--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:11:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cspA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -277.92 -280.87
2 -277.92 -281.19
--------------------------------------
TOTAL -277.92 -281.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886290 0.091671 0.367363 1.527304 0.849951 1330.19 1400.61 1.000
r(A<->C){all} 0.171482 0.020879 0.000060 0.443435 0.133224 137.58 247.18 1.000
r(A<->G){all} 0.170099 0.021387 0.000020 0.471578 0.129353 155.07 160.26 1.003
r(A<->T){all} 0.174474 0.021613 0.000002 0.467150 0.135024 186.45 203.57 1.002
r(C<->G){all} 0.157900 0.018490 0.000060 0.430618 0.119455 307.49 312.62 1.000
r(C<->T){all} 0.161085 0.019075 0.000036 0.434949 0.123345 180.85 218.43 1.000
r(G<->T){all} 0.164961 0.019867 0.000042 0.450440 0.123252 154.00 203.51 1.000
pi(A){all} 0.215695 0.000825 0.163431 0.271397 0.214772 868.63 1136.12 1.000
pi(C){all} 0.277008 0.000967 0.218965 0.339891 0.275526 1162.25 1166.39 1.000
pi(G){all} 0.296982 0.001013 0.239065 0.361990 0.296544 1075.73 1135.08 1.000
pi(T){all} 0.210315 0.000797 0.157455 0.263733 0.209736 1447.53 1463.73 1.000
alpha{1,2} 0.413733 0.230972 0.000154 1.349037 0.246623 1067.75 1088.14 1.001
alpha{3} 0.463617 0.230946 0.000107 1.426167 0.308358 1030.13 1150.39 1.000
pinvar{all} 0.991693 0.000102 0.972132 0.999998 0.995013 971.68 1047.88 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -262.868056
Model 2: PositiveSelection -262.868044
Model 0: one-ratio -262.868244
Model 7: beta -262.868044
Model 8: beta&w>1 -262.868044
Model 0 vs 1 3.7599999996018596E-4
Model 2 vs 1 2.4000000053092663E-5
Model 8 vs 7 0.0
>C1
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C2
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C3
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C4
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C5
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C6
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=67
C1 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C2 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C3 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C4 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C5 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C6 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
**************************************************
C1 EIGHSPKGPQATGVRSV
C2 EIGHSPKGPQATGVRSV
C3 EIGHSPKGPQATGVRSV
C4 EIGHSPKGPQATGVRSV
C5 EIGHSPKGPQATGVRSV
C6 EIGHSPKGPQATGVRSV
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2010]--->[2010]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.445 Mb, Max= 30.585 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C2 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C3 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C4 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C5 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C6 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
**************************************************
C1 EIGHSPKGPQATGVRSV
C2 EIGHSPKGPQATGVRSV
C3 EIGHSPKGPQATGVRSV
C4 EIGHSPKGPQATGVRSV
C5 EIGHSPKGPQATGVRSV
C6 EIGHSPKGPQATGVRSV
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C2 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C3 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C4 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C5 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C6 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
**************************************************
C1 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C2 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C3 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C4 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C5 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C6 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
**************************************************
C1 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C2 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C3 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C4 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C5 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C6 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
**************************************************
C1 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C2 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C3 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C4 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C5 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C6 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
**************************************************
C1 C
C2 C
C3 C
C4 C
C5 C
C6 C
*
>C1
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C2
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C3
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C4
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C5
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C6
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C1
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C2
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C3
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C4
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C5
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C6
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 201 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774190
Setting output file names to "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1728906157
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8786924235
Seed = 1885230589
Swapseed = 1579774190
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -449.847636 -- -24.965149
Chain 2 -- -449.847636 -- -24.965149
Chain 3 -- -449.847636 -- -24.965149
Chain 4 -- -449.847636 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -449.847636 -- -24.965149
Chain 2 -- -449.847610 -- -24.965149
Chain 3 -- -449.847636 -- -24.965149
Chain 4 -- -449.847636 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-449.848] (-449.848) (-449.848) (-449.848) * [-449.848] (-449.848) (-449.848) (-449.848)
500 -- (-281.818) [-282.298] (-288.557) (-290.356) * (-286.350) [-285.412] (-288.168) (-291.125) -- 0:00:00
1000 -- (-285.000) (-284.431) [-283.701] (-288.376) * (-286.763) [-288.842] (-284.976) (-292.827) -- 0:00:00
1500 -- (-284.046) [-286.861] (-294.438) (-288.048) * (-292.348) (-285.302) [-286.125] (-290.255) -- 0:00:00
2000 -- [-285.618] (-293.685) (-287.768) (-294.322) * (-279.990) (-288.109) (-298.207) [-290.386] -- 0:00:00
2500 -- (-292.347) [-288.959] (-284.093) (-287.449) * [-286.521] (-287.174) (-290.830) (-287.834) -- 0:00:00
3000 -- (-285.766) (-288.563) (-281.001) [-284.462] * (-285.802) (-287.775) (-290.601) [-294.278] -- 0:00:00
3500 -- (-285.272) (-288.053) [-282.039] (-289.297) * (-285.601) (-291.654) (-286.551) [-286.215] -- 0:00:00
4000 -- (-291.420) (-285.457) (-296.544) [-285.924] * [-287.899] (-287.301) (-294.639) (-290.531) -- 0:04:09
4500 -- [-294.985] (-283.036) (-290.143) (-287.314) * (-291.170) (-291.386) (-289.524) [-289.744] -- 0:03:41
5000 -- (-289.817) (-288.443) (-286.269) [-285.829] * (-289.142) (-283.699) [-290.916] (-285.491) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- (-285.977) (-289.590) (-286.221) [-287.347] * [-289.054] (-294.960) (-283.714) (-287.170) -- 0:03:00
6000 -- (-285.497) [-284.841] (-284.184) (-287.583) * (-288.685) [-283.585] (-295.016) (-291.935) -- 0:02:45
6500 -- (-289.049) (-290.121) (-287.471) [-285.420] * (-289.500) [-289.760] (-281.288) (-285.314) -- 0:02:32
7000 -- (-290.961) (-286.555) [-286.710] (-286.428) * (-284.753) (-291.174) (-291.687) [-291.134] -- 0:02:21
7500 -- (-287.979) (-286.092) [-289.802] (-289.189) * (-283.713) (-284.717) (-293.231) [-292.260] -- 0:02:12
8000 -- (-287.424) [-293.653] (-283.604) (-286.175) * [-289.796] (-284.329) (-285.761) (-282.101) -- 0:02:04
8500 -- (-287.443) (-290.114) [-284.605] (-284.542) * (-287.935) (-289.142) (-288.004) [-285.816] -- 0:01:56
9000 -- (-282.561) [-282.648] (-282.203) (-284.151) * (-299.175) (-286.076) [-284.236] (-294.084) -- 0:01:50
9500 -- (-285.412) (-285.744) (-285.704) [-282.931] * (-296.943) (-288.174) [-286.781] (-285.335) -- 0:01:44
10000 -- [-286.393] (-286.469) (-298.014) (-293.946) * (-290.751) (-286.602) [-288.846] (-293.280) -- 0:01:39
Average standard deviation of split frequencies: 0.062802
10500 -- (-286.202) (-294.927) (-284.929) [-289.025] * [-281.222] (-288.283) (-289.640) (-287.545) -- 0:01:34
11000 -- (-287.226) (-291.223) [-285.567] (-292.466) * (-278.080) (-292.000) [-282.360] (-289.386) -- 0:01:29
11500 -- (-285.662) (-284.322) (-285.124) [-291.711] * (-278.532) [-291.609] (-293.003) (-283.397) -- 0:01:25
12000 -- [-279.193] (-281.899) (-293.823) (-291.440) * [-278.173] (-297.195) (-289.915) (-285.672) -- 0:01:22
12500 -- (-284.040) [-279.229] (-283.934) (-291.505) * [-281.076] (-293.142) (-291.214) (-279.604) -- 0:01:19
13000 -- (-286.316) (-278.494) (-280.197) [-291.941] * (-277.585) (-287.425) (-290.693) [-278.202] -- 0:01:15
13500 -- [-286.354] (-278.721) (-295.857) (-289.523) * (-279.641) (-288.237) [-282.274] (-279.294) -- 0:01:13
14000 -- [-285.177] (-279.148) (-299.081) (-287.994) * (-276.374) (-295.649) (-297.854) [-277.799] -- 0:01:10
14500 -- (-296.742) [-278.229] (-285.541) (-293.659) * (-278.351) (-284.320) [-292.298] (-278.263) -- 0:01:07
15000 -- (-298.767) (-276.460) (-284.111) [-284.748] * (-279.870) (-288.535) (-286.902) [-280.594] -- 0:01:05
Average standard deviation of split frequencies: 0.067591
15500 -- (-287.663) (-277.433) [-287.661] (-289.164) * (-278.121) (-287.868) [-283.218] (-276.855) -- 0:01:03
16000 -- (-293.651) [-277.139] (-285.960) (-287.106) * (-276.837) [-285.022] (-284.894) (-276.739) -- 0:01:01
16500 -- (-294.870) (-277.620) (-292.091) [-289.083] * (-279.662) (-292.873) [-289.085] (-281.674) -- 0:00:59
17000 -- [-286.594] (-276.788) (-284.723) (-290.250) * [-276.774] (-290.433) (-292.450) (-277.908) -- 0:00:57
17500 -- (-296.681) (-279.271) [-287.612] (-285.016) * (-277.014) (-299.003) (-291.982) [-277.267] -- 0:00:56
18000 -- (-289.544) [-280.671] (-289.784) (-290.326) * (-278.068) (-287.461) (-290.284) [-279.255] -- 0:00:54
18500 -- (-289.877) (-281.299) (-285.494) [-290.663] * (-279.691) [-294.038] (-285.027) (-278.305) -- 0:00:53
19000 -- (-289.350) (-280.922) [-281.555] (-281.004) * (-279.775) (-285.418) [-281.590] (-277.930) -- 0:00:51
19500 -- (-285.442) [-278.308] (-292.314) (-285.367) * [-278.010] (-281.143) (-288.966) (-278.058) -- 0:00:50
20000 -- [-285.555] (-278.331) (-289.016) (-290.221) * (-277.706) [-284.714] (-292.451) (-279.442) -- 0:00:49
Average standard deviation of split frequencies: 0.058292
20500 -- (-299.840) [-278.674] (-280.922) (-292.930) * (-278.155) (-282.898) (-287.832) [-277.500] -- 0:00:47
21000 -- (-291.994) [-280.191] (-284.195) (-292.401) * [-277.090] (-279.917) (-289.156) (-278.902) -- 0:01:33
21500 -- (-302.111) (-278.011) (-282.196) [-296.107] * (-276.895) [-278.937] (-291.535) (-278.870) -- 0:01:31
22000 -- (-288.631) [-277.800] (-287.371) (-281.828) * (-278.965) (-278.942) (-290.217) [-278.668] -- 0:01:28
22500 -- (-278.024) (-279.192) [-285.052] (-299.915) * (-283.561) [-280.620] (-290.163) (-276.815) -- 0:01:26
23000 -- [-277.518] (-279.131) (-282.966) (-285.427) * (-279.949) [-279.254] (-288.431) (-280.763) -- 0:01:24
23500 -- (-280.255) (-278.368) (-287.232) [-282.601] * (-278.374) [-278.899] (-296.587) (-277.458) -- 0:01:23
24000 -- [-281.377] (-278.169) (-293.880) (-282.890) * (-277.986) (-280.337) (-285.749) [-279.078] -- 0:01:21
24500 -- [-276.585] (-276.915) (-290.973) (-286.946) * (-277.423) [-279.157] (-293.432) (-277.592) -- 0:01:19
25000 -- (-277.002) (-277.806) (-286.814) [-278.346] * [-279.687] (-277.763) (-290.954) (-280.846) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- [-278.375] (-277.819) (-287.711) (-276.820) * (-278.770) (-278.413) [-298.876] (-279.362) -- 0:01:16
26000 -- [-278.401] (-278.824) (-289.780) (-277.847) * (-277.958) (-280.406) [-282.987] (-280.443) -- 0:01:14
26500 -- (-276.608) [-277.067] (-290.734) (-280.249) * (-278.029) (-278.966) (-288.617) [-284.546] -- 0:01:13
27000 -- [-279.569] (-279.380) (-292.694) (-278.750) * (-277.385) (-279.075) [-285.148] (-278.606) -- 0:01:12
27500 -- (-279.480) [-278.439] (-286.311) (-278.578) * (-277.556) [-279.917] (-291.565) (-277.217) -- 0:01:10
28000 -- (-280.063) (-280.164) [-287.221] (-277.486) * (-280.880) (-277.696) [-296.520] (-277.766) -- 0:01:09
28500 -- (-278.218) (-278.687) (-292.318) [-277.673] * (-278.461) (-280.007) [-288.808] (-278.463) -- 0:01:08
29000 -- (-277.647) (-278.144) (-279.801) [-277.712] * [-278.550] (-277.231) (-287.475) (-283.131) -- 0:01:06
29500 -- (-281.454) (-281.746) [-277.603] (-277.525) * (-279.092) (-282.306) (-294.282) [-279.920] -- 0:01:05
30000 -- [-276.604] (-277.465) (-278.901) (-276.920) * (-281.450) (-276.990) [-286.870] (-281.177) -- 0:01:04
Average standard deviation of split frequencies: 0.035355
30500 -- (-276.340) (-277.268) [-277.740] (-278.596) * (-278.789) [-277.585] (-291.786) (-277.303) -- 0:01:03
31000 -- (-276.900) (-277.688) [-278.723] (-277.834) * (-278.540) (-277.353) [-285.685] (-276.960) -- 0:01:02
31500 -- (-277.332) (-282.566) [-277.276] (-279.470) * (-281.100) (-277.948) (-294.474) [-277.753] -- 0:01:01
32000 -- (-279.616) (-280.164) (-277.873) [-278.710] * (-280.897) (-276.784) (-284.685) [-277.795] -- 0:01:00
32500 -- (-281.451) [-277.872] (-279.744) (-278.598) * (-280.165) (-279.937) (-289.940) [-277.676] -- 0:00:59
33000 -- [-278.314] (-282.854) (-282.251) (-279.656) * (-278.446) (-280.907) [-284.999] (-280.500) -- 0:00:58
33500 -- (-282.075) [-279.095] (-282.833) (-282.666) * (-279.479) [-277.947] (-291.416) (-277.751) -- 0:00:57
34000 -- [-278.234] (-283.077) (-282.125) (-280.807) * (-279.460) [-279.445] (-288.076) (-277.872) -- 0:00:56
34500 -- [-278.986] (-281.050) (-282.320) (-277.922) * (-277.994) [-279.974] (-286.774) (-278.634) -- 0:00:55
35000 -- (-277.724) (-276.582) (-277.755) [-279.315] * (-278.546) [-277.286] (-292.541) (-279.371) -- 0:00:55
Average standard deviation of split frequencies: 0.034295
35500 -- (-278.312) [-277.709] (-277.609) (-280.151) * [-278.425] (-277.041) (-288.908) (-288.642) -- 0:00:54
36000 -- [-277.979] (-278.530) (-278.303) (-278.992) * (-277.417) (-277.784) (-285.226) [-278.729] -- 0:00:53
36500 -- [-279.111] (-278.064) (-283.050) (-277.965) * [-277.953] (-278.769) (-297.241) (-279.090) -- 0:00:52
