347) (-1413.432) (-1413.194) [-1414.183] -- 0:00:02 968000 -- [-1415.614] (-1412.298) (-1412.906) (-1411.557) * (-1412.572) [-1411.462] (-1414.219) (-1411.930) -- 0:00:02 968500 -- (-1414.497) (-1416.571) [-1412.825] (-1412.053) * [-1411.649] (-1414.531) (-1412.202) (-1416.932) -- 0:00:01 969000 -- (-1415.131) (-1411.533) (-1411.988) [-1413.004] * [-1411.845] (-1417.368) (-1413.446) (-1416.290) -- 0:00:01 969500 -- (-1413.966) [-1412.940] (-1412.185) (-1412.493) * (-1412.603) [-1411.972] (-1411.514) (-1413.836) -- 0:00:01 970000 -- (-1414.926) [-1413.693] (-1412.359) (-1411.425) * [-1413.828] (-1415.421) (-1412.432) (-1411.766) -- 0:00:01 Average standard deviation of split frequencies: 0.009774 970500 -- (-1411.879) [-1413.998] (-1413.779) (-1414.794) * (-1413.815) (-1412.241) [-1411.552] (-1413.063) -- 0:00:01 971000 -- (-1412.566) (-1413.766) (-1411.156) [-1414.116] * (-1414.967) (-1413.364) [-1411.308] (-1412.111) -- 0:00:01 971500 -- [-1413.024] (-1413.165) (-1413.274) (-1414.646) * [-1413.085] (-1413.874) (-1411.578) (-1411.926) -- 0:00:01 972000 -- [-1412.152] (-1417.366) (-1413.256) (-1413.230) * (-1418.424) (-1412.307) [-1416.574] (-1412.142) -- 0:00:01 972500 -- (-1413.076) [-1415.463] (-1413.267) (-1414.946) * [-1411.968] (-1416.901) (-1413.339) (-1413.206) -- 0:00:01 973000 -- (-1415.143) (-1417.835) [-1411.368] (-1415.474) * (-1411.813) (-1416.789) (-1411.299) [-1414.682] -- 0:00:01 973500 -- [-1415.229] (-1415.547) (-1413.934) (-1413.306) * (-1411.748) (-1413.405) (-1413.342) [-1413.647] -- 0:00:01 974000 -- (-1413.155) (-1413.246) (-1412.233) [-1415.350] * [-1414.261] (-1412.226) (-1415.097) (-1412.501) -- 0:00:01 974500 -- (-1413.276) (-1411.968) (-1412.974) [-1412.561] * (-1414.625) [-1414.064] (-1416.943) (-1412.862) -- 0:00:01 975000 -- (-1415.108) (-1413.064) (-1412.607) [-1412.240] * (-1413.038) [-1413.652] (-1411.708) (-1417.093) -- 0:00:01 Average standard deviation of split frequencies: 0.009950 975500 -- (-1413.383) [-1412.028] (-1413.162) (-1412.486) * (-1412.499) (-1414.886) (-1413.695) [-1413.002] -- 0:00:01 976000 -- (-1411.387) [-1413.352] (-1412.316) (-1411.163) * (-1413.160) (-1414.172) (-1414.127) [-1413.103] -- 0:00:01 976500 -- (-1413.434) [-1412.255] (-1411.485) (-1415.405) * (-1414.957) (-1414.134) (-1412.257) [-1412.208] -- 0:00:01 977000 -- (-1411.538) (-1416.006) [-1413.632] (-1414.349) * (-1417.837) (-1413.805) [-1411.825] (-1413.038) -- 0:00:01 977500 -- (-1413.005) (-1414.308) [-1413.719] (-1415.952) * (-1415.718) (-1414.250) (-1411.853) [-1414.599] -- 0:00:01 978000 -- [-1411.913] (-1413.972) (-1413.477) (-1412.507) * (-1417.025) (-1414.429) (-1414.075) [-1413.166] -- 0:00:01 978500 -- (-1412.297) (-1414.132) (-1413.270) [-1412.963] * [-1413.623] (-1413.894) (-1414.988) (-1413.417) -- 0:00:01 979000 -- (-1412.399) (-1412.236) (-1413.261) [-1414.272] * (-1413.911) [-1413.550] (-1415.351) (-1412.277) -- 0:00:01 979500 -- (-1413.578) (-1412.476) (-1413.585) [-1415.370] * (-1415.364) (-1415.849) (-1418.091) [-1415.285] -- 0:00:01 980000 -- (-1413.512) (-1412.198) [-1413.910] (-1421.880) * (-1413.608) [-1412.218] (-1413.486) (-1413.378) -- 0:00:01 Average standard deviation of split frequencies: 0.009966 980500 -- (-1413.277) (-1412.496) [-1411.499] (-1412.811) * (-1413.101) (-1414.022) [-1411.396] (-1415.110) -- 0:00:01 981000 -- (-1412.031) (-1411.835) [-1413.584] (-1413.205) * [-1416.706] (-1417.492) (-1411.414) (-1413.419) -- 0:00:01 981500 -- (-1411.683) [-1412.731] (-1414.737) (-1415.623) * (-1414.494) [-1416.628] (-1412.423) (-1413.878) -- 0:00:01 982000 -- (-1411.616) [-1411.551] (-1416.571) (-1411.774) * (-1413.464) (-1413.479) [-1411.858] (-1414.925) -- 0:00:01 982500 -- (-1411.761) (-1416.618) (-1415.995) [-1412.990] * (-1412.846) [-1413.967] (-1411.993) (-1411.708) -- 0:00:01 983000 -- (-1413.334) (-1412.248) (-1413.794) [-1415.501] * [-1412.382] (-1413.011) (-1412.935) (-1411.960) -- 0:00:01 983500 -- [-1412.953] (-1413.478) (-1414.648) (-1414.474) * (-1413.012) (-1413.808) [-1411.406] (-1414.059) -- 0:00:01 984000 -- (-1414.137) (-1413.730) [-1411.819] (-1415.463) * [-1414.416] (-1416.416) (-1414.884) (-1414.879) -- 0:00:01 984500 -- (-1413.959) (-1418.882) (-1414.494) [-1412.898] * (-1412.026) [-1414.247] (-1414.526) (-1414.073) -- 0:00:00 985000 -- (-1412.945) (-1415.872) (-1413.735) [-1413.258] * [-1412.801] (-1414.669) (-1412.485) (-1412.976) -- 0:00:00 Average standard deviation of split frequencies: 0.009592 985500 -- (-1414.163) [-1413.427] (-1419.137) (-1413.352) * (-1411.266) (-1411.816) (-1413.338) [-1416.559] -- 0:00:00 986000 -- (-1411.698) (-1416.781) (-1412.797) [-1414.322] * (-1413.169) [-1413.107] (-1415.141) (-1413.836) -- 0:00:00 986500 -- (-1411.866) [-1414.895] (-1411.744) (-1412.048) * (-1412.872) [-1413.475] (-1414.511) (-1413.479) -- 0:00:00 987000 -- (-1411.415) (-1416.136) [-1412.773] (-1412.720) * (-1414.018) [-1412.279] (-1414.305) (-1413.068) -- 0:00:00 987500 -- (-1411.970) (-1413.470) [-1413.472] (-1414.050) * (-1415.109) [-1412.236] (-1413.521) (-1413.421) -- 0:00:00 988000 -- [-1416.112] (-1412.979) (-1411.428) (-1413.715) * [-1414.935] (-1422.632) (-1418.242) (-1413.679) -- 0:00:00 988500 -- [-1411.948] (-1413.084) (-1411.131) (-1412.300) * [-1412.672] (-1418.089) (-1416.942) (-1412.043) -- 0:00:00 989000 -- (-1412.063) (-1414.274) [-1413.857] (-1412.825) * (-1415.330) (-1419.281) (-1417.996) [-1412.275] -- 0:00:00 989500 -- (-1412.511) [-1413.684] (-1411.784) (-1413.757) * (-1420.358) (-1413.523) (-1412.773) [-1413.128] -- 0:00:00 990000 -- (-1411.987) [-1413.671] (-1416.136) (-1414.061) * (-1416.101) (-1414.870) [-1412.034] (-1415.006) -- 0:00:00 Average standard deviation of split frequencies: 0.009844 990500 -- (-1413.892) (-1413.367) (-1413.738) [-1412.502] * (-1417.374) [-1413.719] (-1416.052) (-1412.858) -- 0:00:00 991000 -- (-1419.394) (-1416.284) [-1411.446] (-1411.139) * (-1414.754) (-1416.542) [-1413.263] (-1411.861) -- 0:00:00 991500 -- (-1412.531) (-1415.344) (-1413.281) [-1411.842] * (-1414.354) (-1415.236) [-1412.018] (-1413.143) -- 0:00:00 992000 -- (-1413.595) [-1411.235] (-1416.065) (-1411.779) * [-1413.417] (-1412.999) (-1413.578) (-1414.046) -- 0:00:00 992500 -- (-1411.583) [-1412.169] (-1417.489) (-1412.745) * (-1412.417) (-1412.959) [-1412.566] (-1413.747) -- 0:00:00 993000 -- [-1412.469] (-1415.394) (-1419.069) (-1411.900) * (-1415.322) [-1413.278] (-1411.924) (-1413.085) -- 0:00:00 993500 -- (-1415.376) (-1413.331) [-1414.463] (-1412.964) * [-1417.068] (-1413.287) (-1415.404) (-1418.428) -- 0:00:00 994000 -- (-1412.154) [-1415.264] (-1412.688) (-1413.003) * (-1415.884) [-1412.322] (-1414.715) (-1412.652) -- 0:00:00 994500 -- (-1412.963) (-1416.284) [-1411.834] (-1413.255) * (-1413.495) (-1411.380) (-1413.505) [-1413.248] -- 0:00:00 995000 -- (-1411.408) (-1412.891) [-1412.115] (-1412.564) * (-1416.010) (-1413.343) [-1413.752] (-1411.501) -- 0:00:00 Average standard deviation of split frequencies: 0.009821 995500 -- (-1419.138) [-1412.556] (-1413.104) (-1411.437) * (-1411.564) (-1416.743) [-1415.178] (-1415.027) -- 0:00:00 996000 -- (-1416.599) [-1413.060] (-1416.772) (-1413.879) * (-1412.213) [-1414.113] (-1412.039) (-1421.521) -- 0:00:00 996500 -- [-1413.263] (-1413.344) (-1413.658) (-1411.982) * (-1417.309) [-1413.357] (-1411.951) (-1413.789) -- 0:00:00 997000 -- (-1411.410) (-1412.386) [-1413.894] (-1412.037) * (-1411.858) (-1412.988) [-1411.695] (-1415.322) -- 0:00:00 997500 -- [-1411.745] (-1414.743) (-1412.918) (-1411.816) * [-1416.421] (-1415.213) (-1412.961) (-1413.234) -- 0:00:00 998000 -- (-1411.885) (-1413.584) (-1413.472) [-1411.865] * (-1414.940) [-1414.741] (-1417.560) (-1413.771) -- 0:00:00 998500 -- (-1411.621) (-1411.505) [-1412.072] (-1413.108) * [-1413.093] (-1414.893) (-1413.547) (-1412.676) -- 0:00:00 999000 -- (-1413.013) (-1411.360) [-1412.457] (-1415.953) * [-1411.816] (-1412.801) (-1412.620) (-1414.310) -- 0:00:00 999500 -- (-1413.538) (-1418.570) [-1413.157] (-1414.741) * (-1411.468) [-1413.423] (-1412.005) (-1415.132) -- 0:00:00 1000000 -- (-1417.973) [-1414.599] (-1413.931) (-1411.646) * (-1412.413) [-1416.955] (-1413.808) (-1413.639) -- 0:00:00 Average standard deviation of split frequencies: 0.009704 Analysis completed in 1 mins 3 seconds Analysis used 61.63 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -1410.88 Likelihood of best state for "cold" chain of run 2 was -1410.88 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 75.7 % ( 67 %) Dirichlet(Revmat{all}) 100.0 % (100 %) Slider(Revmat{all}) 25.1 % ( 20 %) Dirichlet(Pi{all}) 26.6 % ( 26 %) Slider(Pi{all}) 79.0 % ( 53 %) Multiplier(Alpha{1,2}) 76.8 % ( 39 %) Multiplier(Alpha{3}) 17.1 % ( 28 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.3 % ( 67 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 85 %) ParsSPR(Tau{all},V{all}) 28.1 % ( 17 %) Multiplier(V{all}) 97.4 % ( 98 %) Nodeslider(V{all}) 30.4 % ( 17 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 74.8 % ( 70 %) Dirichlet(Revmat{all}) 99.9 % (100 %) Slider(Revmat{all}) 25.4 % ( 27 %) Dirichlet(Pi{all}) 27.0 % ( 28 %) Slider(Pi{all}) 79.0 % ( 54 %) Multiplier(Alpha{1,2}) 77.9 % ( 54 %) Multiplier(Alpha{3}) 17.8 % ( 27 %) Slider(Pinvar{all}) 98.7 % ( 98 %) ExtSPR(Tau{all},V{all}) 70.2 % ( 73 %) ExtTBR(Tau{all},V{all}) 100.0 % (100 %) NNI(Tau{all},V{all}) 89.5 % ( 90 %) ParsSPR(Tau{all},V{all}) 28.2 % ( 23 %) Multiplier(V{all}) 97.3 % ( 98 %) Nodeslider(V{all}) 30.5 % ( 20 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166457 0.82 0.67 3 | 166643 166871 0.84 4 | 166620 166279 167130 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.81 0.64 0.50 2 | 166800 0.82 0.67 3 | 167067 166906 0.84 4 | 166427 166417 166383 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -1412.46 | 1 | | 2 | | 2 1 1 1 | | 12 1 1 2 1 1 1| | 2121 2 * 2 12 12 1 1 1 12 | |2 * 111 2 12 2 1 * 1 22 1 1 | | 1111 1 21 2 2 2 2 21 2 2 2 1 2 1 | | 2 22 221 1 2 21 1 1 1 1 22 1 2 2 2 2 | |1 1 2 * 2 1 221 1 22 1 2 2| | 1 2 1* 1 2 1 | | 2 2 1 | | 1 22 | | | | | | 2 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1414.50 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1412.61 -1416.05 2 -1412.63 -1415.45 -------------------------------------- TOTAL -1412.62 -1415.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891890 0.088934 0.377789 1.501303 0.855647 1299.25 1400.12 1.000 r(A<->C){all} 0.168538 0.019314 0.000047 0.448896 0.134764 175.29 191.04 1.001 r(A<->G){all} 0.161451 0.019034 0.000017 0.443057 0.126665 246.75 272.44 1.000 r(A<->T){all} 0.174918 0.021568 0.000166 0.475103 0.135909 115.91 168.54 1.000 r(C<->G){all} 0.167757 0.018430 0.000005 0.437410 0.136424 259.34 316.85 1.002 r(C<->T){all} 0.161345 0.018293 0.000140 0.435765 0.126625 222.28 271.95 1.000 r(G<->T){all} 0.165990 0.018943 0.000076 0.443619 0.132000 241.83 266.77 1.000 pi(A){all} 0.172726 0.000136 0.151693 0.196988 0.172161 1112.19 1236.40 1.000 pi(C){all} 0.306531 0.000190 0.279415 0.332588 0.306559 1197.76 1252.92 1.000 pi(G){all} 0.342898 0.000209 0.315749 0.371470 0.342793 1060.45 1280.73 1.000 pi(T){all} 0.177845 0.000138 0.154914 0.200253 0.177724 1373.62 1399.01 1.000 alpha{1,2} 0.443111 0.245939 0.000261 1.431847 0.264457 998.04 1135.57 1.000 alpha{3} 0.455976 0.232927 0.000133 1.417494 0.294483 1180.73 1241.25 1.000 pinvar{all} 0.998569 0.000003 0.995557 0.999999 0.999062 1171.63 1218.78 1.003 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 Key to taxon bipartitions (saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ------------ 1 -- .***** 2 -- .*.... 3 -- ..*... 4 -- ...*.. 5 -- ....*. 6 -- .....* 7 -- ....** 8 -- .**... 9 -- .*.*** 10 -- .****. 11 -- ...*.* 12 -- ...**. 13 -- .*.*.. 14 -- ..**** 15 -- .*..*. 16 -- ..**.. 17 -- .**.** 18 -- ..*.*. 19 -- .*...* 20 -- .***.* 21 -- ..*..* ------------ Summary statistics for informative taxon bipartitions (saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 7 463 0.154231 0.020257 0.139907 0.168554 2 8 461 0.153564 0.001413 0.152565 0.154564 2 9 461 0.153564 0.004240 0.150566 0.156562 2 10 457 0.152232 0.013662 0.142572 0.161892 2 11 443 0.147568 0.011777 0.139241 0.155896 2 12 425 0.141572 0.016488 0.129913 0.153231 2 13 416 0.138574 0.008480 0.132578 0.144570 2 14 415 0.138241 0.018373 0.125250 0.151233 2 15 415 0.138241 0.004240 0.135243 0.141239 2 16 414 0.137908 0.010364 0.130580 0.145237 2 17 414 0.137908 0.012248 0.129247 0.146569 2 18 412 0.137242 0.003769 0.134577 0.139907 2 19 411 0.136909 0.008951 0.130580 0.143238 2 20 406 0.135243 0.004711 0.131912 0.138574 2 21 400 0.133245 0.006595 0.128581 0.137908 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.097810 0.009282 0.000007 0.293594 0.068693 1.000 2 length{all}[2] 0.098892 0.009995 0.000051 0.295934 0.069405 1.000 2 length{all}[3] 0.097767 0.009309 0.000018 0.278817 0.070684 1.000 2 length{all}[4] 0.098138 0.009653 0.000012 0.288285 0.068814 1.000 2 length{all}[5] 0.100421 0.009948 0.000030 0.307471 0.071073 1.000 2 length{all}[6] 0.100852 0.009906 0.000168 0.300637 0.069169 1.000 2 length{all}[7] 0.094809 0.009387 0.000194 0.290133 0.062359 0.998 2 length{all}[8] 0.105856 0.010655 0.000032 0.292151 0.073344 1.001 2 length{all}[9] 0.104151 0.012136 0.000008 0.327862 0.068174 0.998 2 length{all}[10] 0.094401 0.008019 0.001902 0.265638 0.066433 0.999 2 length{all}[11] 0.096389 0.009721 0.000124 0.284367 0.065218 0.998 2 length{all}[12] 0.090954 0.008345 0.000206 0.280162 0.063523 1.005 2 length{all}[13] 0.100250 0.008645 0.000118 0.274985 0.075196 0.998 2 length{all}[14] 0.096906 0.008809 0.000399 0.275386 0.064792 0.998 2 length{all}[15] 0.101528 0.010266 0.000408 0.316049 0.071596 0.999 2 length{all}[16] 0.104557 0.012467 0.000242 0.323630 0.069147 1.006 2 length{all}[17] 0.102806 0.010680 0.000067 0.292153 0.068857 0.999 2 length{all}[18] 0.100845 0.011482 0.000331 0.330763 0.069287 1.002 2 length{all}[19] 0.104877 0.009264 0.000113 0.309059 0.079625 1.009 2 length{all}[20] 0.094157 0.008997 0.000174 0.309590 0.066982 1.006 2 length{all}[21] 0.108475 0.010646 0.000381 0.320936 0.076073 1.001 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.009704 Maximum standard deviation of split frequencies = 0.020257 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.001 Maximum PSRF for parameter values = 1.009 Clade credibility values: /------------------------------------------------------------------------ C1 (1) | |------------------------------------------------------------------------ C2 (2) | |------------------------------------------------------------------------ C3 (3) + |------------------------------------------------------------------------ C4 (4) | |------------------------------------------------------------------------ C5 (5) | \------------------------------------------------------------------------ C6 (6) Phylogram (based on average branch lengths): /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | |------------------------------------------------------------------------ C3 (3) + |---------------------------------------------------------------------- C4 (4) | |------------------------------------------------------------------------ C5 (5) | \---------------------------------------------------------------------- C6 (6) |---------| 0.010 expected changes per site Calculating tree probabilities... Credible sets of trees (105 trees sampled): 50 % credible set contains 46 trees 90 % credible set contains 91 trees 95 % credible set contains 98 trees 99 % credible set contains 104 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.9h, March 2018 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8 seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 1053 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Sequences read.. Counting site patterns.. 0:00 Compressing, 51 patterns at 351 / 351 sites (100.0%), 0:00 Collecting fpatt[] & pose[], 51 patterns at 351 / 351 sites (100.0%), 0:00 Counting codons.. 