37000 -- [-276.361] (-279.131) (-281.343) (-281.979) * (-279.307) (-277.818) (-286.427) [-282.237] -- 0:00:52
37500 -- (-282.572) (-276.532) (-278.887) [-281.652] * (-277.101) (-277.003) [-278.862] (-283.901) -- 0:00:51
38000 -- [-278.761] (-277.017) (-281.494) (-277.632) * [-277.235] (-278.986) (-279.592) (-276.935) -- 0:00:50
38500 -- [-276.636] (-278.698) (-286.184) (-277.155) * (-279.183) (-278.572) (-279.447) [-278.652] -- 0:01:14
39000 -- [-280.762] (-277.899) (-280.389) (-276.837) * [-279.401] (-277.211) (-278.401) (-277.307) -- 0:01:13
39500 -- [-278.379] (-276.688) (-277.248) (-280.578) * (-277.982) (-278.522) [-279.089] (-277.762) -- 0:01:12
40000 -- (-277.634) [-276.591] (-277.210) (-278.794) * (-277.378) (-277.293) [-278.253] (-278.511) -- 0:01:12
Average standard deviation of split frequencies: 0.034166
40500 -- (-277.713) (-277.573) [-277.197] (-278.753) * (-278.166) (-277.292) [-277.408] (-279.824) -- 0:01:11
41000 -- (-278.687) (-278.981) [-277.009] (-280.290) * (-278.658) (-279.662) (-280.040) [-278.211] -- 0:01:10
41500 -- (-276.649) [-276.839] (-282.044) (-277.573) * (-276.529) [-277.468] (-277.499) (-283.077) -- 0:01:09
42000 -- (-277.285) (-280.627) [-283.292] (-276.861) * (-278.257) (-277.224) (-276.736) [-277.313] -- 0:01:08
42500 -- (-278.751) (-282.088) (-278.665) [-278.833] * (-276.687) [-277.789] (-278.418) (-277.131) -- 0:01:07
43000 -- (-277.074) (-281.378) [-277.684] (-276.858) * (-276.809) [-278.185] (-280.810) (-280.173) -- 0:01:06
43500 -- (-279.701) (-277.369) (-279.368) [-277.436] * [-278.855] (-277.599) (-279.608) (-278.062) -- 0:01:05
44000 -- [-277.637] (-277.856) (-279.661) (-279.947) * (-277.479) (-278.119) [-281.513] (-280.409) -- 0:01:05
44500 -- (-277.026) (-277.982) (-277.546) [-279.726] * [-277.583] (-280.085) (-286.483) (-278.920) -- 0:01:04
45000 -- (-279.467) (-282.245) [-278.022] (-278.797) * [-279.925] (-277.311) (-278.988) (-278.743) -- 0:01:03
Average standard deviation of split frequencies: 0.033539
45500 -- (-277.170) (-279.768) (-277.694) [-277.115] * (-278.935) (-282.840) [-278.200] (-280.681) -- 0:01:02
46000 -- (-278.392) [-277.822] (-278.284) (-279.997) * (-277.368) [-280.117] (-277.481) (-277.423) -- 0:01:02
46500 -- [-282.545] (-279.686) (-281.265) (-283.804) * (-280.278) [-276.383] (-277.824) (-277.449) -- 0:01:01
47000 -- (-277.731) [-278.424] (-277.268) (-278.567) * (-278.355) (-277.039) (-284.076) [-276.277] -- 0:01:00
47500 -- (-277.604) (-278.432) [-277.522] (-279.366) * (-279.696) (-279.510) [-280.055] (-277.966) -- 0:01:00
48000 -- [-277.199] (-279.151) (-278.382) (-277.481) * (-278.949) [-279.395] (-280.483) (-280.260) -- 0:00:59
48500 -- [-279.270] (-277.457) (-276.882) (-278.195) * (-281.096) (-276.793) (-282.561) [-278.636] -- 0:00:58
49000 -- (-277.417) (-277.246) [-278.700] (-286.659) * [-284.761] (-277.768) (-283.104) (-279.518) -- 0:00:58
49500 -- (-277.787) (-282.946) [-276.777] (-278.331) * [-277.964] (-280.386) (-284.736) (-277.438) -- 0:00:57
50000 -- (-276.989) [-282.201] (-278.192) (-281.239) * (-279.827) (-280.184) [-280.351] (-277.818) -- 0:00:57
Average standard deviation of split frequencies: 0.029604
50500 -- [-278.290] (-278.015) (-280.796) (-279.921) * (-277.130) (-278.775) [-279.331] (-280.471) -- 0:00:56
51000 -- (-280.788) [-279.414] (-281.370) (-277.993) * (-279.054) (-278.266) [-277.945] (-276.620) -- 0:00:55
51500 -- (-278.002) (-279.374) [-276.513] (-277.601) * (-279.469) (-279.981) (-279.392) [-277.086] -- 0:00:55
52000 -- (-279.009) (-278.706) (-276.852) [-278.885] * (-280.539) (-284.772) (-277.314) [-278.165] -- 0:00:54
52500 -- (-278.004) (-276.993) [-280.320] (-278.059) * [-277.433] (-281.755) (-277.496) (-279.379) -- 0:00:54
53000 -- [-281.169] (-277.050) (-281.259) (-278.848) * (-281.690) (-282.187) (-283.337) [-276.801] -- 0:00:53
53500 -- (-278.084) (-277.326) (-286.067) [-276.974] * (-278.634) [-276.731] (-281.011) (-278.440) -- 0:00:53
54000 -- (-280.032) (-277.213) (-283.003) [-277.161] * (-280.313) [-283.357] (-278.727) (-277.783) -- 0:00:52
54500 -- [-282.818] (-277.197) (-277.109) (-277.949) * (-279.245) (-277.898) (-278.092) [-277.422] -- 0:00:52
55000 -- (-277.377) [-279.722] (-279.200) (-280.673) * [-278.950] (-277.927) (-277.544) (-289.855) -- 0:00:51
Average standard deviation of split frequencies: 0.032736
55500 -- [-277.873] (-279.958) (-278.203) (-282.372) * (-279.952) [-276.689] (-280.195) (-279.517) -- 0:01:08
56000 -- (-277.549) [-278.859] (-278.164) (-277.157) * (-283.039) [-277.538] (-277.289) (-277.999) -- 0:01:07
56500 -- (-280.473) [-282.179] (-276.745) (-277.843) * (-279.772) [-278.358] (-276.868) (-280.893) -- 0:01:06
57000 -- [-278.840] (-277.206) (-281.361) (-276.942) * (-283.537) (-278.244) (-287.766) [-281.900] -- 0:01:06
57500 -- (-277.883) [-278.414] (-278.218) (-279.588) * (-281.758) (-280.887) [-283.893] (-279.267) -- 0:01:05
58000 -- (-277.833) (-278.684) (-281.616) [-281.243] * (-279.857) (-279.972) [-277.562] (-281.728) -- 0:01:04
58500 -- [-278.398] (-277.868) (-277.844) (-278.934) * (-276.235) (-277.882) (-278.685) [-281.066] -- 0:01:04
59000 -- [-277.467] (-282.002) (-277.435) (-277.827) * (-278.818) [-279.641] (-277.354) (-277.492) -- 0:01:03
59500 -- [-277.157] (-278.156) (-278.043) (-280.310) * [-280.062] (-278.233) (-280.048) (-278.527) -- 0:01:03
60000 -- (-281.133) [-278.507] (-278.978) (-278.739) * (-280.236) (-279.697) [-278.302] (-277.948) -- 0:01:02
Average standard deviation of split frequencies: 0.032377
60500 -- [-278.629] (-278.300) (-279.456) (-278.591) * (-281.402) (-277.742) (-278.540) [-280.182] -- 0:01:02
61000 -- (-277.287) (-280.252) [-278.175] (-278.476) * (-280.531) (-281.252) [-277.092] (-278.750) -- 0:01:01
61500 -- (-277.698) [-277.897] (-277.868) (-277.099) * (-284.036) (-280.240) [-276.956] (-279.743) -- 0:01:01
62000 -- [-278.076] (-277.170) (-277.337) (-278.054) * (-280.481) [-279.375] (-278.895) (-277.549) -- 0:01:00
62500 -- [-278.333] (-279.133) (-278.678) (-277.653) * (-282.660) (-277.445) (-279.936) [-277.159] -- 0:01:00
63000 -- (-277.127) [-278.299] (-279.958) (-280.521) * (-279.135) [-281.315] (-282.657) (-278.356) -- 0:00:59
63500 -- (-278.159) [-280.441] (-277.700) (-277.001) * (-282.437) (-281.915) (-284.310) [-276.783] -- 0:00:58
64000 -- (-277.925) (-279.243) (-278.722) [-277.148] * (-281.723) (-278.869) (-282.839) [-277.240] -- 0:00:58
64500 -- [-277.894] (-285.611) (-278.368) (-279.772) * (-277.422) [-279.165] (-280.931) (-279.541) -- 0:00:58
65000 -- (-276.715) [-281.796] (-277.775) (-277.020) * (-278.961) (-279.484) (-280.413) [-278.267] -- 0:00:57
Average standard deviation of split frequencies: 0.031953
65500 -- (-279.313) (-282.237) [-277.927] (-281.822) * (-278.406) (-277.558) (-283.234) [-277.184] -- 0:00:57
66000 -- (-279.495) (-280.179) [-278.564] (-281.273) * [-280.353] (-279.593) (-278.990) (-279.845) -- 0:00:56
66500 -- (-280.675) [-278.827] (-277.773) (-276.815) * (-279.690) (-279.367) (-278.342) [-276.464] -- 0:00:56
67000 -- (-278.405) (-277.278) [-279.800] (-277.738) * (-278.462) (-279.618) [-277.948] (-276.580) -- 0:00:55
67500 -- [-280.457] (-277.385) (-279.280) (-278.682) * (-277.462) (-279.289) [-278.706] (-276.551) -- 0:00:55
68000 -- (-278.565) (-278.536) [-277.788] (-277.545) * (-278.746) (-278.058) (-277.610) [-277.288] -- 0:00:54
68500 -- (-277.056) (-280.191) [-279.401] (-277.323) * [-277.769] (-277.540) (-277.961) (-278.414) -- 0:00:54
69000 -- (-277.413) (-277.253) [-278.636] (-277.627) * (-277.137) (-278.467) [-279.233] (-279.763) -- 0:00:53
69500 -- [-277.952] (-278.711) (-282.913) (-281.356) * [-277.999] (-279.842) (-277.263) (-279.370) -- 0:00:53
70000 -- (-280.022) [-278.695] (-279.849) (-278.737) * [-278.042] (-279.173) (-277.809) (-279.943) -- 0:00:53
Average standard deviation of split frequencies: 0.033354
70500 -- (-278.431) (-280.937) [-277.845] (-280.556) * (-276.893) (-282.849) [-278.466] (-281.318) -- 0:00:52
71000 -- (-279.345) [-279.746] (-278.922) (-277.793) * (-278.265) (-280.071) [-277.729] (-282.226) -- 0:00:52
71500 -- (-278.528) (-278.746) (-281.080) [-278.522] * (-279.327) (-283.652) (-277.623) [-277.615] -- 0:00:51
72000 -- (-279.824) [-277.462] (-278.489) (-276.616) * (-280.315) (-282.560) (-277.400) [-279.276] -- 0:00:51
72500 -- (-276.807) [-277.802] (-279.622) (-279.232) * [-276.844] (-280.036) (-278.217) (-282.404) -- 0:00:51
73000 -- [-278.287] (-279.701) (-279.264) (-279.655) * (-276.845) (-278.381) (-281.594) [-277.515] -- 0:01:03
73500 -- [-282.111] (-276.869) (-281.571) (-278.280) * [-282.687] (-280.307) (-278.851) (-280.794) -- 0:01:03
74000 -- [-278.223] (-277.238) (-283.845) (-279.176) * (-278.516) [-278.123] (-277.928) (-276.851) -- 0:01:02
74500 -- [-278.241] (-276.485) (-278.939) (-276.963) * (-278.685) (-279.407) (-278.043) [-279.479] -- 0:01:02
75000 -- (-278.107) (-279.013) [-278.126] (-277.184) * (-279.276) [-280.341] (-277.867) (-281.256) -- 0:01:01
Average standard deviation of split frequencies: 0.027568
75500 -- (-279.275) [-277.848] (-277.451) (-281.891) * (-283.063) (-278.434) [-279.427] (-281.444) -- 0:01:01
76000 -- [-277.612] (-278.234) (-277.373) (-278.329) * [-280.807] (-276.826) (-279.482) (-278.185) -- 0:01:00
76500 -- (-278.177) [-278.929] (-280.568) (-277.443) * (-281.005) (-277.297) [-280.554] (-279.647) -- 0:01:00
77000 -- [-277.047] (-278.640) (-278.017) (-278.844) * (-276.763) (-278.346) [-276.556] (-276.382) -- 0:00:59
77500 -- [-277.702] (-278.738) (-276.804) (-283.792) * (-279.518) (-276.482) [-278.099] (-279.625) -- 0:00:59
78000 -- [-277.076] (-281.388) (-278.093) (-278.439) * (-277.432) (-280.394) (-277.369) [-280.511] -- 0:00:59
78500 -- (-277.045) (-280.688) [-282.829] (-277.620) * [-279.079] (-279.852) (-278.562) (-276.958) -- 0:00:58
79000 -- [-278.527] (-276.902) (-278.291) (-277.297) * (-278.620) [-280.545] (-278.632) (-277.682) -- 0:00:58
79500 -- (-277.425) [-280.320] (-280.503) (-282.056) * [-279.804] (-281.768) (-279.311) (-278.462) -- 0:00:57
80000 -- (-277.473) (-277.741) (-276.364) [-276.925] * [-276.590] (-281.486) (-281.972) (-278.541) -- 0:00:57
Average standard deviation of split frequencies: 0.024999
80500 -- (-277.254) (-277.222) (-279.618) [-277.102] * (-277.185) (-282.743) [-277.563] (-278.768) -- 0:00:57
81000 -- [-277.862] (-276.609) (-282.173) (-278.556) * (-278.443) (-280.827) [-277.565] (-283.775) -- 0:00:56
81500 -- (-281.690) (-279.090) (-276.968) [-279.332] * (-283.602) [-277.769] (-277.925) (-280.770) -- 0:00:56
82000 -- (-279.370) [-279.831] (-278.897) (-276.931) * (-277.277) (-278.299) [-276.830] (-279.443) -- 0:00:55
82500 -- (-279.936) (-280.520) [-279.047] (-280.855) * (-280.210) (-277.586) (-278.061) [-278.745] -- 0:00:55
83000 -- [-278.952] (-280.554) (-277.792) (-279.063) * (-278.618) [-278.258] (-277.712) (-276.377) -- 0:00:55
83500 -- (-282.405) [-279.580] (-277.697) (-279.003) * (-276.924) (-277.654) (-277.082) [-277.454] -- 0:00:54
84000 -- (-277.670) (-278.196) (-278.330) [-279.588] * (-281.699) (-278.370) [-277.552] (-277.935) -- 0:00:54
84500 -- (-280.349) (-278.847) (-277.797) [-280.465] * [-276.588] (-279.582) (-277.143) (-282.000) -- 0:00:54
85000 -- [-281.431] (-285.627) (-279.560) (-279.523) * (-277.435) [-278.067] (-278.919) (-279.256) -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-279.481) (-285.428) [-280.943] (-279.222) * [-278.045] (-276.394) (-278.101) (-280.262) -- 0:00:53
86000 -- (-278.564) [-279.629] (-279.495) (-281.693) * [-279.872] (-277.283) (-276.776) (-277.972) -- 0:00:53
86500 -- (-278.268) (-282.867) (-277.145) [-279.226] * [-277.647] (-279.889) (-278.834) (-278.947) -- 0:00:52
87000 -- (-284.225) (-279.922) (-276.633) [-283.176] * [-277.521] (-279.233) (-277.736) (-279.952) -- 0:00:52
87500 -- (-278.890) (-278.217) (-277.937) [-279.040] * (-280.396) (-283.411) [-277.535] (-277.041) -- 0:00:52
88000 -- (-279.248) (-281.357) (-282.295) [-278.306] * (-279.320) (-281.502) (-279.270) [-279.789] -- 0:00:51
88500 -- (-279.014) (-284.893) [-278.072] (-282.013) * (-282.321) [-277.650] (-279.017) (-276.735) -- 0:00:51
89000 -- (-278.392) (-280.603) [-279.015] (-277.769) * [-281.681] (-280.529) (-283.370) (-277.091) -- 0:00:51
89500 -- (-279.982) (-277.856) (-277.856) [-277.612] * [-276.916] (-277.118) (-281.480) (-280.534) -- 0:00:50
90000 -- (-280.240) (-277.942) [-278.273] (-282.103) * (-280.127) (-276.582) [-277.876] (-278.363) -- 0:00:50
Average standard deviation of split frequencies: 0.025419
90500 -- (-277.251) (-281.414) [-278.256] (-281.426) * [-279.191] (-281.501) (-279.238) (-278.123) -- 0:01:00
91000 -- (-276.849) (-283.597) [-279.345] (-280.367) * (-276.803) (-279.449) [-278.316] (-277.668) -- 0:00:59
91500 -- (-277.118) (-280.458) (-279.396) [-277.223] * [-278.460] (-278.812) (-277.881) (-280.826) -- 0:00:59
92000 -- [-278.171] (-279.267) (-278.062) (-278.139) * (-280.166) [-279.301] (-277.119) (-277.336) -- 0:00:59
92500 -- (-278.542) (-280.448) (-277.731) [-278.652] * (-278.956) (-279.878) [-279.341] (-279.625) -- 0:00:58
93000 -- (-279.592) (-278.806) (-279.803) [-276.952] * (-278.516) [-278.818] (-278.418) (-282.554) -- 0:00:58
93500 -- [-277.599] (-278.502) (-277.632) (-277.560) * (-279.018) (-279.091) [-277.038] (-279.648) -- 0:00:58
94000 -- [-279.189] (-278.804) (-278.010) (-278.388) * (-277.581) (-279.194) [-276.288] (-278.613) -- 0:00:57
94500 -- (-278.931) (-281.613) (-279.445) [-277.986] * (-278.334) [-278.308] (-278.661) (-278.075) -- 0:00:57
95000 -- (-277.965) (-279.178) [-280.959] (-279.563) * (-279.839) (-277.793) (-277.351) [-277.952] -- 0:00:57
Average standard deviation of split frequencies: 0.026103
95500 -- (-276.577) [-280.669] (-278.028) (-280.583) * (-277.275) [-278.358] (-276.627) (-279.728) -- 0:00:56
96000 -- (-282.372) (-276.369) (-276.777) [-277.084] * [-277.249] (-278.783) (-277.798) (-277.381) -- 0:00:56
96500 -- (-282.839) (-277.262) [-278.999] (-281.453) * (-276.635) (-278.485) [-279.558] (-279.543) -- 0:00:56
97000 -- (-280.622) (-280.027) [-279.603] (-277.754) * (-277.390) [-277.377] (-281.244) (-277.109) -- 0:00:55
97500 -- (-277.648) (-281.461) (-279.505) [-278.401] * (-279.011) (-277.856) [-278.460] (-277.513) -- 0:00:55
98000 -- (-279.809) (-277.448) (-280.031) [-277.865] * (-277.930) (-276.481) (-279.069) [-276.537] -- 0:00:55
98500 -- (-278.383) [-278.670] (-279.735) (-279.329) * (-279.282) (-276.961) (-278.275) [-280.595] -- 0:00:54
99000 -- [-277.927] (-277.923) (-282.830) (-278.043) * [-278.376] (-280.399) (-278.697) (-278.896) -- 0:00:54
99500 -- [-277.462] (-280.077) (-281.017) (-280.392) * [-277.492] (-281.316) (-283.130) (-276.856) -- 0:00:54
100000 -- [-277.337] (-277.569) (-277.707) (-281.686) * (-277.866) [-285.144] (-279.785) (-276.844) -- 0:00:54
Average standard deviation of split frequencies: 0.027111
100500 -- (-281.145) (-277.606) (-279.069) [-277.235] * (-278.044) [-279.819] (-281.049) (-278.057) -- 0:00:53
101000 -- (-278.761) [-279.830] (-279.355) (-281.977) * [-277.158] (-277.666) (-276.885) (-279.074) -- 0:00:53
101500 -- (-280.475) (-279.966) (-280.985) [-278.624] * [-279.958] (-279.660) (-283.267) (-278.749) -- 0:00:53
102000 -- (-277.282) [-277.720] (-277.179) (-277.895) * [-276.802] (-276.894) (-279.199) (-278.914) -- 0:00:52
102500 -- (-277.417) (-283.131) (-277.825) [-280.646] * (-277.961) (-276.470) [-280.062] (-278.078) -- 0:00:52
103000 -- [-279.970] (-279.384) (-278.431) (-277.958) * [-277.091] (-277.934) (-281.524) (-277.171) -- 0:00:52
103500 -- [-278.091] (-279.378) (-278.891) (-277.617) * (-278.523) (-277.053) (-278.742) [-277.993] -- 0:00:51
104000 -- [-277.551] (-278.225) (-278.714) (-277.751) * (-277.385) (-278.750) [-277.293] (-280.093) -- 0:00:51
104500 -- [-278.663] (-278.699) (-278.747) (-278.021) * (-279.044) (-278.996) (-276.948) [-279.145] -- 0:00:51
105000 -- (-281.130) (-277.674) [-277.887] (-278.140) * (-278.221) (-280.701) (-277.645) [-277.454] -- 0:00:51
Average standard deviation of split frequencies: 0.029258
105500 -- (-277.506) (-277.512) [-277.930] (-278.286) * (-282.614) [-276.515] (-279.791) (-278.724) -- 0:00:50
106000 -- (-277.280) (-280.961) (-277.565) [-280.865] * [-277.194] (-277.920) (-280.251) (-281.262) -- 0:00:50
106500 -- (-279.950) (-281.865) (-281.790) [-279.997] * (-276.800) (-278.913) (-277.997) [-277.670] -- 0:00:50
107000 -- (-280.577) (-277.751) (-282.112) [-279.447] * [-278.199] (-277.019) (-281.994) (-279.582) -- 0:00:50
107500 -- [-280.286] (-284.746) (-279.303) (-279.428) * (-278.526) [-278.073] (-276.745) (-280.820) -- 0:00:58
108000 -- (-277.614) (-279.970) (-283.958) [-279.169] * (-277.750) (-279.869) [-278.870] (-279.890) -- 0:00:57
108500 -- (-278.026) [-278.976] (-280.761) (-282.496) * (-282.328) (-280.175) [-277.589] (-277.452) -- 0:00:57
109000 -- (-284.095) (-284.310) (-282.518) [-278.004] * [-276.889] (-279.014) (-277.667) (-277.076) -- 0:00:57
109500 -- [-278.774] (-277.590) (-277.785) (-278.089) * (-281.474) (-280.020) (-277.350) [-279.295] -- 0:00:56
110000 -- (-279.287) (-277.838) (-282.779) [-278.813] * (-277.295) (-278.542) [-282.179] (-278.354) -- 0:00:56
Average standard deviation of split frequencies: 0.026231
110500 -- (-281.415) (-277.998) (-276.851) [-280.501] * (-276.815) (-278.736) [-281.258] (-279.255) -- 0:00:56
111000 -- [-280.007] (-281.484) (-277.720) (-281.232) * (-277.676) (-278.176) [-279.738] (-277.088) -- 0:00:56
111500 -- [-279.553] (-280.523) (-278.804) (-278.209) * [-277.502] (-278.507) (-276.751) (-276.789) -- 0:00:55
112000 -- (-277.519) (-279.729) [-278.373] (-278.614) * (-282.384) [-280.849] (-279.611) (-279.436) -- 0:00:55
112500 -- (-276.310) [-278.814] (-281.517) (-278.681) * (-277.448) [-278.717] (-283.075) (-278.200) -- 0:00:55
113000 -- (-280.985) (-285.269) (-282.882) [-281.861] * (-277.214) [-276.782] (-278.664) (-277.224) -- 0:00:54
113500 -- (-279.292) [-284.265] (-277.826) (-278.218) * (-277.339) (-277.207) (-277.712) [-278.226] -- 0:00:54
114000 -- [-279.419] (-278.919) (-278.668) (-280.215) * [-276.455] (-278.870) (-276.540) (-278.910) -- 0:00:54
114500 -- [-277.293] (-283.086) (-280.873) (-279.218) * (-279.080) (-278.337) (-279.313) [-280.193] -- 0:00:54
115000 -- [-279.095] (-283.450) (-276.445) (-277.198) * (-283.064) [-278.822] (-278.318) (-280.621) -- 0:00:53
Average standard deviation of split frequencies: 0.025880
115500 -- (-280.179) (-279.305) (-276.630) [-276.541] * [-277.709] (-278.101) (-277.046) (-279.175) -- 0:00:53
116000 -- (-280.964) (-277.223) [-277.714] (-279.793) * (-277.431) (-277.091) [-278.017] (-278.386) -- 0:00:53
116500 -- (-277.363) [-276.697] (-278.482) (-278.014) * (-280.780) (-281.163) [-279.192] (-281.310) -- 0:00:53
117000 -- (-278.322) (-283.088) (-283.827) [-277.480] * (-280.651) [-280.294] (-280.252) (-276.775) -- 0:00:52
117500 -- [-276.912] (-280.793) (-283.178) (-277.699) * [-280.408] (-278.596) (-277.155) (-278.315) -- 0:00:52
118000 -- (-282.018) (-282.945) (-278.275) [-276.950] * (-281.275) (-277.847) (-280.182) [-279.387] -- 0:00:52
118500 -- (-276.974) [-281.911] (-277.472) (-278.798) * (-278.960) [-277.151] (-281.762) (-278.033) -- 0:00:52
119000 -- (-279.670) [-278.808] (-278.623) (-283.666) * [-277.342] (-277.378) (-280.003) (-279.481) -- 0:00:51
119500 -- (-282.955) (-277.083) (-277.524) [-279.440] * (-277.423) (-278.250) [-280.616] (-279.468) -- 0:00:51
120000 -- (-277.323) (-283.603) [-279.044] (-277.185) * (-276.848) (-281.081) [-277.694] (-285.950) -- 0:00:51
Average standard deviation of split frequencies: 0.023657
120500 -- (-280.099) [-278.407] (-278.658) (-284.209) * [-278.479] (-278.352) (-277.498) (-279.724) -- 0:00:51
121000 -- (-278.747) [-281.166] (-281.359) (-278.041) * (-283.271) (-279.916) [-278.712] (-279.484) -- 0:00:50
121500 -- (-276.747) (-280.705) (-280.438) [-276.804] * (-278.260) [-279.951] (-277.107) (-280.865) -- 0:00:50
122000 -- (-277.656) [-279.067] (-279.874) (-278.197) * (-280.930) [-277.347] (-277.752) (-279.360) -- 0:00:50
122500 -- (-278.181) [-276.728] (-279.151) (-281.124) * (-280.415) (-278.645) (-277.245) [-278.539] -- 0:00:50
123000 -- [-278.479] (-278.516) (-279.104) (-276.709) * (-277.285) (-279.604) (-277.527) [-277.339] -- 0:00:49
123500 -- [-278.020] (-277.420) (-279.711) (-278.023) * (-277.940) (-276.951) [-278.186] (-276.903) -- 0:00:49
124000 -- [-277.216] (-277.448) (-279.676) (-282.924) * (-280.265) (-278.265) [-277.529] (-277.542) -- 0:00:49
124500 -- (-277.397) (-278.039) [-277.910] (-278.044) * (-279.309) (-278.209) (-278.755) [-279.398] -- 0:00:56
125000 -- (-278.363) [-278.035] (-279.958) (-278.412) * (-285.722) (-280.568) (-281.109) [-279.132] -- 0:00:56
Average standard deviation of split frequencies: 0.021069
125500 -- [-280.842] (-281.781) (-276.867) (-278.034) * (-281.667) [-279.215] (-278.460) (-279.277) -- 0:00:55
126000 -- (-280.168) (-281.760) [-278.573] (-277.884) * (-281.932) (-280.976) [-276.511] (-280.291) -- 0:00:55
126500 -- (-280.460) [-278.653] (-282.643) (-277.680) * [-278.947] (-280.522) (-280.209) (-279.482) -- 0:00:55
127000 -- (-277.309) (-279.930) (-280.065) [-276.938] * (-279.117) (-277.963) (-277.649) [-279.506] -- 0:00:54
127500 -- (-278.166) [-280.835] (-277.493) (-277.513) * [-281.749] (-279.971) (-278.905) (-277.477) -- 0:00:54
128000 -- (-280.362) (-283.035) (-280.544) [-278.553] * (-277.296) [-277.520] (-278.109) (-277.752) -- 0:00:54
128500 -- (-282.369) [-277.269] (-276.652) (-282.311) * (-281.627) (-277.863) (-279.406) [-279.633] -- 0:00:54
129000 -- [-278.280] (-277.314) (-276.593) (-285.150) * (-277.264) (-281.920) (-278.400) [-279.301] -- 0:00:54
129500 -- (-277.883) (-277.313) [-277.621] (-279.442) * (-278.368) (-280.036) (-277.655) [-277.834] -- 0:00:53
130000 -- (-279.009) (-277.187) [-277.530] (-279.951) * [-278.030] (-279.483) (-278.148) (-278.468) -- 0:00:53
Average standard deviation of split frequencies: 0.024115
130500 -- [-277.349] (-279.954) (-278.986) (-277.196) * (-279.450) (-279.617) (-278.230) [-277.860] -- 0:00:53
131000 -- (-279.252) (-279.636) (-278.694) [-276.874] * (-278.486) (-278.817) [-280.623] (-278.822) -- 0:00:53
131500 -- (-278.706) (-277.899) (-278.310) [-278.624] * (-277.831) (-279.168) (-278.349) [-277.822] -- 0:00:52
132000 -- (-282.858) [-276.610] (-278.823) (-281.642) * [-279.032] (-278.367) (-278.621) (-286.544) -- 0:00:52
132500 -- [-277.015] (-277.612) (-280.373) (-280.291) * [-280.166] (-277.353) (-290.024) (-280.368) -- 0:00:52
133000 -- (-280.023) [-277.910] (-279.688) (-277.783) * (-277.752) (-280.871) (-277.233) [-276.825] -- 0:00:52
133500 -- (-276.377) (-278.436) (-278.599) [-279.325] * (-279.092) (-280.050) [-276.940] (-276.454) -- 0:00:51
134000 -- (-276.910) (-277.221) [-278.199] (-278.140) * (-278.490) (-280.091) [-277.930] (-281.191) -- 0:00:51
134500 -- (-279.010) (-277.749) (-276.868) [-278.446] * (-280.264) [-279.629] (-277.608) (-277.198) -- 0:00:51
135000 -- (-280.057) [-277.660] (-278.102) (-280.598) * (-276.740) (-278.458) [-280.793] (-277.918) -- 0:00:51
Average standard deviation of split frequencies: 0.023716
135500 -- (-279.459) [-279.053] (-280.142) (-277.977) * [-279.237] (-281.208) (-277.521) (-276.300) -- 0:00:51
136000 -- (-281.349) [-278.848] (-280.945) (-278.749) * (-278.398) (-278.610) (-277.400) [-279.994] -- 0:00:50
136500 -- (-278.243) [-277.859] (-280.814) (-278.595) * [-276.475] (-278.015) (-277.438) (-277.399) -- 0:00:50
137000 -- (-278.222) (-283.510) (-278.492) [-277.844] * [-279.155] (-278.496) (-288.766) (-280.785) -- 0:00:50
137500 -- (-276.548) (-277.836) (-287.923) [-277.086] * (-278.040) (-277.291) [-281.510] (-278.202) -- 0:00:50
138000 -- (-279.675) (-277.136) [-280.042] (-277.125) * (-277.703) [-277.330] (-281.301) (-277.411) -- 0:00:49
138500 -- (-278.270) (-287.676) (-280.909) [-278.994] * (-279.522) [-278.080] (-278.294) (-281.453) -- 0:00:49
139000 -- (-276.719) (-280.137) (-279.850) [-279.508] * (-277.678) (-278.879) [-278.490] (-278.760) -- 0:00:49
139500 -- (-278.543) (-276.311) (-279.706) [-277.181] * (-278.536) [-277.611] (-277.251) (-279.727) -- 0:00:49
140000 -- [-277.173] (-277.943) (-281.260) (-278.142) * (-276.723) (-277.192) (-277.801) [-282.546] -- 0:00:49
Average standard deviation of split frequencies: 0.022400
140500 -- [-278.466] (-280.395) (-279.943) (-279.562) * [-279.036] (-278.764) (-279.411) (-280.666) -- 0:00:48
141000 -- (-281.973) [-283.270] (-280.356) (-281.502) * [-279.202] (-279.838) (-278.124) (-280.052) -- 0:00:48
141500 -- (-277.345) [-281.870] (-281.556) (-280.749) * (-285.771) (-278.517) [-278.798] (-277.383) -- 0:00:54
142000 -- (-277.582) [-280.007] (-279.003) (-284.081) * (-281.409) (-278.599) [-276.484] (-277.688) -- 0:00:54
142500 -- (-277.351) (-277.552) [-277.396] (-279.760) * (-276.818) (-278.258) [-278.625] (-277.546) -- 0:00:54
143000 -- (-277.823) (-281.739) [-278.104] (-277.286) * (-276.489) [-280.073] (-281.611) (-277.389) -- 0:00:53
143500 -- (-278.818) (-279.644) (-278.155) [-278.571] * (-277.812) [-280.287] (-279.905) (-279.593) -- 0:00:53
144000 -- (-278.633) (-280.762) (-277.077) [-277.452] * (-279.462) [-282.517] (-280.765) (-279.411) -- 0:00:53
144500 -- (-278.448) (-280.624) (-278.453) [-276.588] * (-277.550) (-278.976) [-281.238] (-282.550) -- 0:00:53
145000 -- (-277.210) (-276.959) [-278.410] (-278.254) * [-278.103] (-279.925) (-279.169) (-281.281) -- 0:00:53
Average standard deviation of split frequencies: 0.023086
145500 -- [-278.451] (-277.045) (-279.771) (-277.663) * (-278.939) (-278.272) [-277.783] (-277.492) -- 0:00:52
146000 -- (-277.697) (-279.421) (-278.314) [-277.114] * (-280.784) (-279.641) [-277.714] (-278.064) -- 0:00:52
146500 -- (-276.915) [-276.642] (-278.947) (-280.587) * [-278.140] (-277.118) (-277.690) (-277.695) -- 0:00:52
147000 -- (-278.393) (-278.355) [-277.904] (-280.250) * (-282.267) (-276.610) (-280.111) [-279.196] -- 0:00:52
147500 -- (-278.160) (-279.388) (-276.241) [-277.662] * (-279.570) [-277.614] (-278.018) (-280.558) -- 0:00:52
148000 -- (-279.142) (-280.044) (-276.892) [-277.709] * (-277.602) (-277.704) [-280.902] (-279.689) -- 0:00:51
148500 -- (-281.122) (-276.983) [-278.249] (-277.236) * [-277.003] (-276.656) (-276.647) (-277.474) -- 0:00:51
149000 -- (-278.478) [-279.925] (-278.269) (-278.753) * (-277.831) (-279.182) [-278.568] (-278.695) -- 0:00:51
149500 -- [-277.158] (-277.838) (-279.967) (-278.783) * [-278.478] (-277.677) (-279.103) (-278.777) -- 0:00:51
150000 -- (-276.468) [-280.183] (-277.360) (-279.969) * (-278.219) [-277.829] (-277.900) (-286.057) -- 0:00:51
Average standard deviation of split frequencies: 0.023391
150500 -- (-277.425) (-281.203) (-279.329) [-278.294] * (-281.494) [-279.896] (-278.609) (-280.344) -- 0:00:50
151000 -- (-279.567) [-278.170] (-278.429) (-280.586) * (-280.134) (-278.998) (-278.674) [-277.645] -- 0:00:50
151500 -- (-277.250) (-277.775) (-278.784) [-278.137] * (-280.419) (-278.569) (-277.349) [-278.867] -- 0:00:50
152000 -- (-282.888) (-279.908) (-276.861) [-276.775] * [-277.410] (-278.621) (-276.997) (-277.063) -- 0:00:50
152500 -- (-279.935) [-277.132] (-279.060) (-278.443) * (-277.371) (-279.169) (-277.654) [-282.645] -- 0:00:50
153000 -- (-279.759) (-278.657) (-279.964) [-279.722] * (-276.673) (-278.247) (-279.805) [-277.039] -- 0:00:49
153500 -- [-279.914] (-277.029) (-279.992) (-277.135) * (-279.035) (-279.616) (-281.058) [-280.659] -- 0:00:49
154000 -- [-279.344] (-278.846) (-280.580) (-278.426) * [-277.333] (-281.108) (-276.657) (-280.512) -- 0:00:49
154500 -- [-277.201] (-278.455) (-281.530) (-279.094) * [-278.517] (-284.636) (-280.671) (-278.214) -- 0:00:49
155000 -- (-281.643) (-279.824) [-279.972] (-279.612) * (-279.244) [-278.054] (-279.089) (-277.079) -- 0:00:49
Average standard deviation of split frequencies: 0.024175
155500 -- (-277.828) (-277.935) [-276.637] (-278.665) * (-283.576) (-277.924) (-279.373) [-278.225] -- 0:00:48
156000 -- (-278.057) (-279.009) (-278.532) [-277.478] * [-277.897] (-278.240) (-276.418) (-279.260) -- 0:00:48
156500 -- (-280.116) [-279.208] (-282.438) (-278.462) * (-277.865) (-277.620) (-279.297) [-279.481] -- 0:00:48
157000 -- [-281.951] (-277.693) (-277.649) (-278.455) * (-278.237) (-281.603) [-277.808] (-278.738) -- 0:00:48
157500 -- (-279.888) (-279.388) [-278.112] (-281.703) * (-279.089) (-281.966) [-277.343] (-278.678) -- 0:00:48
158000 -- (-283.169) (-283.849) (-277.864) [-280.152] * [-279.620] (-279.421) (-276.663) (-278.095) -- 0:00:47
158500 -- (-284.024) (-283.347) [-277.594] (-278.209) * (-277.223) (-277.010) [-277.937] (-279.800) -- 0:00:47
159000 -- (-280.877) (-281.388) [-279.232] (-278.051) * (-277.746) (-276.778) [-278.028] (-279.005) -- 0:00:52
159500 -- (-277.348) (-278.902) [-277.299] (-279.225) * (-282.639) [-279.792] (-277.592) (-277.156) -- 0:00:52
160000 -- (-278.833) (-276.799) (-276.739) [-277.271] * (-286.783) (-276.898) (-281.722) [-277.595] -- 0:00:52
Average standard deviation of split frequencies: 0.026080
160500 -- [-283.171] (-279.862) (-279.283) (-279.250) * [-284.576] (-278.234) (-280.888) (-281.898) -- 0:00:52
161000 -- [-278.255] (-278.474) (-277.531) (-283.010) * [-280.410] (-278.746) (-281.633) (-278.395) -- 0:00:52
161500 -- [-277.893] (-278.376) (-280.621) (-281.693) * (-277.555) (-280.963) [-277.797] (-279.031) -- 0:00:51
162000 -- (-282.327) (-277.849) [-276.366] (-276.773) * [-280.208] (-280.722) (-278.330) (-279.708) -- 0:00:51
162500 -- [-279.111] (-280.324) (-279.426) (-277.239) * (-278.431) [-277.084] (-276.801) (-279.572) -- 0:00:51