120 bytes for distance 49776 bytes for conP 4488 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.082622 0.108727 0.105771 0.101344 0.068343 0.078227 0.300000 1.300000 ntime & nrate & np: 6 2 8 Bounds (np=8): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 8 lnL0 = -1558.301575 Iterating by ming2 Initial: fx= 1558.301575 x= 0.08262 0.10873 0.10577 0.10134 0.06834 0.07823 0.30000 1.30000 1 h-m-p 0.0000 0.0002 835.7655 +++ 1418.087742 m 0.0002 14 | 1/8 2 h-m-p 0.0011 0.0053 81.2985 -----------.. | 1/8 3 h-m-p 0.0000 0.0000 772.3634 ++ 1400.830229 m 0.0000 45 | 2/8 4 h-m-p 0.0004 0.0198 53.3163 ----------.. | 2/8 5 h-m-p 0.0000 0.0000 691.5655 ++ 1394.677457 m 0.0000 75 | 3/8 6 h-m-p 0.0002 0.0301 42.3258 ----------.. | 3/8 7 h-m-p 0.0000 0.0001 598.7643 ++ 1374.926761 m 0.0001 105 | 4/8 8 h-m-p 0.0009 0.0423 31.5034 -----------.. | 4/8 9 h-m-p 0.0000 0.0000 490.4683 ++ 1371.795091 m 0.0000 136 | 5/8 10 h-m-p 0.0002 0.0626 21.1664 ----------.. | 5/8 11 h-m-p 0.0000 0.0000 347.0103 ++ 1370.747590 m 0.0000 166 | 6/8 12 h-m-p 0.0160 8.0000 0.0000 Y 1370.747590 0 0.0160 177 | 6/8 13 h-m-p 1.6000 8.0000 0.0000 -Y 1370.747590 0 0.1000 191 Out.. lnL = -1370.747590 192 lfun, 192 eigenQcodon, 1152 P(t) Time used: 0:00 Model 1: NearlyNeutral TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.102399 0.083754 0.039087 0.103945 0.105437 0.026944 0.299840 0.636718 0.340149 ntime & nrate & np: 6 2 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 10.003191 np = 9 lnL0 = -1524.262990 Iterating by ming2 Initial: fx= 1524.262990 x= 0.10240 0.08375 0.03909 0.10395 0.10544 0.02694 0.29984 0.63672 0.34015 1 h-m-p 0.0000 0.0001 789.2437 ++ 1472.209193 m 0.0001 14 | 1/9 2 h-m-p 0.0000 0.0001 581.9952 ++ 1451.880068 m 0.0001 26 | 2/9 3 h-m-p 0.0000 0.0002 764.8241 ++ 1395.184024 m 0.0002 38 | 3/9 4 h-m-p 0.0001 0.0005 253.5234 ++ 1372.295705 m 0.0005 50 | 4/9 5 h-m-p 0.0000 0.0000 1311.5990 ++ 1371.242903 m 0.0000 62 | 5/9 6 h-m-p 0.0000 0.0000 605099.6573 ++ 1370.747490 m 0.0000 74 | 6/9 7 h-m-p 1.6000 8.0000 0.0002 ++ 1370.747489 m 8.0000 86 | 6/9 8 h-m-p 0.0140 7.0088 0.1463 -------------.. | 6/9 9 h-m-p 0.0160 8.0000 0.0003 +++++ 1370.747489 m 8.0000 130 | 6/9 10 h-m-p 0.0092 3.7848 0.2649 ----------Y 1370.747489 0 0.0000 155 | 6/9 11 h-m-p 0.0105 5.2354 0.0316 +++++ 1370.747417 m 5.2354 173 | 7/9 12 h-m-p 0.4760 3.6262 0.2907 ----------------.. | 7/9 13 h-m-p 0.0160 8.0000 0.0005 +++++ 1370.747415 m 8.0000 219 | 7/9 14 h-m-p 0.0133 3.0882 0.2985 ---------Y 1370.747415 0 0.0000 242 | 7/9 15 h-m-p 0.0160 8.0000 0.0036 +++++ 1370.747401 m 8.0000 259 | 7/9 16 h-m-p 0.0961 2.8097 0.3032 --------------.. | 7/9 17 h-m-p 0.0160 8.0000 0.0006 +++++ 1370.747398 m 8.0000 302 | 7/9 18 h-m-p 0.0155 3.3394 0.2856 ----------Y 1370.747398 0 0.0000 326 | 7/9 19 h-m-p 0.0160 8.0000 0.0018 +++++ 1370.747391 m 8.0000 343 | 7/9 20 h-m-p 0.0480 2.9103 0.2971 -----------N 1370.747391 0 0.0000 368 | 7/9 21 h-m-p 0.0160 8.0000 0.0027 +++++ 1370.747379 m 8.0000 385 | 7/9 22 h-m-p 0.0760 3.1239 0.2835 ------------C 1370.747379 0 0.0000 411 | 7/9 23 h-m-p 0.0160 8.0000 0.0000 +++++ 1370.747379 m 8.0000 428 | 7/9 24 h-m-p 0.0079 3.9664 0.2915 ------------Y 1370.747379 0 0.0000 454 | 7/9 25 h-m-p 0.0160 8.0000 0.0002 --------Y 1370.747379 0 0.0000 476 | 7/9 26 h-m-p 0.0160 8.0000 0.0000 +++++ 1370.747379 m 8.0000 493 | 7/9 27 h-m-p 0.0066 3.2877 0.2699 ------------.. | 7/9 28 h-m-p 0.0160 8.0000 0.0006 +++++ 1370.747376 m 8.0000 534 | 7/9 29 h-m-p 0.0190 3.6926 0.2689 -------------.. | 7/9 30 h-m-p 0.0160 8.0000 0.0007 +++++ 1370.747372 m 8.0000 576 | 7/9 31 h-m-p 0.0195 3.7316 0.2672 ----------Y 1370.747372 0 0.0000 600 | 7/9 32 h-m-p 0.0160 8.0000 0.0022 +++++ 1370.747362 m 8.0000 617 | 7/9 33 h-m-p 0.0625 3.3070 0.2768 -----------Y 1370.747362 0 0.0000 642 | 7/9 34 h-m-p 0.0160 8.0000 0.0004 +++++ 1370.747360 m 8.0000 659 | 7/9 35 h-m-p 0.0111 3.3567 0.2742 -------------.. | 7/9 36 h-m-p 0.0160 8.0000 0.0007 +++++ 1370.747356 m 8.0000 701 | 7/9 37 h-m-p 0.0222 3.9817 0.2563 -------------.. | 7/9 38 h-m-p 0.0160 8.0000 0.0007 +++++ 1370.747352 m 8.0000 743 | 7/9 39 h-m-p 0.0229 4.0310 0.2543 -------------.. | 7/9 40 h-m-p 0.0160 8.0000 0.0007 +++++ 1370.747347 m 8.0000 785 | 7/9 41 h-m-p 0.0237 4.0888 0.2518 ----------C 1370.747347 0 0.0000 809 | 7/9 42 h-m-p 0.0160 8.0000 0.0004 +++++ 1370.747347 m 8.0000 826 | 7/9 43 h-m-p 0.0067 0.4144 0.5227 -----------Y 1370.747347 0 0.0000 851 | 7/9 44 h-m-p 0.0160 8.0000 0.0001 --------Y 1370.747347 0 0.0000 873 | 7/9 45 h-m-p 0.0000 0.0248 2.7573 +++++ 1370.747297 m 0.0248 890 | 8/9 46 h-m-p 0.1812 3.1420 0.0572 +++ 1370.747218 m 3.1420 903 | 9/9 47 h-m-p 0.0160 8.0000 0.0000 Y 1370.747218 0 0.0160 916 Out.. lnL = -1370.747218 917 lfun, 2751 eigenQcodon, 11004 P(t) Time used: 0:03 Model 2: PositiveSelection TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.078459 0.030396 0.049058 0.109114 0.037990 0.037911 0.000100 1.477693 0.402516 0.456301 1.413932 ntime & nrate & np: 6 3 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 10.115654 np = 11 lnL0 = -1485.516346 Iterating by ming2 Initial: fx= 1485.516346 x= 0.07846 0.03040 0.04906 0.10911 0.03799 0.03791 0.00011 1.47769 0.40252 0.45630 1.41393 1 h-m-p 0.0000 0.0000 799.8369 ++ 1484.171148 