163000 -- (-277.291) [-278.120] (-281.955) (-277.748) * [-277.725] (-278.074) (-278.118) (-277.355) -- 0:00:51
163500 -- (-277.684) (-277.247) (-281.652) [-277.935] * (-281.196) (-277.931) [-278.348] (-278.033) -- 0:00:51
164000 -- [-280.183] (-277.888) (-282.125) (-277.108) * (-278.301) [-279.160] (-278.596) (-278.047) -- 0:00:50
164500 -- (-277.999) [-277.378] (-281.676) (-279.252) * [-276.685] (-279.096) (-280.529) (-277.472) -- 0:00:50
165000 -- (-280.888) (-277.220) (-279.028) [-278.501] * (-279.628) (-280.996) [-278.391] (-276.328) -- 0:00:50
Average standard deviation of split frequencies: 0.028082
165500 -- (-281.070) [-277.153] (-280.534) (-277.408) * [-278.737] (-279.271) (-279.190) (-277.572) -- 0:00:50
166000 -- (-277.355) (-282.687) (-279.826) [-283.594] * [-278.906] (-277.617) (-278.039) (-280.601) -- 0:00:50
166500 -- (-278.560) (-277.925) [-278.330] (-283.130) * (-277.419) [-282.512] (-281.625) (-277.610) -- 0:00:50
167000 -- (-278.681) (-278.359) (-278.044) [-280.539] * (-279.946) (-278.571) (-281.458) [-279.994] -- 0:00:49
167500 -- (-280.662) (-277.908) (-276.856) [-277.442] * (-278.261) (-278.181) (-280.291) [-278.523] -- 0:00:49
168000 -- (-280.107) (-280.479) [-276.901] (-279.511) * (-277.270) [-280.440] (-277.645) (-278.682) -- 0:00:49
168500 -- (-276.954) [-277.733] (-279.427) (-278.679) * [-279.136] (-282.135) (-279.123) (-279.729) -- 0:00:49
169000 -- (-279.980) (-277.984) [-276.787] (-277.477) * (-278.914) [-278.697] (-280.946) (-277.778) -- 0:00:49
169500 -- [-278.554] (-280.615) (-276.409) (-279.935) * (-281.223) [-277.819] (-278.058) (-276.984) -- 0:00:48
170000 -- (-277.794) [-278.154] (-277.619) (-281.085) * (-278.230) (-277.827) [-280.510] (-277.716) -- 0:00:48
Average standard deviation of split frequencies: 0.026854
170500 -- (-278.359) (-279.365) [-279.992] (-285.649) * (-289.314) (-285.447) [-278.814] (-278.622) -- 0:00:48
171000 -- (-278.098) [-278.904] (-282.835) (-278.440) * (-285.983) [-284.696] (-279.857) (-277.865) -- 0:00:48
171500 -- (-281.751) (-278.783) (-278.984) [-279.134] * (-279.474) (-279.841) [-279.240] (-277.237) -- 0:00:48
172000 -- (-283.451) [-276.679] (-277.723) (-278.324) * [-280.108] (-280.817) (-278.138) (-280.619) -- 0:00:48
172500 -- (-279.135) (-276.829) (-278.957) [-277.845] * (-282.062) [-278.338] (-280.633) (-279.565) -- 0:00:47
173000 -- [-278.247] (-280.523) (-280.065) (-277.047) * [-280.809] (-277.340) (-281.717) (-277.775) -- 0:00:47
173500 -- [-281.482] (-280.885) (-278.133) (-278.103) * (-284.402) [-276.453] (-276.637) (-278.509) -- 0:00:47
174000 -- (-279.065) [-277.585] (-280.651) (-279.868) * [-278.147] (-281.194) (-279.062) (-279.645) -- 0:00:47
174500 -- (-279.702) (-279.404) [-281.456] (-279.939) * (-278.236) (-279.786) (-277.509) [-276.886] -- 0:00:47
175000 -- (-279.024) (-277.649) [-277.108] (-280.532) * (-279.843) [-279.637] (-279.072) (-280.969) -- 0:00:47
Average standard deviation of split frequencies: 0.024701
175500 -- (-279.907) [-280.020] (-283.522) (-282.118) * (-277.580) [-278.949] (-281.065) (-277.375) -- 0:00:46
176000 -- (-280.023) (-283.302) (-280.852) [-277.189] * (-281.986) (-278.480) (-277.876) [-278.002] -- 0:00:51
176500 -- (-277.601) (-281.059) (-276.693) [-276.726] * (-278.124) (-280.348) (-276.758) [-277.913] -- 0:00:51
177000 -- (-278.899) [-280.636] (-277.546) (-278.860) * (-278.975) (-277.674) (-277.947) [-277.728] -- 0:00:51
177500 -- [-278.060] (-284.126) (-277.496) (-279.626) * [-277.525] (-280.268) (-276.802) (-278.639) -- 0:00:50
178000 -- [-282.096] (-278.697) (-279.589) (-280.102) * (-278.761) [-279.472] (-276.567) (-280.733) -- 0:00:50
178500 -- (-282.066) [-278.579] (-279.014) (-278.348) * (-280.158) (-277.420) (-278.439) [-278.459] -- 0:00:50
179000 -- [-279.117] (-279.832) (-278.072) (-281.957) * (-276.939) (-278.663) (-277.994) [-277.160] -- 0:00:50
179500 -- (-281.783) (-280.228) [-277.516] (-278.112) * (-279.215) [-277.946] (-278.604) (-278.222) -- 0:00:50
180000 -- (-277.924) (-285.419) [-279.570] (-280.146) * (-278.775) [-277.633] (-276.838) (-280.661) -- 0:00:50
Average standard deviation of split frequencies: 0.024097
180500 -- (-277.273) (-280.415) (-277.913) [-280.097] * (-278.178) (-280.201) (-277.753) [-278.573] -- 0:00:49
181000 -- (-282.506) (-277.817) [-279.332] (-277.298) * (-277.286) (-279.145) (-280.273) [-278.739] -- 0:00:49
181500 -- [-277.827] (-279.503) (-282.931) (-279.067) * [-277.477] (-277.329) (-278.283) (-280.309) -- 0:00:49
182000 -- (-278.140) (-282.382) [-278.652] (-277.380) * (-277.109) (-277.428) (-281.767) [-280.182] -- 0:00:49
182500 -- [-277.602] (-279.503) (-277.649) (-277.182) * (-280.054) (-277.415) (-279.551) [-278.202] -- 0:00:49
183000 -- (-278.773) [-277.525] (-277.251) (-278.431) * (-277.243) [-282.469] (-279.908) (-282.890) -- 0:00:49
183500 -- (-279.939) (-282.540) (-278.112) [-277.996] * (-277.278) (-278.885) [-277.566] (-279.571) -- 0:00:48
184000 -- (-281.034) [-277.747] (-278.604) (-277.689) * [-277.334] (-280.024) (-278.508) (-278.859) -- 0:00:48
184500 -- (-278.842) (-278.314) [-278.604] (-279.275) * (-277.654) (-278.785) [-278.532] (-278.325) -- 0:00:48
185000 -- [-278.623] (-276.927) (-277.939) (-279.765) * (-281.122) (-278.127) [-278.342] (-279.894) -- 0:00:48
Average standard deviation of split frequencies: 0.022810
185500 -- (-278.867) (-276.534) [-278.575] (-279.377) * (-282.865) (-280.318) (-277.000) [-277.614] -- 0:00:48
186000 -- (-279.023) (-276.581) [-280.041] (-276.911) * (-279.055) [-277.120] (-278.123) (-277.769) -- 0:00:48
186500 -- (-281.173) (-278.255) [-278.968] (-278.303) * [-277.041] (-277.772) (-276.932) (-281.480) -- 0:00:47
187000 -- (-278.763) (-277.255) (-282.793) [-280.086] * (-281.091) (-284.535) [-279.636] (-280.367) -- 0:00:47
187500 -- (-276.753) (-276.479) [-277.249] (-277.900) * [-279.273] (-276.173) (-278.576) (-280.103) -- 0:00:47
188000 -- (-279.020) (-278.817) (-278.638) [-277.982] * (-280.240) (-281.573) (-280.248) [-280.351] -- 0:00:47
188500 -- (-279.500) [-277.433] (-277.381) (-279.108) * [-280.423] (-279.837) (-278.688) (-279.648) -- 0:00:47
189000 -- (-277.840) (-278.510) [-281.129] (-278.556) * (-277.355) (-277.775) [-279.442] (-280.995) -- 0:00:47
189500 -- [-278.607] (-278.876) (-278.105) (-278.143) * (-281.530) [-277.843] (-279.283) (-281.927) -- 0:00:47
190000 -- (-278.445) (-281.440) (-279.413) [-278.617] * [-280.338] (-277.023) (-278.712) (-278.642) -- 0:00:46
Average standard deviation of split frequencies: 0.020797
190500 -- (-276.648) (-280.437) (-279.029) [-277.150] * (-278.966) (-281.069) [-282.867] (-281.352) -- 0:00:46
191000 -- [-276.276] (-277.190) (-276.671) (-277.586) * (-280.185) (-278.524) (-277.852) [-282.018] -- 0:00:46
191500 -- (-276.557) (-277.754) [-277.550] (-277.158) * (-280.666) (-277.888) (-278.286) [-278.038] -- 0:00:46
192000 -- (-276.632) (-278.681) (-279.817) [-279.792] * (-278.098) [-277.714] (-278.365) (-278.050) -- 0:00:46
192500 -- (-278.215) (-276.370) (-281.336) [-279.407] * (-279.248) (-279.527) [-281.979] (-282.747) -- 0:00:46
193000 -- (-279.545) (-278.452) (-278.012) [-279.400] * [-276.805] (-276.875) (-281.550) (-278.991) -- 0:00:45
193500 -- [-280.935] (-278.547) (-278.017) (-283.964) * (-278.576) (-276.353) [-277.437] (-282.043) -- 0:00:50
194000 -- (-278.629) (-281.236) [-279.600] (-276.848) * [-279.160] (-276.951) (-286.090) (-278.920) -- 0:00:49
194500 -- (-277.077) (-279.572) [-278.566] (-277.953) * (-279.204) [-276.907] (-279.607) (-277.589) -- 0:00:49
195000 -- (-278.292) [-278.648] (-279.126) (-280.146) * (-277.928) (-277.353) [-277.954] (-277.415) -- 0:00:49
Average standard deviation of split frequencies: 0.021363
195500 -- (-278.228) [-278.563] (-277.393) (-280.503) * (-279.756) (-276.584) [-278.294] (-282.692) -- 0:00:49
196000 -- (-279.096) (-278.707) [-278.058] (-281.342) * (-278.373) [-277.054] (-277.303) (-278.295) -- 0:00:49
196500 -- [-278.510] (-281.672) (-277.844) (-282.283) * [-279.628] (-287.173) (-277.658) (-278.292) -- 0:00:49
197000 -- (-283.214) [-278.690] (-278.526) (-279.887) * [-278.374] (-278.212) (-280.241) (-278.393) -- 0:00:48
197500 -- (-281.772) (-281.721) [-278.232] (-280.833) * (-277.599) [-279.322] (-277.093) (-276.942) -- 0:00:48
198000 -- (-277.137) (-283.491) [-279.121] (-280.818) * (-278.758) (-276.884) (-278.357) [-279.253] -- 0:00:48
198500 -- [-278.143] (-279.207) (-279.901) (-280.490) * (-282.314) (-278.896) [-276.901] (-280.004) -- 0:00:48
199000 -- [-278.279] (-278.885) (-277.974) (-276.945) * (-281.276) (-278.182) (-276.914) [-277.362] -- 0:00:48
199500 -- [-277.478] (-278.942) (-277.340) (-278.321) * (-279.029) (-277.519) [-277.610] (-276.596) -- 0:00:48
200000 -- (-279.196) [-276.763] (-276.913) (-277.614) * (-277.668) (-280.214) [-276.487] (-277.338) -- 0:00:48
Average standard deviation of split frequencies: 0.021695
200500 -- (-277.704) (-278.336) (-278.001) [-281.135] * [-277.666] (-277.454) (-279.027) (-278.545) -- 0:00:47
201000 -- (-279.182) (-277.679) (-278.984) [-280.930] * (-277.441) [-281.351] (-278.713) (-281.852) -- 0:00:47
201500 -- (-278.521) (-279.717) (-281.130) [-278.315] * (-282.385) [-277.090] (-278.985) (-279.740) -- 0:00:47
202000 -- (-278.866) (-279.705) [-281.104] (-276.740) * (-278.054) (-277.890) (-279.831) [-276.960] -- 0:00:47
202500 -- (-278.523) (-277.933) (-281.826) [-278.029] * (-278.072) (-277.126) [-279.183] (-277.739) -- 0:00:47
203000 -- [-278.152] (-277.119) (-281.368) (-277.712) * (-280.230) (-279.148) (-280.105) [-279.812] -- 0:00:47
203500 -- (-276.969) (-282.042) (-278.832) [-277.669] * (-278.377) (-281.111) [-280.291] (-278.086) -- 0:00:46
204000 -- (-276.934) (-280.169) [-277.507] (-277.703) * (-280.903) [-278.326] (-281.935) (-277.458) -- 0:00:46
204500 -- (-278.508) (-278.752) (-277.208) [-278.598] * (-280.973) (-278.615) (-280.119) [-277.760] -- 0:00:46
205000 -- (-278.848) (-276.574) [-279.020] (-278.168) * (-277.549) [-280.345] (-279.202) (-283.043) -- 0:00:46
Average standard deviation of split frequencies: 0.021403
205500 -- (-279.640) (-279.414) [-278.782] (-279.062) * (-279.603) (-276.760) (-282.351) [-281.388] -- 0:00:46
206000 -- (-282.418) (-277.402) (-280.216) [-279.168] * [-276.499] (-280.689) (-278.658) (-281.835) -- 0:00:46
206500 -- (-278.647) [-277.418] (-277.149) (-277.956) * [-277.017] (-279.137) (-282.726) (-277.632) -- 0:00:46
207000 -- (-278.129) (-279.596) [-277.621] (-276.479) * (-278.450) (-280.885) (-282.213) [-276.889] -- 0:00:45
207500 -- [-278.745] (-278.895) (-278.999) (-281.176) * (-283.165) (-278.759) [-280.604] (-281.204) -- 0:00:45
208000 -- (-279.246) (-277.059) [-278.060] (-279.609) * (-279.500) (-277.682) (-277.103) [-277.095] -- 0:00:45
208500 -- (-277.306) (-279.719) [-280.406] (-277.402) * (-278.451) (-278.338) (-280.435) [-278.885] -- 0:00:45
209000 -- (-280.110) (-281.356) (-277.829) [-279.026] * (-283.549) [-280.414] (-279.889) (-278.311) -- 0:00:45
209500 -- (-283.825) [-276.920] (-277.594) (-279.105) * (-279.709) (-278.382) [-278.841] (-279.666) -- 0:00:45
210000 -- [-278.376] (-278.026) (-277.719) (-279.074) * (-278.493) (-279.245) [-277.272] (-280.730) -- 0:00:45
Average standard deviation of split frequencies: 0.020666
210500 -- (-277.882) (-277.277) (-282.500) [-278.834] * (-276.977) [-276.881] (-279.382) (-286.772) -- 0:00:48
211000 -- (-282.453) (-282.019) [-278.192] (-277.112) * (-276.404) (-281.219) (-278.312) [-277.589] -- 0:00:48
211500 -- [-279.891] (-279.547) (-278.104) (-278.644) * (-276.428) (-276.595) (-280.584) [-280.866] -- 0:00:48
212000 -- (-278.103) [-277.066] (-280.553) (-277.166) * [-277.445] (-279.860) (-279.335) (-282.518) -- 0:00:48
212500 -- [-278.459] (-277.705) (-277.548) (-278.403) * [-277.686] (-277.812) (-278.443) (-278.758) -- 0:00:48
213000 -- [-279.755] (-277.473) (-277.795) (-279.538) * (-276.901) (-278.635) [-278.864] (-277.475) -- 0:00:48
213500 -- (-282.356) (-279.513) [-279.296] (-278.784) * (-277.728) (-277.307) [-277.686] (-279.283) -- 0:00:47
214000 -- (-282.655) (-280.773) [-276.975] (-280.921) * (-278.951) (-277.092) (-277.599) [-278.282] -- 0:00:47
214500 -- (-280.051) (-276.717) (-276.898) [-280.627] * [-278.910] (-277.883) (-281.009) (-279.586) -- 0:00:47
215000 -- (-277.297) [-278.471] (-279.031) (-278.539) * (-279.418) [-277.308] (-280.163) (-276.998) -- 0:00:47
Average standard deviation of split frequencies: 0.021568
215500 -- (-279.413) (-280.707) [-277.044] (-283.915) * [-279.979] (-277.948) (-278.061) (-277.253) -- 0:00:47
216000 -- [-278.706] (-278.929) (-279.374) (-280.497) * (-278.691) (-278.655) (-279.216) [-277.276] -- 0:00:47
216500 -- [-282.072] (-282.032) (-281.818) (-280.185) * [-277.968] (-277.825) (-278.360) (-277.517) -- 0:00:47
217000 -- (-281.490) (-279.665) (-276.996) [-279.569] * (-280.537) (-281.542) (-277.819) [-278.520] -- 0:00:46
217500 -- [-279.508] (-277.642) (-279.711) (-280.841) * [-276.945] (-277.198) (-278.036) (-277.757) -- 0:00:46
218000 -- (-283.239) [-277.586] (-279.249) (-279.942) * (-281.466) (-278.886) [-278.163] (-280.425) -- 0:00:46
218500 -- (-278.828) [-277.878] (-277.446) (-279.974) * (-279.654) [-278.375] (-278.307) (-278.320) -- 0:00:46
219000 -- (-284.718) (-277.408) (-279.602) [-277.663] * (-277.177) (-278.491) [-277.032] (-278.591) -- 0:00:46
219500 -- (-276.904) (-280.985) (-278.603) [-277.906] * (-278.054) (-278.419) (-278.138) [-277.273] -- 0:00:46
220000 -- [-280.730] (-279.863) (-277.100) (-279.269) * (-276.979) (-278.033) (-278.353) [-277.322] -- 0:00:46
Average standard deviation of split frequencies: 0.020860
220500 -- (-277.462) (-279.007) [-281.066] (-279.176) * [-277.384] (-278.027) (-277.049) (-278.836) -- 0:00:45
221000 -- (-283.231) (-280.638) [-278.415] (-278.894) * [-276.881] (-276.854) (-278.387) (-279.576) -- 0:00:45
221500 -- (-281.770) (-278.802) [-281.011] (-279.978) * (-278.773) (-277.836) (-280.029) [-280.221] -- 0:00:45
222000 -- (-277.954) (-280.068) [-277.575] (-280.584) * [-278.504] (-278.848) (-277.780) (-279.912) -- 0:00:45
222500 -- (-279.894) (-278.699) (-277.985) [-277.608] * [-277.280] (-277.775) (-281.781) (-279.616) -- 0:00:45
223000 -- (-277.216) (-277.360) (-277.256) [-278.961] * (-279.178) [-282.270] (-282.211) (-278.489) -- 0:00:45
223500 -- (-279.702) (-282.516) [-276.918] (-285.219) * (-278.767) [-276.757] (-283.328) (-279.350) -- 0:00:45
224000 -- (-279.851) (-280.387) (-280.971) [-277.862] * (-278.865) (-279.050) (-286.639) [-279.174] -- 0:00:45
224500 -- (-277.533) (-283.202) (-278.906) [-278.187] * [-280.841] (-278.090) (-278.740) (-279.458) -- 0:00:44
225000 -- (-280.011) (-278.486) (-278.339) [-279.327] * [-279.161] (-279.191) (-280.146) (-279.924) -- 0:00:44
Average standard deviation of split frequencies: 0.019086