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0004 411.3954 +++ 1423.729335 m 0.0004 31 | 2/11 3 h-m-p 0.0000 0.0000 734.0946 ++ 1412.654445 m 0.0000 45 | 3/11 4 h-m-p 0.0000 0.0000 222.6624 ++ 1412.465583 m 0.0000 59 | 4/11 5 h-m-p 0.0000 0.0000 1688.2598 ++ 1392.695898 m 0.0000 73 | 5/11 6 h-m-p 0.0001 0.0004 372.4037 ++ 1378.204534 m 0.0004 87 | 6/11 7 h-m-p 0.0000 0.0000 25331.3168 ++ 1372.172721 m 0.0000 101 | 7/11 8 h-m-p 0.0052 0.7717 4.6668 ------------.. | 7/11 9 h-m-p 0.0000 0.0000 340.4913 ++ 1370.747465 m 0.0000 139 | 8/11 10 h-m-p 0.0260 8.0000 0.0000 +++++ 1370.747465 m 8.0000 156 | 8/11 11 h-m-p 0.0219 8.0000 0.0031 +++++ 1370.747465 m 8.0000 176 | 8/11 12 h-m-p 0.0222 8.0000 1.1063 ---------Y 1370.747465 0 0.0000 202 | 8/11 13 h-m-p 0.0160 8.0000 0.0000 +++++ 1370.747465 m 8.0000 219 | 8/11 14 h-m-p 0.0160 8.0000 0.0059 +++++ 1370.747464 m 8.0000 239 | 8/11 15 h-m-p 0.1308 8.0000 0.3587 ----------C 1370.747464 0 0.0000 266 | 8/11 16 h-m-p 0.0160 8.0000 0.0000 +++++ 1370.747464 m 8.0000 286 | 8/11 17 h-m-p 0.0160 8.0000 0.1940 --------C 1370.747464 0 0.0000 311 | 8/11 18 h-m-p 0.0160 8.0000 0.0000 N 1370.747464 0 0.0040 328 | 8/11 19 h-m-p 0.0160 8.0000 0.0003 +++++ 1370.747464 m 8.0000 348 | 8/11 20 h-m-p 0.0160 8.0000 0.3584 ----------Y 1370.747464 0 0.0000 375 | 8/11 21 h-m-p 0.0160 8.0000 0.0000 --N 1370.747464 0 0.0003 394 | 8/11 22 h-m-p 0.0160 8.0000 0.0000 --N 1370.747464 0 0.0003 413 Out.. lnL = -1370.747464 414 lfun, 1656 eigenQcodon, 7452 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1370.768352 S = -1370.743762 -0.009441 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:05 did 20 / 51 patterns 0:05 did 30 / 51 patterns 0:05 did 40 / 51 patterns 0:05 did 50 / 51 patterns 0:05 did 51 / 51 patterns 0:05 Time used: 0:05 Model 7: beta TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.109669 0.034199 0.093030 0.029185 0.085005 0.101707 0.000100 1.095344 1.544765 ntime & nrate & np: 6 1 9 Bounds (np=9): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 13.747185 np = 9 lnL0 = -1519.526472 Iterating by ming2 Initial: fx= 1519.526472 x= 0.10967 0.03420 0.09303 0.02918 0.08500 0.10171 0.00011 1.09534 1.54477 1 h-m-p 0.0000 0.0000 776.9962 ++ 1518.991638 m 0.0000 14 | 1/9 2 h-m-p 0.0000 0.0084 94.6338 +++++ 1460.701300 m 0.0084 29 | 2/9 3 h-m-p 0.0000 0.0000 943.8443 ++ 1458.633813 m 0.0000 41 | 3/9 4 h-m-p 0.0000 0.0000 53099.6616 ++ 1449.885727 m 0.0000 53 | 4/9 5 h-m-p 0.0001 0.0005 137.6574 ++ 1414.393839 m 0.0005 65 | 5/9 6 h-m-p 0.0048 0.0239 3.3471 ------------.. | 5/9 7 h-m-p 0.0000 0.0001 550.2092 ++ 1393.440645 m 0.0001 99 | 6/9 8 h-m-p 0.0188 8.0000 1.6206 -------------.. | 6/9 9 h-m-p 0.0000 0.0001 453.6815 ++ 1378.050364 m 0.0001 134 | 7/9 10 h-m-p 0.0227 8.0000 1.0356 -------------.. | 7/9 11 h-m-p 0.0000 0.0001 324.7301 ++ 1370.747218 m 0.0001 169 | 8/9 12 h-m-p 1.6000 8.0000 0.0000 Y 1370.747218 0 1.6000 181 | 8/9 13 h-m-p 0.0160 8.0000 0.0000 N 1370.747218 0 0.0160 194 Out.. lnL = -1370.747218 195 lfun, 2145 eigenQcodon, 11700 P(t) Time used: 0:08 Model 8: beta&w>1 TREE # 1 (1, 2, 3, 4, 5, 6); MP score: 0 0.049077 0.097554 0.010274 0.055419 0.039658 0.026463 0.000100 0.900000 0.263149 1.671863 1.299779 ntime & nrate & np: 6 2 11 Bounds (np=11): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 17.133044 np = 11 lnL0 = -1459.132316 Iterating by ming2 Initial: fx= 1459.132316 x= 0.04908 0.09755 0.01027 0.05542 0.03966 0.02646 0.00011 0.90000 0.26315 1.67186 1.29978 1 h-m-p 0.0000 0.0000 736.5915 ++ 1458.559685 m 0.0000 16 | 1/11 2 h-m-p 0.0000 0.0003 283.7436 +++ 1440.142001 m 0.0003 31 | 2/11 3 h-m-p 0.0000 0.0002 306.1489 ++ 1412.925028 m 0.0002 45 | 3/11 4 h-m-p 0.0002 0.0010 155.9350 ++ 1399.101963 m 0.0010 59 | 4/11 5 h-m-p 0.0000 0.0000 32793.8621 ++ 1392.716557 m 0.0000 73 | 5/11 6 h-m-p 0.0001 0.0004 140.0796 ++ 1382.604212 m 0.0004 87 | 6/11 7 h-m-p 0.0000 0.0002 109.6912 ++ 1380.323926 m 0.0002 101 | 7/11 8 h-m-p 0.0011 0.0489 12.2672 -----------.. | 7/11 9 h-m-p 0.0000 0.0001 326.6686 ++ 1370.747416 m 0.0001 138 | 8/11 10 h-m-p 1.0151 8.0000 0.0001 ++ 1370.747416 m 8.0000 152 | 8/11 11 h-m-p 0.0160 8.0000 0.3174 ----------Y 1370.747416 0 0.0000 179 | 8/11 12 h-m-p 0.0160 8.0000 0.0000 +++++ 1370.747416 m 8.0000 199 | 8/11 13 h-m-p 0.0160 8.0000 4.5173 -----------Y 1370.747416 0 0.0000 227 | 8/11 14 h-m-p 0.0160 8.0000 0.0000 -----N 1370.747416 0 0.0000 246 | 8/11 15 h-m-p 0.0160 8.0000 0.0000 -N 1370.747416 0 0.0010 264 Out.. lnL = -1370.747416 265 lfun, 3180 eigenQcodon, 17490 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal likelihood. log(fX) = -1370.782896 S = -1370.744643 -0.016902 Calculating f(w|X), posterior probabilities of site classes. did 10 / 51 patterns 0:12 did 20 / 51 patterns 0:13 did 30 / 51 patterns 0:13 did 40 / 51 patterns 0:13 did 50 / 51 patterns 0:13 did 51 / 51 patterns 0:13 Time used: 0:13 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=351 NC_011896_1_WP_010907979_1_907_MLBR_RS04270 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP NC_002677_1_NP_301655_1_527_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP NZ_CP029543_1_WP_010907979_1_925_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP NZ_AP014567_1_WP_010907979_1_942_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI NC_002677_1_NP_301655_1_527_cobT RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI NZ_CP029543_1_WP_010907979_1_925_cobT RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI NZ_AP014567_1_WP_010907979_1_942_cobT RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA NC_002677_1_NP_301655_1_527_cobT ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA NZ_CP029543_1_WP_010907979_1_925_cobT ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA NZ_AP014567_1_WP_010907979_1_942_cobT ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG NC_002677_1_NP_301655_1_527_cobT GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG NZ_CP029543_1_WP_010907979_1_925_cobT GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG NZ_AP014567_1_WP_010907979_1_942_cobT GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA NC_002677_1_NP_301655_1_527_cobT IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA NZ_CP029543_1_WP_010907979_1_925_cobT IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA NZ_AP014567_1_WP_010907979_1_942_cobT IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD NC_002677_1_NP_301655_1_527_cobT VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD NZ_CP029543_1_WP_010907979_1_925_cobT VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD NZ_AP014567_1_WP_010907979_1_942_cobT VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP NC_002677_1_NP_301655_1_527_cobT LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP NZ_CP029543_1_WP_010907979_1_925_cobT LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP NZ_AP014567_1_WP_010907979_1_942_cobT LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP ************************************************** NC_011896_1_WP_010907979_1_907_MLBR_RS04270 S NC_002677_1_NP_301655_1_527_cobT S NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 S NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 S NZ_CP029543_1_WP_010907979_1_925_cobT S NZ_AP014567_1_WP_010907979_1_942_cobT S *
>NC_011896_1_WP_010907979_1_907_MLBR_RS04270 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >NC_002677_1_NP_301655_1_527_cobT ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >NZ_CP029543_1_WP_010907979_1_925_cobT ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG >NZ_AP014567_1_WP_010907979_1_942_cobT ATGGAGTTCGCGCCAGTGTCGCCGCCCGACGGCCACGCCGCAGCAGCTGC CCGCGCTCGCCAGGACACCCTGACCAAGCCGCGCGGCGCGTTGGGCCGTC TCGAAGATTTGTCGATCTGGGTGGCGTCGTGCCAGGGACAGTGTCCGCCA CGCCAGTTCCAGCGTGCTCGGATAGTAGTGTTCGCCGGTGACCACGGTGT CGCCCGGTCCGGGGTGTCGGCATACCCACCGCAATTGACCGCTCAGATGG TAGCTAACATCGACCGCGGCGGGGCGGCAATCAACGCACTAGCGAGTATC GCCGACGCGACGATACGAATCGCGGATTTAGCTGTCGACGCAGACCCATT GTCGCAGCAGATCGGCATCCATAAAGTGCGACGCGGCAGTGGCGATATCG CGATCCAGGACGCGTTAACCGAAGACGAGACTGCCCGAGCGATCATAGCC GGTCAACGCATCGCCGATGAGGAAGTCGACCGCGGTGCTGACCTGTTAAT CGCCGGCGACATCGGAATTGGAAACACCACCGCAGCGGCGGTTTTGGTGG CGGCGTTGACGAACGCCGAACCAGTCGCCGTAGTGGGCTTCGGAACCGGG ATCGATGACGCCAGTTGGGCACGCAAAACGGCTGCGGTGCGCGATGCCTT ATGTCGGATACGGCTGGTGTTGCCCGATCCGGTCGGGTTGCTGCGCTGCT GCGGCGGCGCCGACCTGGCCGCTATGGCGGGCTTCTGTGCGCAAGCAGCG GTACGACGTACCCCGTTGCTACTCGACGGCATGGTGGTGACGGCGGCCGC ACTGGTCGCCGAGCGCCTGGCACCGGGTTCCTGGCAATGGTGGCAGGCCG GTCATCAGTCAACCGAACCGGGTCATGCCCTGGCTTTGGCAGCTTTGGAC TTGGATCCGATTCTGGACCTGCGGATGCGGCTGGGCGAAGGAACCGGTGC TACGGCAGCGTTACTGGTGCTGCGCGCCGCAGTAGCCGCGTTGACGTCAA TGACGACCTTCGCAGAGGCTGGTGTGGCCGGTACGTCGACCTCGCCACCA TCG
>NC_011896_1_WP_010907979_1_907_MLBR_RS04270 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >NC_002677_1_NP_301655_1_527_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >NZ_CP029543_1_WP_010907979_1_925_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S >NZ_AP014567_1_WP_010907979_1_942_cobT MEFAPVSPPDGHAAAAARARQDTLTKPRGALGRLEDLSIWVASCQGQCPP RQFQRARIVVFAGDHGVARSGVSAYPPQLTAQMVANIDRGGAAINALASI ADATIRIADLAVDADPLSQQIGIHKVRRGSGDIAIQDALTEDETARAIIA GQRIADEEVDRGADLLIAGDIGIGNTTAAAVLVAALTNAEPVAVVGFGTG IDDASWARKTAAVRDALCRIRLVLPDPVGLLRCCGGADLAAMAGFCAQAA VRRTPLLLDGMVVTAAALVAERLAPGSWQWWQAGHQSTEPGHALALAALD LDPILDLRMRLGEGTGATAALLVLRAAVAALTSMTTFAEAGVAGTSTSPP S
#NEXUS [ID: 8977532113] begin taxa; dimensions ntax=6; taxlabels NC_011896_1_WP_010907979_1_907_MLBR_RS04270 NC_002677_1_NP_301655_1_527_cobT NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 NZ_CP029543_1_WP_010907979_1_925_cobT NZ_AP014567_1_WP_010907979_1_942_cobT ; end; begin trees; translate 1 NC_011896_1_WP_010907979_1_907_MLBR_RS04270, 2 NC_002677_1_NP_301655_1_527_cobT, 3 NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200, 4 NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830, 5 NZ_CP029543_1_WP_010907979_1_925_cobT, 6 NZ_AP014567_1_WP_010907979_1_942_cobT ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.06869325,2:0.0694051,3:0.07068396,4:0.06881418,5:0.07107305,6:0.06916938); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.06869325,2:0.0694051,3:0.07068396,4:0.06881418,5:0.07107305,6:0.06916938); end;