225500 -- (-278.074) [-278.883] (-280.038) (-283.325) * (-277.626) (-281.932) [-284.919] (-278.482) -- 0:00:44
226000 -- [-278.814] (-280.788) (-276.886) (-278.906) * [-279.979] (-280.112) (-282.643) (-280.015) -- 0:00:44
226500 -- (-278.094) (-280.567) [-276.669] (-277.041) * [-278.758] (-279.016) (-279.053) (-277.851) -- 0:00:44
227000 -- (-278.346) [-278.940] (-279.528) (-277.074) * (-278.553) [-278.457] (-276.689) (-278.408) -- 0:00:44
227500 -- (-277.588) [-280.793] (-279.627) (-277.549) * (-277.658) (-276.757) [-277.587] (-277.065) -- 0:00:47
228000 -- (-277.281) [-281.814] (-279.411) (-278.669) * (-277.452) (-279.307) (-277.354) [-276.268] -- 0:00:47
228500 -- (-279.008) [-282.591] (-281.857) (-277.315) * (-278.750) [-279.198] (-277.480) (-277.370) -- 0:00:47
229000 -- (-282.070) [-278.111] (-283.231) (-280.235) * (-276.885) (-279.647) [-278.160] (-277.221) -- 0:00:47
229500 -- (-280.616) [-281.335] (-280.449) (-281.937) * (-277.612) (-277.272) (-278.420) [-277.637] -- 0:00:47
230000 -- [-279.211] (-281.430) (-280.164) (-283.109) * (-280.126) [-278.545] (-280.173) (-277.604) -- 0:00:46
Average standard deviation of split frequencies: 0.017780
230500 -- (-278.682) (-277.776) (-280.526) [-280.075] * (-281.053) (-277.417) [-277.891] (-278.365) -- 0:00:46
231000 -- (-279.524) [-276.534] (-280.386) (-280.370) * [-277.779] (-279.684) (-280.598) (-283.373) -- 0:00:46
231500 -- (-285.002) [-276.950] (-277.947) (-278.433) * (-278.791) (-280.145) [-278.624] (-277.480) -- 0:00:46
232000 -- [-282.548] (-277.881) (-280.563) (-277.546) * [-278.046] (-280.519) (-276.550) (-276.963) -- 0:00:46
232500 -- [-280.335] (-277.850) (-277.747) (-279.058) * [-278.034] (-280.332) (-278.183) (-282.218) -- 0:00:46
233000 -- [-277.837] (-278.044) (-278.689) (-279.407) * (-279.054) (-287.640) (-278.085) [-284.647] -- 0:00:46
233500 -- [-278.801] (-277.423) (-282.095) (-277.649) * (-279.868) (-278.931) [-277.605] (-279.022) -- 0:00:45
234000 -- (-279.683) (-279.569) [-276.462] (-282.630) * (-279.365) (-278.858) (-278.137) [-280.895] -- 0:00:45
234500 -- (-277.645) [-277.260] (-278.783) (-278.429) * [-278.512] (-278.992) (-278.981) (-280.503) -- 0:00:45
235000 -- (-278.252) (-281.365) (-280.985) [-277.353] * [-277.152] (-281.694) (-279.085) (-278.016) -- 0:00:45
Average standard deviation of split frequencies: 0.017155
235500 -- (-276.824) (-280.384) [-284.660] (-279.601) * (-281.163) (-277.785) (-280.761) [-276.539] -- 0:00:45
236000 -- (-277.986) [-279.046] (-279.186) (-277.289) * (-279.889) (-278.123) (-279.323) [-278.620] -- 0:00:45
236500 -- (-279.308) [-283.385] (-282.021) (-279.479) * (-280.730) [-279.128] (-283.309) (-280.134) -- 0:00:45
237000 -- [-283.349] (-280.723) (-280.957) (-281.134) * [-278.275] (-278.249) (-280.721) (-282.287) -- 0:00:45
237500 -- [-277.762] (-278.503) (-281.240) (-279.556) * (-278.220) (-277.467) [-278.578] (-279.886) -- 0:00:44
238000 -- [-278.294] (-278.274) (-279.021) (-278.970) * (-277.262) (-277.445) (-279.814) [-277.907] -- 0:00:44
238500 -- [-278.895] (-277.875) (-277.648) (-280.072) * [-277.147] (-277.410) (-278.116) (-277.610) -- 0:00:44
239000 -- (-277.762) [-279.298] (-277.970) (-279.068) * (-276.768) (-277.455) (-279.372) [-278.124] -- 0:00:44
239500 -- [-277.866] (-277.059) (-277.259) (-276.433) * (-279.063) [-277.408] (-280.986) (-280.547) -- 0:00:44
240000 -- [-279.920] (-280.123) (-276.676) (-277.789) * (-277.965) (-277.982) [-277.469] (-277.313) -- 0:00:44
Average standard deviation of split frequencies: 0.019370
240500 -- (-286.474) [-278.886] (-278.169) (-276.732) * (-277.957) [-279.357] (-277.726) (-279.476) -- 0:00:44
241000 -- (-278.907) (-280.445) (-276.608) [-277.668] * (-281.136) [-278.021] (-283.079) (-277.601) -- 0:00:44
241500 -- (-277.971) [-279.118] (-277.826) (-277.794) * (-276.793) (-278.925) (-278.256) [-280.532] -- 0:00:43
242000 -- [-276.839] (-277.836) (-279.429) (-277.643) * (-282.149) (-281.384) [-277.625] (-279.249) -- 0:00:43
242500 -- [-280.915] (-279.185) (-279.173) (-278.400) * (-280.656) (-281.270) [-278.344] (-279.201) -- 0:00:43
243000 -- [-278.438] (-278.275) (-279.622) (-278.564) * (-281.013) (-278.460) (-279.071) [-278.078] -- 0:00:43
243500 -- (-276.258) [-280.053] (-281.484) (-279.584) * (-278.211) (-279.171) (-278.051) [-277.372] -- 0:00:43
244000 -- (-277.193) (-284.503) (-283.333) [-279.942] * (-278.328) (-279.404) (-277.397) [-280.402] -- 0:00:43
244500 -- (-280.661) [-277.698] (-282.059) (-277.729) * (-280.494) (-279.235) (-277.487) [-277.975] -- 0:00:43
245000 -- (-278.824) (-278.031) (-283.307) [-278.176] * (-279.941) (-281.802) (-281.102) [-276.710] -- 0:00:46
Average standard deviation of split frequencies: 0.019062
245500 -- (-283.377) (-278.374) [-277.013] (-276.912) * (-279.985) [-280.144] (-281.884) (-277.637) -- 0:00:46
246000 -- (-276.850) (-283.233) [-280.093] (-277.922) * (-279.065) (-278.331) [-277.273] (-277.415) -- 0:00:45
246500 -- (-280.453) (-282.672) (-277.533) [-281.583] * (-279.255) (-278.861) [-282.225] (-278.778) -- 0:00:45
247000 -- (-280.862) (-282.392) [-278.219] (-278.947) * (-279.065) (-280.723) [-277.420] (-280.498) -- 0:00:45
247500 -- [-279.780] (-287.557) (-279.233) (-279.431) * (-279.996) (-278.185) (-277.989) [-280.764] -- 0:00:45
248000 -- [-279.070] (-279.793) (-278.368) (-280.173) * [-278.889] (-280.925) (-279.618) (-278.782) -- 0:00:45
248500 -- (-280.264) (-278.098) [-276.995] (-277.545) * (-279.208) (-285.622) (-278.051) [-280.217] -- 0:00:45
249000 -- (-277.790) [-277.115] (-277.225) (-276.847) * [-280.674] (-280.141) (-284.198) (-279.639) -- 0:00:45
249500 -- (-282.206) (-278.538) (-276.588) [-277.585] * (-279.696) (-278.755) (-278.256) [-277.434] -- 0:00:45
250000 -- (-280.291) (-281.702) [-277.728] (-278.973) * (-278.263) (-278.209) (-279.709) [-279.890] -- 0:00:45
Average standard deviation of split frequencies: 0.019224
250500 -- (-277.725) (-284.559) [-277.410] (-285.556) * (-277.701) (-279.313) (-281.344) [-279.928] -- 0:00:44
251000 -- (-280.015) (-279.703) (-276.989) [-278.620] * [-279.465] (-278.580) (-277.005) (-277.561) -- 0:00:44
251500 -- (-280.379) (-279.803) (-278.987) [-278.970] * (-278.127) [-276.276] (-278.616) (-280.279) -- 0:00:44
252000 -- (-276.991) (-276.960) [-278.618] (-278.876) * (-277.043) [-277.817] (-279.337) (-276.881) -- 0:00:44
252500 -- (-280.940) (-280.140) [-277.292] (-278.972) * (-276.519) [-278.894] (-280.773) (-280.012) -- 0:00:44
253000 -- (-278.046) (-277.426) [-280.371] (-281.306) * (-277.108) (-279.281) (-276.690) [-279.693] -- 0:00:44
253500 -- (-277.003) (-277.993) [-280.646] (-280.037) * [-279.707] (-277.862) (-277.585) (-282.152) -- 0:00:44
254000 -- (-279.062) (-280.830) (-279.843) [-278.835] * [-278.725] (-283.232) (-279.260) (-284.121) -- 0:00:44
254500 -- (-282.724) [-277.901] (-280.763) (-278.747) * (-278.689) (-278.644) [-276.940] (-280.018) -- 0:00:43
255000 -- [-278.015] (-276.941) (-280.531) (-279.019) * (-277.822) (-278.932) [-277.954] (-282.024) -- 0:00:43
Average standard deviation of split frequencies: 0.017391
255500 -- (-284.597) (-277.644) [-279.072] (-279.296) * (-284.517) (-277.631) [-279.219] (-278.287) -- 0:00:43
256000 -- (-280.775) (-278.894) [-278.452] (-279.038) * (-279.471) [-277.356] (-276.704) (-279.940) -- 0:00:43
256500 -- (-278.888) (-277.161) [-276.450] (-279.807) * (-279.164) [-276.958] (-277.756) (-279.680) -- 0:00:43
257000 -- (-278.156) (-277.446) (-285.617) [-277.596] * (-278.449) [-277.133] (-279.364) (-278.060) -- 0:00:43
257500 -- (-276.514) (-277.535) (-279.518) [-278.594] * (-279.420) (-283.698) (-283.113) [-280.139] -- 0:00:43
258000 -- (-280.258) (-278.586) [-278.840] (-280.359) * (-283.309) [-279.192] (-279.724) (-279.456) -- 0:00:43
258500 -- (-280.865) (-277.229) (-280.604) [-278.978] * [-280.511] (-280.282) (-281.833) (-278.477) -- 0:00:43
259000 -- (-278.694) (-277.551) [-277.478] (-279.191) * (-281.414) (-280.332) (-277.587) [-278.265] -- 0:00:42
259500 -- (-276.868) [-279.026] (-280.078) (-278.100) * (-279.034) (-278.538) [-276.705] (-278.339) -- 0:00:42
260000 -- [-276.909] (-278.399) (-278.477) (-277.248) * (-277.117) (-279.528) (-278.110) [-278.890] -- 0:00:42
Average standard deviation of split frequencies: 0.015485
260500 -- (-281.723) [-277.928] (-277.462) (-284.054) * (-279.351) (-277.613) (-277.179) [-278.965] -- 0:00:42
261000 -- (-278.915) [-278.013] (-278.133) (-280.379) * (-278.849) (-276.966) [-281.833] (-278.903) -- 0:00:42
261500 -- (-279.950) (-279.442) [-278.856] (-281.180) * [-277.277] (-276.781) (-279.704) (-279.628) -- 0:00:42
262000 -- (-277.259) (-278.702) (-277.281) [-280.525] * (-278.680) [-278.727] (-278.609) (-278.175) -- 0:00:45
262500 -- (-278.041) [-278.000] (-280.016) (-278.338) * (-283.252) (-278.489) (-279.180) [-279.422] -- 0:00:44
263000 -- (-283.966) (-279.767) (-286.084) [-279.539] * (-281.017) (-279.263) (-281.948) [-280.024] -- 0:00:44
263500 -- (-280.788) (-277.029) (-282.719) [-277.965] * (-276.768) (-282.129) [-277.257] (-281.139) -- 0:00:44
264000 -- (-277.697) [-277.378] (-281.746) (-280.734) * (-277.532) (-282.782) (-277.632) [-278.687] -- 0:00:44
264500 -- [-278.936] (-277.938) (-279.612) (-282.573) * (-280.038) (-284.090) (-279.974) [-277.636] -- 0:00:44
265000 -- [-280.891] (-283.267) (-279.947) (-281.051) * (-278.130) [-283.685] (-279.473) (-278.530) -- 0:00:44
Average standard deviation of split frequencies: 0.016976
265500 -- [-279.667] (-277.401) (-278.328) (-276.703) * (-278.220) (-278.523) (-282.617) [-277.027] -- 0:00:44
266000 -- (-279.927) (-277.533) (-279.455) [-277.804] * (-278.555) (-279.170) (-281.315) [-280.169] -- 0:00:44
266500 -- (-278.528) (-278.917) [-279.619] (-281.579) * (-284.626) [-279.510] (-278.816) (-277.857) -- 0:00:44
267000 -- (-282.231) (-277.779) [-279.079] (-277.719) * (-281.001) (-279.279) [-280.034] (-279.405) -- 0:00:43
267500 -- [-278.062] (-279.116) (-279.135) (-276.862) * (-277.397) (-277.176) [-278.587] (-281.255) -- 0:00:43
268000 -- (-279.059) (-280.037) [-278.378] (-280.101) * [-280.242] (-278.891) (-277.783) (-278.292) -- 0:00:43
268500 -- (-283.938) (-278.124) (-278.115) [-277.771] * (-281.425) (-278.710) [-277.556] (-278.575) -- 0:00:43
269000 -- (-280.709) (-279.410) (-278.812) [-278.307] * (-281.741) (-278.940) [-278.471] (-277.693) -- 0:00:43
269500 -- (-279.749) (-277.206) [-280.445] (-276.770) * (-278.978) [-278.471] (-278.641) (-279.931) -- 0:00:43
270000 -- (-283.274) (-276.495) (-279.308) [-277.610] * (-279.308) [-279.646] (-277.627) (-278.960) -- 0:00:43
Average standard deviation of split frequencies: 0.017900
270500 -- (-280.519) (-280.031) [-278.414] (-284.185) * (-281.365) [-277.825] (-278.409) (-276.377) -- 0:00:43
271000 -- (-280.638) (-278.293) (-277.249) [-279.224] * (-277.334) (-277.393) [-277.592] (-279.310) -- 0:00:43
271500 -- (-280.217) [-277.034] (-283.382) (-277.543) * (-276.813) [-277.310] (-280.576) (-279.120) -- 0:00:42
272000 -- (-285.293) [-276.756] (-282.958) (-280.852) * (-278.219) (-277.813) [-277.200] (-277.972) -- 0:00:42
272500 -- (-283.195) (-279.950) (-284.018) [-282.026] * (-281.973) (-276.610) (-276.737) [-278.222] -- 0:00:42
273000 -- (-278.324) (-283.046) (-279.837) [-277.008] * (-279.776) [-276.611] (-277.104) (-279.694) -- 0:00:42
273500 -- (-276.571) [-281.574] (-278.017) (-277.760) * (-280.072) [-278.769] (-278.768) (-279.058) -- 0:00:42
274000 -- (-281.267) (-282.103) (-279.083) [-278.256] * (-278.346) (-278.221) (-278.509) [-279.409] -- 0:00:42
274500 -- [-280.118] (-278.655) (-279.578) (-279.161) * [-277.560] (-279.735) (-280.961) (-278.448) -- 0:00:42
275000 -- (-277.902) (-276.792) (-277.943) [-277.509] * (-284.803) (-280.986) [-278.218] (-276.928) -- 0:00:42
Average standard deviation of split frequencies: 0.017744
275500 -- (-276.923) (-277.709) (-278.590) [-279.347] * (-278.867) (-281.457) [-279.046] (-276.995) -- 0:00:42
276000 -- (-278.060) (-279.095) (-284.991) [-277.389] * (-281.344) [-277.111] (-279.087) (-280.924) -- 0:00:41
276500 -- (-278.559) [-277.070] (-287.013) (-277.609) * (-279.022) (-279.411) (-277.562) [-277.946] -- 0:00:41
277000 -- (-278.599) [-277.072] (-277.938) (-281.033) * (-280.784) (-278.805) [-279.271] (-279.061) -- 0:00:41
277500 -- (-280.130) (-282.534) [-279.557] (-278.055) * (-278.267) [-278.628] (-278.996) (-278.786) -- 0:00:41
278000 -- (-278.569) (-279.532) [-280.689] (-280.165) * (-277.151) (-279.233) (-277.280) [-278.630] -- 0:00:41
278500 -- [-277.616] (-278.974) (-281.514) (-276.821) * [-280.403] (-281.026) (-282.879) (-280.030) -- 0:00:41
279000 -- [-276.516] (-277.474) (-281.891) (-281.988) * (-278.060) (-279.055) [-283.433] (-278.389) -- 0:00:43
279500 -- (-278.978) (-277.615) (-283.651) [-278.780] * (-277.753) [-277.864] (-277.867) (-280.092) -- 0:00:43
280000 -- [-279.493] (-277.016) (-282.656) (-279.141) * (-280.114) (-277.531) [-277.906] (-276.685) -- 0:00:43
Average standard deviation of split frequencies: 0.016423
280500 -- (-277.963) (-276.437) [-281.381] (-278.790) * (-278.696) (-276.823) [-279.383] (-279.734) -- 0:00:43
281000 -- (-277.774) (-279.175) (-278.376) [-278.178] * (-276.915) [-276.409] (-279.303) (-279.279) -- 0:00:43
281500 -- (-278.856) (-277.511) [-277.504] (-278.263) * [-278.824] (-279.458) (-278.631) (-279.744) -- 0:00:43
282000 -- (-282.602) (-277.274) [-277.832] (-282.437) * (-281.297) (-280.798) [-277.140] (-279.120) -- 0:00:43
282500 -- (-283.781) (-280.911) (-276.625) [-277.512] * (-278.093) [-277.500] (-277.220) (-278.263) -- 0:00:43
283000 -- (-278.391) (-277.017) [-277.354] (-281.472) * (-282.830) (-276.870) (-278.003) [-281.749] -- 0:00:43
283500 -- (-276.601) (-277.246) (-277.477) [-278.233] * (-276.692) (-278.625) [-276.950] (-277.707) -- 0:00:42
284000 -- (-280.417) (-277.851) (-277.432) [-278.681] * (-277.625) (-278.297) [-279.377] (-277.171) -- 0:00:42
284500 -- [-278.773] (-281.317) (-279.037) (-278.159) * (-277.137) (-278.885) [-278.640] (-278.895) -- 0:00:42
285000 -- (-278.205) (-279.221) (-277.665) [-281.258] * (-279.669) [-278.173] (-279.120) (-279.990) -- 0:00:42
Average standard deviation of split frequencies: 0.016222
285500 -- (-279.583) [-278.165] (-280.039) (-279.845) * (-279.929) [-276.922] (-279.980) (-280.108) -- 0:00:42
286000 -- (-279.484) (-277.478) [-279.346] (-281.718) * (-281.520) [-280.030] (-279.860) (-277.362) -- 0:00:42
286500 -- (-281.292) [-278.290] (-279.422) (-278.605) * (-279.007) (-278.261) (-278.917) [-277.762] -- 0:00:42
287000 -- (-277.156) [-279.573] (-280.816) (-281.348) * (-279.341) [-277.440] (-287.585) (-277.557) -- 0:00:42
287500 -- [-277.756] (-279.219) (-285.231) (-280.424) * [-277.504] (-276.490) (-280.102) (-278.814) -- 0:00:42