Estimated marginal likelihoods for runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -1412.61 -1416.05 2 -1412.63 -1415.45 -------------------------------------- TOTAL -1412.62 -1415.79 -------------------------------------- Model parameter summaries over the runs sampled in files "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/data/1res/cobT/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.891890 0.088934 0.377789 1.501303 0.855647 1299.25 1400.12 1.000 r(A<->C){all} 0.168538 0.019314 0.000047 0.448896 0.134764 175.29 191.04 1.001 r(A<->G){all} 0.161451 0.019034 0.000017 0.443057 0.126665 246.75 272.44 1.000 r(A<->T){all} 0.174918 0.021568 0.000166 0.475103 0.135909 115.91 168.54 1.000 r(C<->G){all} 0.167757 0.018430 0.000005 0.437410 0.136424 259.34 316.85 1.002 r(C<->T){all} 0.161345 0.018293 0.000140 0.435765 0.126625 222.28 271.95 1.000 r(G<->T){all} 0.165990 0.018943 0.000076 0.443619 0.132000 241.83 266.77 1.000 pi(A){all} 0.172726 0.000136 0.151693 0.196988 0.172161 1112.19 1236.40 1.000 pi(C){all} 0.306531 0.000190 0.279415 0.332588 0.306559 1197.76 1252.92 1.000 pi(G){all} 0.342898 0.000209 0.315749 0.371470 0.342793 1060.45 1280.73 1.000 pi(T){all} 0.177845 0.000138 0.154914 0.200253 0.177724 1373.62 1399.01 1.000 alpha{1,2} 0.443111 0.245939 0.000261 1.431847 0.264457 998.04 1135.57 1.000 alpha{3} 0.455976 0.232927 0.000133 1.417494 0.294483 1180.73 1241.25 1.000 pinvar{all} 0.998569 0.000003 0.995557 0.999999 0.999062 1171.63 1218.78 1.003 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/cobT/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio, Codon frequency model: F3x4 Site-class models: ns = 6 ls = 351 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 3 3 3 3 3 3 TTC 6 6 6 6 6 6 | TCC 2 2 2 2 2 2 | TAC 1 1 1 1 1 1 | TGC 3 3 3 3 3 3 Leu TTA 5 5 5 5 5 5 | TCA 2 2 2 2 2 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 13 13 13 13 13 13 | TCG 8 8 8 8 8 8 | TAG 0 0 0 0 0 0 | Trp TGG 5 5 5 5 5 5 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 3 3 3 3 3 3 | Arg CGT 3 3 3 3 3 3 CTC 2 2 2 2 2 2 | CCC 2 2 2 2 2 2 | CAC 2 2 2 2 2 2 | CGC 13 13 13 13 13 13 CTA 2 2 2 2 2 2 | CCA 7 7 7 7 7 7 | Gln CAA 4 4 4 4 4 4 | CGA 4 4 4 4 4 4 CTG 13 13 13 13 13 13 | CCG 9 9 9 9 9 9 | CAG 11 11 11 11 11 11 | CGG 6 6 6 6 6 6 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 3 3 3 3 3 3 ATC 14 14 14 14 14 14 | ACC 12 12 12 12 12 12 | AAC 4 4 4 4 4 4 | AGC 0 0 0 0 0 0 ATA 4 4 4 4 4 4 | ACA 0 0 0 0 0 0 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0 Met ATG 6 6 6 6 6 6 | ACG 8 8 8 8 8 8 | AAG 1 1 1 1 1 1 | AGG 0 0 0 0 0 0 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 1 1 1 1 1 1 | Ala GCT 13 13 13 13 13 13 | Asp GAT 8 8 8 8 8 8 | Gly GGT 10 10 10 10 10 10 GTC 6 6 6 6 6 6 | GCC 22 22 22 22 22 22 | GAC 17 17 17 17 17 17 | GGC 14 14 14 14 14 14 GTA 5 5 5 5 5 5 | GCA 15 15 15 15 15 15 | Glu GAA 6 6 6 6 6 6 | GGA 5 5 5 5 5 5 GTG 13 13 13 13 13 13 | GCG 21 21 21 21 21 21 | GAG 5 5 5 5 5 5 | GGG 4 4 4 4 4 4 -------------------------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: NC_011896_1_WP_010907979_1_907_MLBR_RS04270 position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 #2: NC_002677_1_NP_301655_1_527_cobT position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 #3: NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200 position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 #4: NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830 position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 #5: NZ_CP029543_1_WP_010907979_1_925_cobT position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 #6: NZ_AP014567_1_WP_010907979_1_942_cobT position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 18 TTC 36 | TCC 12 | TAC 6 | TGC 18 Leu L TTA 30 | TCA 12 | *** * TAA 0 | *** * TGA 0 TTG 78 | TCG 48 | TAG 0 | Trp W TGG 30 ------------------------------------------------------------------------------ Leu L CTT 0 | Pro P CCT 0 | His H CAT 18 | Arg R CGT 18 CTC 12 | CCC 12 | CAC 12 | CGC 78 CTA 12 | CCA 42 | Gln Q CAA 24 | CGA 24 CTG 78 | CCG 54 | CAG 66 | CGG 36 ------------------------------------------------------------------------------ Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 18 ATC 84 | ACC 72 | AAC 24 | AGC 0 ATA 24 | ACA 0 | Lys K AAA 12 | Arg R AGA 0 Met M ATG 36 | ACG 48 | AAG 6 | AGG 0 ------------------------------------------------------------------------------ Val V GTT 6 | Ala A GCT 78 | Asp D GAT 48 | Gly G GGT 60 GTC 36 | GCC 132 | GAC 102 | GGC 84 GTA 30 | GCA 90 | Glu E GAA 36 | GGA 30 GTG 78 | GCG 126 | GAG 30 | GGG 24 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.13675 C:0.23077 A:0.16239 G:0.47009 position 2: T:0.26211 C:0.34758 A:0.18234 G:0.20798 position 3: T:0.13390 C:0.34188 A:0.17379 G:0.35043 Average T:0.17759 C:0.30674 A:0.17284 G:0.34283 Model 0: one-ratio TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 8): -1370.747590 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299840 1.299779 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907979_1_907_MLBR_RS04270: 0.000004, NC_002677_1_NP_301655_1_527_cobT: 0.000004, NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200: 0.000004, NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830: 0.000004, NZ_CP029543_1_WP_010907979_1_925_cobT: 0.000004, NZ_AP014567_1_WP_010907979_1_942_cobT: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.29984 omega (dN/dS) = 1.29978 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 7..2 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 7..3 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 7..4 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 7..5 