288000 -- (-283.339) [-277.984] (-280.035) (-278.102) * (-278.934) (-278.123) (-277.005) [-277.350] -- 0:00:42
288500 -- [-277.898] (-281.257) (-279.672) (-281.199) * (-280.294) [-278.280] (-277.915) (-278.513) -- 0:00:41
289000 -- (-279.030) (-279.137) [-279.867] (-278.680) * (-280.468) (-279.055) (-279.174) [-281.942] -- 0:00:41
289500 -- (-279.240) [-281.133] (-279.332) (-279.103) * (-279.649) [-277.647] (-279.384) (-279.941) -- 0:00:41
290000 -- [-279.675] (-279.501) (-279.384) (-281.191) * [-277.282] (-279.981) (-277.402) (-280.246) -- 0:00:41
Average standard deviation of split frequencies: 0.015621
290500 -- (-280.880) (-277.695) (-280.539) [-280.278] * (-279.109) (-277.222) (-278.380) [-277.113] -- 0:00:41
291000 -- (-278.918) (-279.345) (-277.279) [-276.989] * [-277.778] (-276.865) (-278.731) (-276.848) -- 0:00:41
291500 -- (-277.722) (-276.708) (-277.689) [-278.815] * (-277.250) (-278.623) [-278.269] (-279.750) -- 0:00:41
292000 -- (-277.410) [-277.903] (-278.531) (-281.916) * [-277.273] (-280.740) (-277.362) (-279.340) -- 0:00:41
292500 -- (-277.460) (-280.340) (-278.491) [-277.800] * (-277.589) (-278.292) (-279.625) [-278.417] -- 0:00:41
293000 -- [-277.437] (-280.673) (-277.011) (-279.689) * (-278.251) (-276.870) (-277.374) [-278.242] -- 0:00:41
293500 -- [-278.677] (-277.513) (-278.257) (-276.720) * (-278.620) (-281.279) [-278.193] (-279.963) -- 0:00:40
294000 -- (-277.227) [-277.678] (-284.404) (-278.299) * (-282.017) (-285.169) (-280.945) [-278.152] -- 0:00:40
294500 -- (-278.238) [-276.937] (-279.892) (-278.137) * (-279.135) [-280.847] (-280.079) (-279.450) -- 0:00:40
295000 -- [-278.494] (-277.896) (-279.144) (-279.714) * [-278.080] (-276.501) (-279.848) (-278.563) -- 0:00:40
Average standard deviation of split frequencies: 0.013979
295500 -- (-277.846) [-281.270] (-277.876) (-277.740) * (-278.070) (-278.663) (-277.167) [-277.839] -- 0:00:40
296000 -- (-281.156) [-278.439] (-277.145) (-277.471) * (-279.300) [-277.907] (-277.721) (-277.853) -- 0:00:42
296500 -- (-280.423) [-278.589] (-278.439) (-278.003) * (-276.846) [-279.287] (-278.098) (-277.631) -- 0:00:42
297000 -- (-280.885) (-278.032) [-278.843] (-281.187) * (-277.690) [-279.113] (-281.073) (-279.569) -- 0:00:42
297500 -- (-279.137) (-277.045) [-277.408] (-279.955) * (-277.349) (-277.413) (-278.567) [-278.453] -- 0:00:42
298000 -- (-280.776) [-279.326] (-279.256) (-286.817) * (-280.273) (-277.261) (-278.447) [-276.793] -- 0:00:42
298500 -- (-284.361) (-279.087) (-282.127) [-282.727] * (-279.419) (-281.790) (-277.285) [-277.009] -- 0:00:42
299000 -- (-278.129) (-278.819) (-282.890) [-278.041] * [-278.270] (-283.090) (-277.123) (-281.312) -- 0:00:42
299500 -- [-278.353] (-284.679) (-279.211) (-283.273) * (-281.715) (-277.401) [-276.649] (-278.021) -- 0:00:42
300000 -- (-279.150) (-279.498) (-277.860) [-281.603] * [-279.315] (-277.090) (-280.127) (-277.655) -- 0:00:42
Average standard deviation of split frequencies: 0.013066
300500 -- (-278.496) (-279.331) (-283.180) [-277.744] * (-282.592) (-276.947) (-279.392) [-277.245] -- 0:00:41
301000 -- (-279.618) (-279.571) [-276.893] (-276.798) * (-280.674) (-278.232) [-276.819] (-278.332) -- 0:00:41
301500 -- (-279.084) (-279.895) [-276.790] (-283.416) * (-279.803) (-278.410) (-277.685) [-278.858] -- 0:00:41
302000 -- [-277.639] (-278.399) (-278.701) (-279.213) * (-279.489) (-277.894) (-278.696) [-277.211] -- 0:00:41
302500 -- (-280.009) [-276.961] (-279.421) (-278.732) * (-280.733) [-276.996] (-277.933) (-276.967) -- 0:00:41
303000 -- (-279.066) [-278.012] (-279.000) (-278.583) * (-282.794) (-276.703) (-290.651) [-277.739] -- 0:00:41
303500 -- (-279.834) (-277.258) (-280.501) [-278.674] * (-276.829) [-280.905] (-284.762) (-279.175) -- 0:00:41
304000 -- [-278.979] (-278.632) (-279.166) (-279.112) * (-282.066) [-279.277] (-280.112) (-280.576) -- 0:00:41
304500 -- (-279.452) [-278.714] (-280.577) (-281.425) * [-279.185] (-277.590) (-278.573) (-279.080) -- 0:00:41
305000 -- (-277.528) (-282.021) [-279.036] (-281.011) * (-277.393) (-278.638) (-278.271) [-279.677] -- 0:00:41
Average standard deviation of split frequencies: 0.012892
305500 -- (-279.963) (-277.290) (-279.563) [-279.200] * [-279.059] (-279.361) (-281.162) (-283.243) -- 0:00:40
306000 -- (-278.182) (-279.713) (-278.457) [-280.165] * (-277.007) (-277.840) [-277.143] (-280.218) -- 0:00:40
306500 -- (-277.096) (-277.534) (-276.654) [-277.744] * (-278.628) [-279.161] (-279.289) (-278.120) -- 0:00:40
307000 -- (-277.477) [-278.214] (-277.289) (-277.980) * (-278.853) (-280.443) [-277.293] (-280.506) -- 0:00:40
307500 -- (-280.089) (-277.659) [-280.628] (-278.637) * (-277.625) [-276.885] (-278.119) (-280.285) -- 0:00:40
308000 -- (-277.245) (-277.897) (-281.680) [-276.725] * (-277.007) [-277.136] (-277.468) (-276.979) -- 0:00:40
308500 -- [-277.205] (-277.241) (-276.944) (-278.508) * (-279.735) (-281.748) [-277.153] (-281.707) -- 0:00:40
309000 -- (-277.893) (-278.565) (-278.522) [-280.073] * (-278.863) (-284.119) (-277.807) [-281.146] -- 0:00:40
309500 -- [-278.295] (-277.918) (-277.734) (-279.515) * (-277.944) (-281.273) (-278.043) [-277.047] -- 0:00:40
310000 -- (-281.267) [-280.600] (-279.477) (-278.658) * (-280.803) (-278.713) (-276.763) [-278.994] -- 0:00:40
Average standard deviation of split frequencies: 0.012698
310500 -- [-277.368] (-279.023) (-278.093) (-277.430) * (-281.170) (-282.383) (-278.540) [-281.450] -- 0:00:39
311000 -- (-280.157) (-283.165) [-278.554] (-277.045) * (-278.835) [-278.913] (-279.740) (-277.786) -- 0:00:39
311500 -- (-280.263) [-280.544] (-278.535) (-278.430) * (-278.490) [-278.546] (-284.351) (-277.816) -- 0:00:39
312000 -- (-277.022) (-279.608) [-280.298] (-277.858) * (-278.050) (-279.177) (-279.369) [-276.925] -- 0:00:39
312500 -- (-282.293) (-280.064) [-278.414] (-277.493) * [-277.115] (-281.335) (-280.164) (-277.066) -- 0:00:39
313000 -- (-282.301) (-277.901) (-277.475) [-279.307] * (-278.549) (-278.835) (-278.668) [-277.905] -- 0:00:41
313500 -- (-281.281) (-284.276) (-276.960) [-277.816] * (-283.077) (-278.535) [-277.906] (-279.054) -- 0:00:41
314000 -- [-277.695] (-277.931) (-278.306) (-278.281) * (-282.890) (-280.003) [-277.773] (-278.106) -- 0:00:41
314500 -- (-279.522) (-282.422) [-278.997] (-278.687) * (-279.939) (-277.943) (-276.572) [-279.534] -- 0:00:41
315000 -- (-279.240) [-278.872] (-279.332) (-277.875) * (-279.689) (-284.480) [-279.067] (-283.408) -- 0:00:41
Average standard deviation of split frequencies: 0.014172
315500 -- (-283.112) [-279.153] (-278.913) (-281.628) * (-278.099) [-276.968] (-277.397) (-277.239) -- 0:00:41
316000 -- [-278.405] (-280.833) (-280.042) (-278.323) * (-277.318) (-277.654) [-278.574] (-276.884) -- 0:00:41
316500 -- (-277.752) (-277.328) [-282.874] (-278.218) * (-278.493) (-280.474) [-277.630] (-276.840) -- 0:00:41
317000 -- (-278.397) (-279.612) (-277.825) [-276.415] * (-278.757) [-279.083] (-280.088) (-278.925) -- 0:00:40
317500 -- [-279.352] (-276.831) (-279.764) (-279.051) * [-278.530] (-277.829) (-281.838) (-281.553) -- 0:00:40
318000 -- [-281.370] (-277.788) (-276.723) (-278.838) * [-279.653] (-277.922) (-280.815) (-286.569) -- 0:00:40
318500 -- (-280.733) (-280.192) [-278.007] (-282.626) * [-284.153] (-278.894) (-279.465) (-279.642) -- 0:00:40
319000 -- [-277.828] (-279.821) (-281.705) (-280.696) * (-277.841) (-282.090) (-278.534) [-279.885] -- 0:00:40
319500 -- (-277.943) (-282.820) [-278.865] (-281.499) * (-277.472) [-279.222] (-278.362) (-280.353) -- 0:00:40
320000 -- (-278.553) (-280.512) (-279.177) [-281.407] * (-277.378) (-278.729) [-278.316] (-280.955) -- 0:00:40
Average standard deviation of split frequencies: 0.013850
320500 -- (-277.589) (-281.282) (-279.128) [-280.668] * (-286.259) (-277.900) [-276.316] (-278.088) -- 0:00:40
321000 -- (-279.170) [-278.056] (-280.552) (-279.106) * (-280.618) (-279.409) (-280.440) [-279.531] -- 0:00:40
321500 -- [-277.125] (-279.293) (-278.572) (-278.351) * (-278.386) (-278.618) [-277.555] (-278.500) -- 0:00:40
322000 -- [-278.705] (-278.923) (-278.521) (-278.184) * [-278.868] (-277.551) (-280.165) (-279.062) -- 0:00:40
322500 -- (-280.218) (-277.270) [-279.061] (-282.754) * (-278.144) (-279.680) (-279.658) [-278.276] -- 0:00:39
323000 -- (-279.354) (-277.179) [-276.968] (-277.065) * (-282.297) [-276.642] (-283.313) (-279.878) -- 0:00:39
323500 -- (-283.464) (-283.546) [-277.504] (-281.704) * (-277.543) (-277.527) (-279.975) [-279.015] -- 0:00:39
324000 -- (-282.096) (-280.431) (-277.237) [-281.637] * (-277.070) (-277.217) (-281.519) [-277.518] -- 0:00:39
324500 -- (-278.250) (-277.458) [-278.487] (-280.975) * (-283.224) (-279.599) (-280.985) [-277.327] -- 0:00:39
325000 -- (-278.952) (-281.178) [-280.353] (-276.774) * (-279.867) [-279.267] (-282.470) (-280.643) -- 0:00:39
Average standard deviation of split frequencies: 0.013376
325500 -- [-281.108] (-280.265) (-280.488) (-276.963) * (-280.758) (-278.448) [-279.351] (-277.936) -- 0:00:39
326000 -- (-281.117) (-278.756) (-281.169) [-279.264] * (-277.329) [-277.837] (-277.018) (-280.501) -- 0:00:39
326500 -- (-278.882) (-276.760) [-276.805] (-280.941) * [-277.020] (-279.169) (-277.484) (-281.859) -- 0:00:39
327000 -- (-277.560) [-277.486] (-277.196) (-278.021) * (-279.305) [-282.311] (-276.557) (-279.226) -- 0:00:39
327500 -- [-276.831] (-282.972) (-280.211) (-278.345) * (-277.024) (-279.392) (-277.001) [-282.174] -- 0:00:39
328000 -- [-280.031] (-278.144) (-279.245) (-284.301) * (-276.822) [-277.134] (-277.586) (-277.441) -- 0:00:38
328500 -- (-277.640) (-280.545) (-278.623) [-278.404] * (-280.199) [-276.870] (-280.375) (-276.959) -- 0:00:38
329000 -- [-278.205] (-280.772) (-277.508) (-280.137) * [-277.964] (-277.403) (-277.360) (-278.589) -- 0:00:38
329500 -- (-277.497) (-281.318) (-277.567) [-278.704] * (-278.741) (-277.593) [-279.034] (-277.470) -- 0:00:38
330000 -- (-279.487) (-279.290) [-278.254] (-277.769) * [-277.814] (-280.321) (-278.668) (-279.152) -- 0:00:38
Average standard deviation of split frequencies: 0.013330
330500 -- (-278.402) [-277.933] (-284.669) (-277.716) * [-276.990] (-281.567) (-279.162) (-276.976) -- 0:00:40
331000 -- (-277.354) (-280.215) (-280.373) [-278.485] * (-277.697) (-278.664) [-280.889] (-276.933) -- 0:00:40
331500 -- [-276.437] (-280.719) (-280.176) (-281.758) * (-278.432) (-279.741) (-286.482) [-276.766] -- 0:00:40
332000 -- (-279.445) (-282.573) (-282.146) [-279.071] * (-282.116) (-278.538) (-279.248) [-278.078] -- 0:00:40
332500 -- (-281.634) (-280.743) (-277.766) [-276.823] * (-281.308) (-279.704) [-278.830] (-278.705) -- 0:00:40
333000 -- (-278.650) (-277.011) [-277.885] (-280.003) * (-279.266) [-278.036] (-277.087) (-281.498) -- 0:00:40
333500 -- (-279.371) (-280.904) [-277.807] (-280.158) * (-278.150) (-278.832) [-278.552] (-278.005) -- 0:00:39
334000 -- [-279.682] (-281.218) (-277.107) (-279.040) * (-278.032) [-277.690] (-281.333) (-278.747) -- 0:00:39
334500 -- (-276.608) (-279.275) [-278.410] (-278.376) * [-279.164] (-280.971) (-279.940) (-277.992) -- 0:00:39
335000 -- (-278.319) (-278.964) (-280.296) [-276.897] * [-278.796] (-281.119) (-281.758) (-278.846) -- 0:00:39
Average standard deviation of split frequencies: 0.013882
335500 -- (-278.276) [-279.299] (-277.247) (-282.673) * (-281.044) (-277.181) [-282.814] (-277.912) -- 0:00:39
336000 -- (-277.503) [-278.492] (-276.716) (-278.605) * [-276.734] (-278.579) (-281.908) (-278.461) -- 0:00:39
336500 -- (-279.945) (-279.908) [-277.997] (-280.820) * (-279.984) (-277.149) (-280.119) [-281.942] -- 0:00:39
337000 -- (-281.799) (-281.716) (-277.150) [-282.310] * (-278.694) (-281.049) [-282.001] (-278.831) -- 0:00:39
337500 -- (-279.210) [-279.282] (-279.870) (-285.907) * (-277.835) (-280.317) (-277.613) [-280.483] -- 0:00:39
338000 -- (-281.148) [-278.139] (-278.129) (-281.466) * (-280.369) (-278.177) (-278.957) [-277.085] -- 0:00:39
338500 -- (-283.108) [-278.826] (-282.256) (-279.059) * (-277.497) (-279.485) (-277.272) [-279.982] -- 0:00:39
339000 -- (-281.474) (-282.834) (-277.916) [-280.102] * (-277.490) [-278.711] (-279.219) (-276.776) -- 0:00:38
339500 -- (-279.500) (-278.187) [-277.453] (-277.665) * (-278.017) (-276.806) (-283.056) [-279.376] -- 0:00:38
340000 -- (-280.906) (-280.746) [-278.010] (-280.047) * (-278.364) [-277.564] (-280.114) (-279.959) -- 0:00:38
Average standard deviation of split frequencies: 0.014114
340500 -- (-279.900) [-280.642] (-278.132) (-278.431) * (-278.373) (-278.636) (-278.113) [-280.614] -- 0:00:38
341000 -- [-278.429] (-277.029) (-278.424) (-278.331) * (-277.662) [-278.033] (-277.974) (-278.273) -- 0:00:38
341500 -- (-279.673) (-277.831) [-281.046] (-277.169) * [-279.722] (-277.206) (-278.774) (-280.301) -- 0:00:38
342000 -- (-277.456) (-278.942) (-277.165) [-277.756] * (-278.206) (-277.163) [-281.186] (-279.160) -- 0:00:38
342500 -- (-277.066) (-277.535) [-278.144] (-279.245) * (-277.703) [-277.107] (-282.552) (-277.509) -- 0:00:38
343000 -- (-280.219) (-278.792) [-279.860] (-281.838) * (-281.960) [-278.358] (-284.704) (-278.481) -- 0:00:38
343500 -- (-281.812) (-278.498) [-278.852] (-277.085) * (-277.672) [-277.085] (-279.285) (-279.421) -- 0:00:38
344000 -- (-278.831) (-277.974) (-281.328) [-277.628] * (-277.450) (-278.413) (-278.977) [-277.819] -- 0:00:38
344500 -- (-277.421) (-280.677) [-282.816] (-282.994) * (-279.742) [-277.322] (-278.361) (-278.279) -- 0:00:38
345000 -- (-280.242) (-278.195) [-276.808] (-278.770) * (-286.069) (-277.530) (-276.659) [-277.082] -- 0:00:37
Average standard deviation of split frequencies: 0.013624
345500 -- (-277.838) (-278.544) [-278.391] (-279.975) * (-287.291) (-278.373) (-278.956) [-278.462] -- 0:00:37
346000 -- [-279.688] (-278.231) (-277.453) (-279.163) * (-283.206) (-278.170) [-276.704] (-278.927) -- 0:00:37
346500 -- (-276.914) (-279.090) (-277.532) [-278.536] * (-279.738) (-281.086) [-278.050] (-280.775) -- 0:00:37
347000 -- [-280.164] (-277.002) (-277.486) (-278.623) * [-278.414] (-280.839) (-276.380) (-279.075) -- 0:00:37
347500 -- (-284.274) (-277.515) [-277.042] (-278.276) * (-281.034) (-277.907) (-278.404) [-280.190] -- 0:00:39
348000 -- [-279.469] (-277.917) (-279.389) (-278.420) * [-278.160] (-277.050) (-279.822) (-277.610) -- 0:00:39
348500 -- (-279.337) (-279.923) [-280.157] (-277.811) * (-281.406) (-277.710) [-277.791] (-277.334) -- 0:00:39
349000 -- (-285.212) (-279.932) [-280.332] (-278.448) * (-281.052) (-276.704) (-277.181) [-276.306] -- 0:00:39
349500 -- (-279.878) [-277.213] (-278.563) (-282.180) * [-280.354] (-280.563) (-279.032) (-276.296) -- 0:00:39
350000 -- (-280.447) [-278.263] (-277.627) (-281.640) * (-276.922) [-279.182] (-278.520) (-279.442) -- 0:00:39
Average standard deviation of split frequencies: 0.012311