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 7..6 0.000 738.0 315.0 1.2998 0.0000 0.0000 0.0 0.0 tree length for dN: 0.0000 tree length for dS: 0.0000 Time used: 0:00 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1370.747218 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907979_1_907_MLBR_RS04270: 0.000004, NC_002677_1_NP_301655_1_527_cobT: 0.000004, NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200: 0.000004, NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830: 0.000004, NZ_CP029543_1_WP_010907979_1_925_cobT: 0.000004, NZ_AP014567_1_WP_010907979_1_942_cobT: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=2) p: 0.99999 0.00001 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:03 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1370.747464 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.646675 0.206621 0.000001 1.431743 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907979_1_907_MLBR_RS04270: 0.000004, NC_002677_1_NP_301655_1_527_cobT: 0.000004, NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200: 0.000004, NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830: 0.000004, NZ_CP029543_1_WP_010907979_1_925_cobT: 0.000004, NZ_AP014567_1_WP_010907979_1_942_cobT: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 MLEs of dN/dS (w) for site classes (K=3) p: 0.64668 0.20662 0.14670 w: 0.00000 1.00000 1.43174 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 7..2 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 7..3 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 7..4 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 7..5 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 7..6 0.000 741.1 311.9 0.4167 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907979_1_907_MLBR_RS04270) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907979_1_907_MLBR_RS04270) Pr(w>1) post mean +- SE for w The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 w2: 0.102 0.101 0.101 0.100 0.100 0.100 0.099 0.099 0.099 0.099 Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1) 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 sum of density on p0-p1 = 1.000000 Time used: 0:05 Model 7: beta (10 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 9): -1370.747218 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.674468 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907979_1_907_MLBR_RS04270: 0.000004, NC_002677_1_NP_301655_1_527_cobT: 0.000004, NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200: 0.000004, NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830: 0.000004, NZ_CP029543_1_WP_010907979_1_925_cobT: 0.000004, NZ_AP014567_1_WP_010907979_1_942_cobT: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M7 (beta): p = 0.00500 q = 1.67447 MLEs of dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..2 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..3 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..4 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..5 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 7..6 0.000 741.1 311.9 0.0000 0.0000 0.0000 0.0 0.0 Time used: 0:08 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0 lnL(ntime: 6 np: 11): -1370.747416 +0.000000 7..1 7..2 7..3 7..4 7..5 7..6 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.808034 0.005000 1.700269 1.456651 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.000024 (1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004); (NC_011896_1_WP_010907979_1_907_MLBR_RS04270: 0.000004, NC_002677_1_NP_301655_1_527_cobT: 0.000004, NZ_LVXE01000007_1_WP_010907979_1_2561_A3216_RS04200: 0.000004, NZ_LYPH01000011_1_WP_010907979_1_383_A8144_RS01830: 0.000004, NZ_CP029543_1_WP_010907979_1_925_cobT: 0.000004, NZ_AP014567_1_WP_010907979_1_942_cobT: 0.000004); Detailed output identifying parameters kappa (ts/tv) = 0.00010 Parameters in M8 (beta&w>1): p0 = 0.80803 p = 0.00500 q = 1.70027 (p1 = 0.19197) w = 1.45665 MLEs of dN/dS (w) for site classes (K=11) p: 0.08080 0.08080 0.08080 0.08080 0.08080 0.08080 0.08080 0.08080 0.08080 0.08080 0.19197 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002 1.45665 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 7..1 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 7..2 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 7..3 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 7..4 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 7..5 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 7..6 0.000 741.1 311.9 0.2796 0.0000 0.0000 0.0 0.0 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907979_1_907_MLBR_RS04270) Pr(w>1) post mean +- SE for w Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: NC_011896_1_WP_010907979_1_907_MLBR_RS04270) Pr(w>1) post mean +- SE for w The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.097 0.098 0.098 0.099 0.100 0.100 0.101 0.102 0.102 0.103 p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 ws: 0.103 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.097 Time used: 0:13
Model 1: NearlyNeutral -1370.747218 Model 2: PositiveSelection -1370.747464 Model 0: one-ratio -1370.74759 Model 7: beta -1370.747218 Model 8: beta&w>1 -1370.747416 Model 0 vs 1 7.4399999994057E-4 Model 2 vs 1 4.920000001220615E-4 Model 8 vs 7 3.959999999096908E-4