350500 -- (-279.308) (-279.995) (-277.538) [-277.603] * (-277.264) (-278.101) (-277.886) [-279.392] -- 0:00:38
351000 -- (-279.271) (-278.242) (-278.146) [-276.721] * [-280.323] (-280.710) (-281.133) (-281.862) -- 0:00:38
351500 -- (-277.082) (-277.322) [-279.448] (-279.274) * [-278.267] (-278.891) (-276.737) (-279.345) -- 0:00:38
352000 -- (-276.490) [-281.004] (-279.513) (-279.848) * [-276.287] (-279.266) (-278.199) (-279.133) -- 0:00:38
352500 -- [-278.539] (-279.213) (-279.109) (-282.526) * (-278.772) (-281.176) (-277.958) [-280.741] -- 0:00:38
353000 -- (-276.632) (-279.659) [-282.599] (-282.177) * (-280.308) [-278.835] (-277.639) (-279.073) -- 0:00:38
353500 -- (-281.235) [-280.364] (-277.424) (-279.737) * (-277.996) (-280.634) [-280.158] (-279.496) -- 0:00:38
354000 -- (-278.225) (-278.394) [-285.234] (-277.873) * (-279.230) (-282.724) (-279.247) [-282.951] -- 0:00:38
354500 -- (-279.930) [-277.580] (-277.755) (-279.953) * (-278.294) (-281.207) [-280.766] (-282.217) -- 0:00:38
355000 -- (-278.268) (-278.429) (-281.413) [-278.310] * [-278.492] (-277.982) (-279.327) (-281.981) -- 0:00:38
Average standard deviation of split frequencies: 0.013311
355500 -- (-278.789) [-279.446] (-279.916) (-277.625) * (-277.549) (-279.794) (-277.108) [-278.426] -- 0:00:38
356000 -- (-277.166) (-277.546) [-277.425] (-277.746) * (-278.932) (-277.609) (-281.522) [-277.624] -- 0:00:37
356500 -- (-279.618) [-277.283] (-279.295) (-277.123) * (-277.993) (-278.230) [-276.429] (-282.282) -- 0:00:37
357000 -- (-279.687) (-278.091) (-283.746) [-280.860] * [-277.826] (-277.886) (-280.100) (-277.561) -- 0:00:37
357500 -- (-277.921) (-277.920) (-279.984) [-278.087] * (-281.348) (-277.212) (-276.981) [-278.545] -- 0:00:37
358000 -- (-277.257) (-276.840) (-277.083) [-279.213] * (-280.706) (-281.846) (-280.160) [-277.273] -- 0:00:37
358500 -- (-278.485) (-278.478) (-277.832) [-277.193] * (-277.555) (-281.472) (-276.719) [-278.358] -- 0:00:37
359000 -- (-280.084) (-278.839) (-279.140) [-277.220] * (-281.751) (-278.675) (-280.758) [-277.325] -- 0:00:37
359500 -- (-282.856) [-279.634] (-279.318) (-277.395) * [-276.965] (-278.839) (-286.044) (-278.530) -- 0:00:37
360000 -- [-278.077] (-276.540) (-278.597) (-278.522) * (-282.098) [-278.768] (-279.914) (-281.966) -- 0:00:37
Average standard deviation of split frequencies: 0.013208
360500 -- (-278.972) (-279.117) [-278.422] (-277.609) * [-285.488] (-278.716) (-279.184) (-277.253) -- 0:00:37
361000 -- (-280.635) [-278.637] (-277.835) (-277.063) * (-279.714) (-280.633) [-277.593] (-280.871) -- 0:00:37
361500 -- (-277.771) (-280.894) [-281.747] (-277.019) * [-276.579] (-279.624) (-284.970) (-278.637) -- 0:00:37
362000 -- (-280.723) (-283.809) (-279.564) [-280.532] * (-276.633) (-281.798) (-283.149) [-277.205] -- 0:00:37
362500 -- (-276.866) [-277.607] (-280.762) (-277.473) * (-281.926) (-279.516) (-278.491) [-278.037] -- 0:00:36
363000 -- [-276.620] (-285.478) (-284.638) (-276.981) * (-280.732) [-278.454] (-278.525) (-281.217) -- 0:00:36
363500 -- (-277.303) [-279.064] (-278.198) (-279.659) * (-277.849) (-278.037) (-279.529) [-277.756] -- 0:00:36
364000 -- (-278.291) [-278.269] (-282.065) (-282.150) * [-278.789] (-284.457) (-278.390) (-278.526) -- 0:00:36
364500 -- (-277.812) (-278.028) (-280.457) [-277.795] * (-279.831) [-279.273] (-277.781) (-277.750) -- 0:00:36
365000 -- [-277.222] (-279.126) (-277.979) (-278.975) * (-280.648) (-277.136) [-279.704] (-276.927) -- 0:00:38
Average standard deviation of split frequencies: 0.013083
365500 -- [-277.998] (-279.620) (-277.242) (-278.771) * (-281.592) [-280.629] (-278.368) (-278.981) -- 0:00:38
366000 -- [-281.432] (-278.114) (-284.313) (-281.409) * (-277.461) [-279.194] (-280.564) (-277.011) -- 0:00:38
366500 -- (-284.050) (-278.434) [-277.616] (-283.428) * (-277.553) (-281.394) [-278.724] (-277.496) -- 0:00:38
367000 -- [-281.310] (-279.693) (-277.995) (-282.724) * (-279.221) (-282.518) (-277.099) [-276.921] -- 0:00:37
367500 -- (-278.108) (-278.674) [-278.584] (-281.223) * (-278.956) (-278.100) (-285.893) [-277.951] -- 0:00:37
368000 -- (-280.090) (-277.644) [-278.167] (-277.808) * (-278.190) (-276.709) (-276.841) [-277.063] -- 0:00:37
368500 -- (-276.826) (-277.468) (-277.638) [-279.809] * (-277.065) [-276.765] (-281.345) (-276.439) -- 0:00:37
369000 -- (-277.087) [-278.542] (-279.789) (-279.813) * (-277.449) (-277.970) [-279.193] (-279.353) -- 0:00:37
369500 -- (-279.112) (-276.333) (-280.393) [-279.813] * (-279.224) [-278.876] (-277.360) (-279.363) -- 0:00:37
370000 -- [-278.855] (-277.284) (-277.048) (-277.288) * (-279.779) [-278.772] (-279.731) (-279.803) -- 0:00:37
Average standard deviation of split frequencies: 0.013417
370500 -- (-278.813) (-279.142) (-277.568) [-280.672] * (-278.977) (-286.285) (-278.087) [-277.047] -- 0:00:37
371000 -- [-279.009] (-280.563) (-280.314) (-279.162) * (-277.774) (-278.473) [-278.559] (-281.302) -- 0:00:37
371500 -- [-278.709] (-277.717) (-277.133) (-281.773) * (-277.710) (-277.815) (-276.560) [-277.315] -- 0:00:37
372000 -- (-278.794) (-280.278) (-278.325) [-279.113] * (-278.196) (-277.265) (-277.915) [-277.324] -- 0:00:37
372500 -- (-277.441) (-283.898) (-278.964) [-280.907] * (-277.775) [-279.804] (-279.765) (-279.113) -- 0:00:37
373000 -- (-281.215) [-279.960] (-280.622) (-278.141) * (-279.655) (-277.868) [-279.713] (-279.004) -- 0:00:36
373500 -- (-279.972) [-280.204] (-280.955) (-278.080) * [-277.365] (-276.916) (-280.861) (-278.580) -- 0:00:36
374000 -- (-281.563) [-279.516] (-277.966) (-277.567) * (-280.955) [-280.004] (-278.775) (-281.210) -- 0:00:36
374500 -- [-277.715] (-278.956) (-277.416) (-277.741) * (-279.840) (-277.324) (-279.054) [-281.584] -- 0:00:36
375000 -- (-277.101) (-278.810) [-276.919] (-278.813) * (-280.466) [-278.673] (-277.648) (-279.114) -- 0:00:36
Average standard deviation of split frequencies: 0.013461
375500 -- [-276.601] (-278.363) (-277.176) (-278.359) * (-277.405) (-280.742) (-277.119) [-278.189] -- 0:00:36
376000 -- (-280.959) [-277.969] (-280.955) (-281.315) * (-283.385) (-284.214) (-278.698) [-279.504] -- 0:00:36
376500 -- (-281.016) [-277.958] (-278.022) (-279.438) * (-278.054) [-277.831] (-277.166) (-278.529) -- 0:00:36
377000 -- (-279.659) [-277.307] (-286.068) (-278.198) * (-281.009) (-280.479) [-279.046] (-277.218) -- 0:00:36
377500 -- (-281.344) (-277.001) [-280.738] (-278.878) * (-280.312) (-280.965) (-278.961) [-277.707] -- 0:00:36
378000 -- (-278.952) (-277.163) [-278.292] (-277.156) * (-278.674) (-277.715) (-277.581) [-277.583] -- 0:00:36
378500 -- (-279.022) [-277.115] (-280.944) (-277.947) * [-279.518] (-278.640) (-278.611) (-278.250) -- 0:00:36
379000 -- (-280.010) (-278.148) (-283.899) [-277.723] * [-280.816] (-278.439) (-277.520) (-277.263) -- 0:00:36
379500 -- (-279.720) (-278.786) (-281.407) [-279.075] * (-279.716) (-277.348) (-277.936) [-277.777] -- 0:00:35
380000 -- (-279.416) (-279.339) [-278.548] (-279.195) * (-277.243) (-281.606) [-276.604] (-277.737) -- 0:00:35
Average standard deviation of split frequencies: 0.013361
380500 -- (-279.859) [-278.160] (-279.535) (-278.082) * (-278.487) (-283.988) [-277.327] (-282.127) -- 0:00:35
381000 -- (-280.670) (-279.322) [-278.101] (-278.549) * (-277.722) (-277.031) [-277.186] (-280.725) -- 0:00:35
381500 -- (-282.862) [-278.354] (-278.464) (-277.008) * (-279.437) (-278.552) [-277.652] (-278.547) -- 0:00:35
382000 -- (-281.629) (-280.360) [-277.571] (-277.883) * (-277.235) (-279.062) [-278.549] (-277.858) -- 0:00:37
382500 -- (-279.157) (-277.573) (-278.171) [-277.609] * [-279.737] (-281.104) (-278.411) (-279.873) -- 0:00:37
383000 -- (-281.112) (-276.843) [-279.735] (-278.340) * (-277.057) [-278.874] (-282.663) (-279.793) -- 0:00:37
383500 -- (-281.901) (-279.265) [-281.204] (-279.780) * [-277.576] (-278.945) (-277.821) (-278.609) -- 0:00:36
384000 -- [-276.999] (-278.408) (-277.242) (-278.601) * (-277.067) (-279.077) [-278.445] (-277.667) -- 0:00:36
384500 -- (-278.636) (-279.740) (-277.981) [-278.957] * (-280.884) [-277.224] (-278.691) (-276.582) -- 0:00:36
385000 -- (-279.001) (-279.081) [-278.759] (-278.761) * (-279.877) (-277.685) (-277.488) [-277.447] -- 0:00:36
Average standard deviation of split frequencies: 0.012945
385500 -- (-279.889) (-277.028) (-277.926) [-278.694] * (-282.823) (-281.103) (-278.146) [-282.303] -- 0:00:36
386000 -- (-278.912) (-277.079) (-279.909) [-277.675] * (-282.433) (-276.902) (-281.427) [-278.580] -- 0:00:36
386500 -- (-278.179) [-277.452] (-278.805) (-279.457) * (-279.441) (-279.965) (-279.157) [-277.962] -- 0:00:36
387000 -- [-279.930] (-280.927) (-277.378) (-281.306) * (-279.348) (-279.745) [-277.957] (-279.848) -- 0:00:36
387500 -- (-279.847) [-278.886] (-276.634) (-282.371) * (-279.125) (-280.630) (-276.877) [-278.009] -- 0:00:36
388000 -- (-279.213) [-279.116] (-276.827) (-282.886) * (-279.500) (-277.836) (-278.756) [-278.224] -- 0:00:36
388500 -- (-279.312) (-280.361) (-277.964) [-284.202] * (-278.839) (-279.493) [-279.071] (-277.270) -- 0:00:36
389000 -- (-277.044) (-276.868) [-278.433] (-284.032) * (-279.955) [-279.089] (-278.924) (-277.449) -- 0:00:36
389500 -- (-277.205) (-278.758) [-277.418] (-279.979) * (-277.421) (-281.378) (-279.094) [-280.483] -- 0:00:36
390000 -- (-282.574) (-278.702) [-277.286] (-279.683) * (-278.365) (-277.347) [-281.476] (-282.264) -- 0:00:35
Average standard deviation of split frequencies: 0.012194
390500 -- (-279.866) (-276.876) [-278.082] (-279.155) * (-278.388) (-278.235) (-282.791) [-281.737] -- 0:00:35
391000 -- (-279.574) (-280.714) (-278.576) [-277.203] * (-277.948) (-276.916) [-285.990] (-282.575) -- 0:00:35
391500 -- (-278.812) (-277.028) [-277.415] (-277.950) * [-279.858] (-281.851) (-279.709) (-276.934) -- 0:00:35
392000 -- [-279.837] (-276.699) (-277.315) (-278.931) * (-280.779) (-280.386) [-277.046] (-284.931) -- 0:00:35
392500 -- (-281.240) (-283.273) (-279.754) [-278.132] * (-278.957) (-277.401) (-278.217) [-278.542] -- 0:00:35
393000 -- (-281.903) [-277.745] (-280.500) (-278.113) * (-279.069) (-278.842) (-279.189) [-276.516] -- 0:00:35
393500 -- [-279.226] (-278.087) (-278.749) (-280.554) * (-281.377) (-278.924) (-282.604) [-277.755] -- 0:00:35
394000 -- (-277.995) [-276.730] (-282.617) (-279.092) * (-279.806) (-277.435) (-278.841) [-276.967] -- 0:00:35
394500 -- (-278.870) [-277.832] (-278.213) (-279.347) * [-278.045] (-278.842) (-277.555) (-278.410) -- 0:00:35
395000 -- (-276.569) [-278.341] (-278.299) (-278.097) * (-278.937) (-278.135) (-278.765) [-281.521] -- 0:00:35
Average standard deviation of split frequencies: 0.011904
395500 -- (-281.386) (-277.091) [-280.034] (-278.331) * (-279.974) (-279.086) (-279.406) [-279.250] -- 0:00:35
396000 -- (-284.254) [-282.031] (-278.432) (-277.522) * (-277.562) (-279.792) [-280.447] (-279.424) -- 0:00:35
396500 -- (-281.975) [-279.232] (-279.158) (-282.552) * (-279.504) [-280.835] (-277.424) (-284.297) -- 0:00:35
397000 -- [-282.831] (-279.613) (-280.132) (-279.598) * (-277.686) (-282.585) (-279.721) [-280.605] -- 0:00:34
397500 -- (-278.118) [-276.422] (-278.278) (-278.463) * [-278.348] (-282.125) (-279.876) (-279.761) -- 0:00:34
398000 -- (-279.329) [-277.841] (-278.803) (-285.682) * (-277.461) (-280.326) (-285.686) [-280.833] -- 0:00:34
398500 -- [-279.737] (-279.069) (-279.395) (-277.602) * (-277.760) [-279.125] (-278.152) (-278.730) -- 0:00:34
399000 -- (-277.885) (-277.050) (-281.884) [-276.727] * [-278.913] (-278.630) (-277.231) (-278.316) -- 0:00:36
399500 -- (-277.782) [-276.569] (-277.346) (-278.908) * (-277.450) [-278.068] (-281.180) (-278.052) -- 0:00:36
400000 -- (-277.070) [-276.962] (-280.620) (-277.708) * (-276.693) (-277.532) (-277.065) [-277.691] -- 0:00:36
Average standard deviation of split frequencies: 0.012042
400500 -- (-278.244) (-278.305) [-280.026] (-279.224) * [-276.464] (-278.505) (-280.069) (-277.771) -- 0:00:35
401000 -- [-279.007] (-277.423) (-280.408) (-276.866) * [-281.378] (-278.453) (-279.938) (-277.763) -- 0:00:35
401500 -- (-281.359) [-276.583] (-278.045) (-281.164) * (-277.099) (-279.225) (-280.374) [-278.497] -- 0:00:35
402000 -- [-278.868] (-281.695) (-276.501) (-279.420) * (-282.122) [-277.017] (-277.841) (-277.247) -- 0:00:35
402500 -- (-278.461) [-278.652] (-277.422) (-277.893) * (-279.690) (-277.076) (-281.775) [-279.968] -- 0:00:35
403000 -- (-278.987) (-276.742) [-278.234] (-276.514) * (-278.533) (-276.578) [-280.690] (-276.897) -- 0:00:35
403500 -- (-277.312) (-279.700) [-282.061] (-281.452) * (-278.585) (-277.724) (-278.919) [-279.145] -- 0:00:35
404000 -- (-278.537) (-278.921) (-279.848) [-280.111] * (-279.856) (-276.584) [-278.051] (-279.644) -- 0:00:35
404500 -- (-276.838) (-278.560) (-282.015) [-280.597] * (-283.323) (-278.882) (-277.678) [-277.210] -- 0:00:35
405000 -- [-278.150] (-279.137) (-278.100) (-278.180) * [-277.995] (-279.018) (-276.336) (-277.762) -- 0:00:35
Average standard deviation of split frequencies: 0.011952
405500 -- (-278.957) (-281.538) (-280.002) [-278.960] * (-282.259) (-278.646) [-277.541] (-284.155) -- 0:00:35
406000 -- (-279.351) (-278.298) [-277.108] (-281.702) * (-280.479) [-276.996] (-280.469) (-277.351) -- 0:00:35
406500 -- (-279.661) (-279.222) (-282.083) [-277.926] * [-278.143] (-276.909) (-285.526) (-280.748) -- 0:00:35
407000 -- (-281.062) [-277.478] (-279.557) (-279.789) * (-282.028) (-279.282) [-276.647] (-277.127) -- 0:00:34
407500 -- (-280.532) (-277.873) (-282.199) [-280.371] * [-279.066] (-276.850) (-276.750) (-277.119) -- 0:00:34
408000 -- [-279.247] (-280.159) (-278.197) (-279.698) * (-278.141) [-278.726] (-280.156) (-278.396) -- 0:00:34
408500 -- (-277.627) (-282.880) (-279.847) [-282.250] * [-277.829] (-277.298) (-276.360) (-276.636) -- 0:00:34
409000 -- [-280.372] (-276.981) (-280.118) (-279.372) * [-278.189] (-279.149) (-280.119) (-276.418) -- 0:00:34
409500 -- (-279.315) (-281.151) [-278.814] (-276.852) * (-282.139) [-278.310] (-281.653) (-277.463) -- 0:00:34
410000 -- (-280.960) [-279.298] (-279.033) (-281.502) * [-282.166] (-279.867) (-278.790) (-279.553) -- 0:00:34
Average standard deviation of split frequencies: 0.013137
410500 -- [-281.088] (-281.939) (-277.454) (-279.416) * (-281.563) (-283.917) [-282.486] (-280.625) -- 0:00:34
411000 -- [-278.469] (-277.164) (-280.362) (-278.177) * [-279.215] (-277.807) (-279.543) (-279.554) -- 0:00:34
411500 -- (-276.836) (-278.295) (-278.682) [-279.837] * (-280.818) [-277.367] (-281.750) (-284.213) -- 0:00:34
412000 -- (-281.308) (-278.640) (-277.939) [-280.291] * [-277.418] (-276.865) (-276.866) (-284.053) -- 0:00:34
412500 -- (-277.707) (-279.282) [-279.201] (-282.219) * (-278.173) [-281.264] (-280.773) (-278.975) -- 0:00:34
413000 -- (-277.900) [-278.714] (-279.521) (-280.063) * (-280.650) (-277.190) (-279.192) [-279.662] -- 0:00:34
413500 -- [-282.616] (-280.095) (-279.830) (-279.000) * (-283.405) (-281.180) (-279.807) [-280.227] -- 0:00:34
414000 -- (-280.022) [-277.838] (-281.270) (-277.185) * [-277.901] (-278.313) (-277.872) (-283.209) -- 0:00:33
414500 -- (-278.286) [-279.319] (-279.762) (-278.667) * [-277.158] (-280.746) (-277.610) (-281.737) -- 0:00:33
415000 -- (-277.149) (-282.301) [-278.403] (-280.183) * (-281.110) (-282.527) (-278.948) [-276.717] -- 0:00:33
Average standard deviation of split frequencies: 0.012398
415500 -- [-276.471] (-279.149) (-278.138) (-278.380) * [-282.650] (-280.630) (-277.874) (-278.394) -- 0:00:33
416000 -- (-278.433) (-277.120) [-279.208] (-284.542) * [-281.333] (-279.838) (-280.296) (-280.607) -- 0:00:35
416500 -- (-279.575) [-279.956] (-278.796) (-281.225) * [-278.504] (-278.570) (-280.974) (-278.862) -- 0:00:35
417000 -- (-279.118) [-279.015] (-277.153) (-276.572) * [-280.265] (-278.441) (-279.309) (-277.274) -- 0:00:34
417500 -- (-284.882) (-279.449) [-277.855] (-277.727) * (-279.108) [-278.596] (-280.472) (-279.339) -- 0:00:34
418000 -- [-282.154] (-278.580) (-279.034) (-278.212) * (-282.196) (-278.039) [-278.112] (-279.380) -- 0:00:34
418500 -- (-276.880) [-276.270] (-279.252) (-279.542) * (-283.178) (-276.893) (-279.283) [-277.429] -- 0:00:34
419000 -- (-276.691) [-276.870] (-276.896) (-279.638) * (-278.117) (-281.123) [-280.883] (-278.832) -- 0:00:34
419500 -- (-283.352) (-279.742) [-279.481] (-281.820) * (-280.674) (-278.926) (-278.413) [-281.657] -- 0:00:34
420000 -- (-283.261) (-278.795) [-279.213] (-286.067) * (-283.386) (-279.107) [-279.497] (-278.755) -- 0:00:34
Average standard deviation of split frequencies: 0.013250
420500 -- (-281.343) (-279.201) [-276.741] (-277.159) * (-280.913) (-280.396) (-281.053) [-278.727] -- 0:00:34
421000 -- (-276.916) (-278.469) (-278.085) [-278.554] * (-279.421) [-280.615] (-276.918) (-282.120) -- 0:00:34
421500 -- [-277.628] (-277.059) (-277.959) (-277.958) * (-279.633) (-283.079) (-278.192) [-278.702] -- 0:00:34
422000 -- (-278.245) (-278.974) (-280.517) [-279.499] * (-286.491) (-278.330) [-281.594] (-278.311) -- 0:00:34
422500 -- (-278.687) [-280.423] (-279.819) (-287.080) * [-278.839] (-278.598) (-277.946) (-277.222) -- 0:00:34
423000 -- [-278.629] (-280.904) (-276.891) (-277.591) * [-278.251] (-279.641) (-276.675) (-279.987) -- 0:00:34
423500 -- (-277.713) [-278.234] (-279.332) (-279.442) * (-277.640) (-276.889) (-276.852) [-277.029] -- 0:00:34
424000 -- (-280.028) [-278.972] (-278.293) (-278.966) * [-279.908] (-279.979) (-278.787) (-277.859) -- 0:00:33
424500 -- (-276.654) (-276.468) (-277.299) [-280.127] * [-278.058] (-277.057) (-278.121) (-279.585) -- 0:00:33
425000 -- (-279.174) (-282.197) (-277.002) [-278.983] * (-278.502) (-278.859) (-277.874) [-278.464] -- 0:00:33
Average standard deviation of split frequencies: 0.012823
425500 -- [-279.008] (-276.914) (-279.456) (-278.828) * (-281.727) [-277.450] (-279.785) (-278.599) -- 0:00:33
426000 -- (-277.104) (-277.470) [-276.659] (-279.905) * (-279.100) (-280.841) (-281.085) [-277.784] -- 0:00:33
426500 -- [-277.095] (-280.677) (-278.127) (-277.940) * (-277.488) (-280.192) (-276.856) [-282.442] -- 0:00:33
427000 -- [-277.647] (-277.062) (-279.873) (-278.920) * (-282.376) [-276.495] (-279.466) (-278.065) -- 0:00:33
427500 -- (-279.786) (-278.862) (-277.589) [-279.945] * (-277.017) [-278.004] (-281.024) (-278.342) -- 0:00:33
428000 -- (-277.081) (-279.315) [-278.623] (-279.246) * (-278.256) (-276.877) (-277.901) [-277.098] -- 0:00:33
428500 -- [-276.957] (-278.225) (-277.987) (-278.453) * (-276.809) (-276.808) [-278.159] (-277.003) -- 0:00:33
429000 -- (-280.012) (-280.339) (-277.220) [-277.412] * [-280.105] (-277.830) (-277.448) (-280.562) -- 0:00:33
429500 -- [-276.983] (-280.654) (-278.405) (-278.457) * [-282.225] (-279.457) (-277.047) (-281.329) -- 0:00:33
430000 -- (-278.403) (-278.813) (-277.176) [-277.792] * (-279.876) (-278.223) [-278.404] (-278.941) -- 0:00:33
Average standard deviation of split frequencies: 0.012620
430500 -- (-277.504) [-279.229] (-278.649) (-279.980) * [-277.874] (-278.101) (-279.454) (-280.389) -- 0:00:33
431000 -- (-277.424) (-280.110) (-280.824) [-279.886] * [-278.187] (-283.256) (-278.820) (-277.678) -- 0:00:33
431500 -- (-277.249) (-276.940) [-279.282] (-278.891) * (-278.133) (-281.606) (-277.082) [-281.409] -- 0:00:32
432000 -- [-276.679] (-277.788) (-279.293) (-278.499) * (-278.576) (-278.061) (-277.635) [-279.389] -- 0:00:32
432500 -- [-278.448] (-280.460) (-277.403) (-277.486) * (-277.756) (-280.006) (-277.700) [-278.705] -- 0:00:32
433000 -- [-278.173] (-279.656) (-278.797) (-277.567) * [-276.965] (-277.933) (-277.360) (-277.657) -- 0:00:32
433500 -- [-277.906] (-281.583) (-278.797) (-278.145) * [-281.270] (-277.403) (-277.744) (-277.504) -- 0:00:33
434000 -- (-282.343) (-281.704) (-279.254) [-278.807] * (-278.053) (-278.195) [-278.153] (-277.856) -- 0:00:33
434500 -- (-278.273) (-282.083) (-280.290) [-277.792] * (-277.771) (-277.411) (-278.920) [-277.253] -- 0:00:33
435000 -- [-277.745] (-277.759) (-277.970) (-276.576) * [-279.060] (-277.557) (-281.403) (-277.619) -- 0:00:33
Average standard deviation of split frequencies: 0.012338
435500 -- (-284.165) (-279.418) (-276.716) [-276.661] * [-277.318] (-277.103) (-279.542) (-282.865) -- 0:00:33
436000 -- (-280.492) (-279.567) [-277.477] (-276.486) * (-278.416) (-276.662) [-282.057] (-279.267) -- 0:00:33
436500 -- (-278.362) [-284.914] (-276.615) (-276.732) * (-281.086) [-280.399] (-280.354) (-279.921) -- 0:00:33
437000 -- [-282.391] (-278.897) (-280.055) (-277.802) * (-281.544) (-281.609) [-277.798] (-278.276) -- 0:00:33
437500 -- (-280.794) [-278.897] (-282.895) (-282.338) * (-283.749) (-280.434) [-277.419] (-278.298) -- 0:00:33
438000 -- (-282.013) [-277.890] (-276.634) (-279.661) * (-277.636) (-280.149) (-276.896) [-278.061] -- 0:00:33
438500 -- [-280.559] (-278.945) (-277.486) (-280.411) * (-279.914) (-277.636) (-276.979) [-278.560] -- 0:00:33
439000 -- (-278.956) (-281.610) [-278.628] (-281.593) * (-281.180) (-281.752) [-279.268] (-277.919) -- 0:00:33
439500 -- (-277.964) (-280.146) (-278.123) [-282.395] * (-278.170) (-279.421) [-278.989] (-279.259) -- 0:00:33
440000 -- (-282.210) (-277.425) [-278.402] (-279.905) * (-276.971) (-278.739) [-278.516] (-284.265) -- 0:00:33
Average standard deviation of split frequencies: 0.012102
440500 -- (-280.105) (-277.614) [-277.770] (-280.755) * (-276.924) [-277.886] (-277.044) (-277.660) -- 0:00:33
441000 -- (-277.322) [-281.603] (-276.796) (-278.923) * (-277.930) (-278.845) [-279.137] (-280.404) -- 0:00:32
441500 -- [-277.696] (-282.231) (-282.021) (-281.449) * (-278.400) (-280.206) [-277.589] (-281.730) -- 0:00:32
442000 -- (-278.440) (-280.204) (-283.976) [-277.044] * (-277.365) [-278.304] (-282.280) (-278.943) -- 0:00:32
442500 -- (-277.049) (-282.172) [-278.114] (-278.500) * (-278.448) (-279.373) (-280.206) [-279.039] -- 0:00:32
443000 -- [-277.170] (-282.072) (-282.577) (-278.225) * (-277.420) (-277.768) [-279.238] (-278.272) -- 0:00:32
443500 -- [-276.986] (-277.692) (-277.832) (-277.770) * [-277.523] (-277.412) (-277.114) (-277.721) -- 0:00:32
444000 -- (-279.103) (-279.312) [-279.457] (-277.291) * (-278.263) [-276.970] (-277.037) (-276.842) -- 0:00:32
444500 -- (-276.386) (-277.274) (-281.938) [-277.778] * (-277.824) (-276.993) [-280.085] (-278.383) -- 0:00:32
445000 -- (-278.865) (-281.225) (-284.135) [-277.908] * [-278.324] (-280.307) (-278.386) (-277.876) -- 0:00:32
Average standard deviation of split frequencies: 0.011378
445500 -- (-277.328) (-277.734) [-278.408] (-278.960) * (-278.684) [-278.528] (-277.358) (-280.003) -- 0:00:32
446000 -- (-279.592) [-276.826] (-278.182) (-277.713) * (-277.612) (-278.162) [-277.637] (-285.541) -- 0:00:32
446500 -- (-279.279) (-278.849) (-279.595) [-276.861] * (-277.737) (-278.037) [-279.333] (-283.707) -- 0:00:32
447000 -- (-279.861) (-285.301) [-277.445] (-277.198) * (-276.705) (-282.885) (-278.820) [-279.345] -- 0:00:32
447500 -- [-279.790] (-280.546) (-279.098) (-278.223) * [-281.211] (-280.627) (-281.612) (-276.954) -- 0:00:32
448000 -- (-278.069) (-279.133) (-277.841) [-276.654] * [-282.674] (-280.627) (-280.990) (-277.547) -- 0:00:32
448500 -- [-279.347] (-278.882) (-281.303) (-280.540) * [-283.723] (-277.065) (-279.268) (-280.106) -- 0:00:31
449000 -- (-279.448) (-277.756) [-278.837] (-281.559) * [-278.860] (-281.621) (-277.550) (-284.044) -- 0:00:31
449500 -- [-277.369] (-283.961) (-280.222) (-278.910) * (-279.440) [-277.466] (-279.389) (-279.011) -- 0:00:31
450000 -- [-278.677] (-279.145) (-278.694) (-279.796) * [-277.619] (-279.213) (-281.163) (-280.529) -- 0:00:31
Average standard deviation of split frequencies: 0.011383
450500 -- (-281.937) (-277.903) (-281.610) [-278.911] * [-280.519] (-280.209) (-279.799) (-281.043) -- 0:00:32
451000 -- (-282.382) [-279.524] (-281.602) (-276.872) * (-281.729) (-279.747) (-284.208) [-276.637] -- 0:00:32
451500 -- (-281.593) (-277.314) [-279.002] (-278.550) * (-279.836) [-278.748] (-279.445) (-277.015) -- 0:00:32
452000 -- (-278.399) (-280.149) (-276.884) [-276.491] * (-277.770) [-277.104] (-278.697) (-277.359) -- 0:00:32
452500 -- (-277.389) (-279.842) [-277.333] (-277.271) * (-278.099) (-277.872) (-280.215) [-276.781] -- 0:00:32
453000 -- [-276.937] (-278.023) (-276.867) (-277.861) * [-276.991] (-279.847) (-278.103) (-278.969) -- 0:00:32
453500 -- (-278.602) [-276.337] (-276.919) (-281.056) * (-281.183) (-276.547) [-278.710] (-283.887) -- 0:00:32
454000 -- [-280.083] (-277.229) (-279.127) (-280.195) * (-277.276) (-280.888) (-279.667) [-282.302] -- 0:00:32
454500 -- (-279.894) [-281.450] (-279.203) (-277.609) * [-278.207] (-279.672) (-282.224) (-279.596) -- 0:00:32
455000 -- [-276.839] (-278.320) (-279.453) (-279.128) * (-277.247) (-278.717) (-278.408) [-278.482] -- 0:00:32
Average standard deviation of split frequencies: 0.011980
455500 -- (-279.128) (-278.086) [-280.270] (-280.742) * (-277.801) [-278.392] (-279.704) (-278.121) -- 0:00:32
456000 -- (-277.383) (-280.586) [-282.418] (-278.515) * (-278.546) [-279.718] (-277.328) (-277.953) -- 0:00:32
456500 -- (-279.534) (-278.560) (-282.648) [-282.699] * (-277.674) (-278.448) [-278.363] (-277.428) -- 0:00:32
457000 -- (-279.597) (-277.124) [-280.312] (-277.051) * (-281.185) [-277.365] (-280.930) (-278.910) -- 0:00:32
457500 -- (-279.858) [-279.308] (-279.702) (-277.568) * (-281.427) [-279.292] (-278.734) (-277.864) -- 0:00:32
458000 -- (-280.156) [-277.831] (-277.711) (-277.670) * (-280.111) (-279.393) [-277.638] (-278.413) -- 0:00:31
458500 -- (-280.268) (-278.692) (-277.064) [-278.616] * (-279.799) (-280.377) (-278.574) [-277.202] -- 0:00:31
459000 -- (-279.360) (-282.325) [-277.137] (-282.733) * (-277.970) (-279.481) [-280.978] (-279.325) -- 0:00:31
459500 -- (-278.871) (-279.494) (-280.958) [-282.883] * [-280.084] (-279.698) (-280.646) (-277.200) -- 0:00:31
460000 -- (-278.794) (-280.355) (-282.889) [-282.815] * (-278.347) (-280.834) [-277.073] (-281.987) -- 0:00:31
Average standard deviation of split frequencies: 0.012340
460500 -- (-277.661) [-280.072] (-278.351) (-277.752) * (-278.655) (-281.352) [-277.260] (-278.010) -- 0:00:31
461000 -- (-279.091) (-278.470) (-278.895) [-281.644] * [-280.237] (-280.548) (-277.488) (-277.932) -- 0:00:31
461500 -- (-277.303) (-279.739) (-277.653) [-279.365] * (-278.214) [-277.594] (-278.898) (-277.645) -- 0:00:31
462000 -- (-278.154) (-278.112) [-279.726] (-276.942) * [-278.871] (-278.145) (-278.330) (-280.418) -- 0:00:31
462500 -- (-280.723) [-276.947] (-280.768) (-277.286) * (-279.391) (-277.130) (-279.191) [-278.227] -- 0:00:31
463000 -- (-280.604) (-278.182) [-276.722] (-278.042) * (-277.314) (-277.977) [-279.723] (-281.568) -- 0:00:31
463500 -- (-279.732) (-282.930) [-278.268] (-279.442) * [-278.398] (-277.431) (-278.730) (-281.191) -- 0:00:31
464000 -- [-278.132] (-277.148) (-279.431) (-278.301) * (-277.675) (-277.119) (-279.852) [-277.111] -- 0:00:31
464500 -- [-276.821] (-279.151) (-276.957) (-280.567) * [-277.768] (-277.093) (-280.524) (-279.357) -- 0:00:31
465000 -- (-276.564) [-277.257] (-277.330) (-285.130) * (-277.881) [-277.867] (-278.302) (-280.080) -- 0:00:31
Average standard deviation of split frequencies: 0.011782
465500 -- (-279.621) (-277.290) (-280.049) [-278.353] * (-278.028) [-280.378] (-280.757) (-277.706) -- 0:00:31
466000 -- [-280.858] (-278.310) (-279.182) (-277.506) * (-277.226) (-278.879) [-277.459] (-279.545) -- 0:00:30
466500 -- (-279.056) [-279.063] (-278.421) (-281.493) * [-277.033] (-279.943) (-277.230) (-276.683) -- 0:00:30
467000 -- (-280.851) [-277.239] (-279.620) (-278.794) * (-276.902) [-277.636] (-278.424) (-277.092) -- 0:00:30
467500 -- (-277.954) (-279.086) (-279.601) [-278.423] * [-280.899] (-282.413) (-283.144) (-276.509) -- 0:00:31
468000 -- (-278.195) [-277.927] (-277.648) (-277.190) * (-284.862) (-277.906) (-278.983) [-278.031] -- 0:00:31
468500 -- [-277.794] (-278.232) (-278.158) (-277.316) * [-281.313] (-278.814) (-278.800) (-276.526) -- 0:00:31
469000 -- (-278.216) (-280.124) [-282.574] (-280.177) * (-278.559) (-278.841) [-279.814] (-278.467) -- 0:00:31
469500 -- [-279.794] (-279.522) (-277.700) (-279.030) * (-282.019) (-276.915) [-278.716] (-278.724) -- 0:00:31
470000 -- (-277.896) (-279.707) (-277.239) [-279.080] * (-281.319) (-276.784) [-276.686] (-279.160) -- 0:00:31
Average standard deviation of split frequencies: 0.011489
470500 -- (-279.068) [-278.529] (-276.599) (-278.593) * (-279.631) (-278.566) [-278.000] (-282.341) -- 0:00:31
471000 -- (-277.261) [-279.077] (-280.187) (-281.542) * (-281.196) (-282.428) [-277.317] (-278.760) -- 0:00:31
471500 -- (-280.277) (-281.276) (-281.041) [-277.516] * (-280.984) (-277.739) [-278.030] (-277.281) -- 0:00:31
472000 -- (-282.869) (-277.561) (-277.373) [-278.024] * [-280.281] (-278.003) (-278.726) (-277.678) -- 0:00:31
472500 -- (-279.343) (-280.497) (-280.924) [-277.825] * (-279.795) [-278.788] (-280.016) (-277.224) -- 0:00:31
473000 -- (-283.327) [-278.421] (-280.592) (-277.959) * (-281.145) [-276.743] (-277.324) (-281.325) -- 0:00:31
473500 -- (-277.247) (-277.973) [-280.094] (-281.225) * (-279.884) [-276.686] (-278.203) (-278.033) -- 0:00:31
474000 -- (-277.136) [-276.656] (-280.437) (-278.613) * (-277.604) [-277.911] (-276.576) (-277.501) -- 0:00:31
474500 -- (-278.457) (-280.623) (-280.018) [-280.830] * (-277.530) (-279.301) [-278.484] (-277.010) -- 0:00:31
475000 -- (-278.680) (-280.277) (-280.815) [-277.370] * [-278.161] (-277.813) (-280.212) (-278.815) -- 0:00:30
Average standard deviation of split frequencies: 0.011127
475500 -- (-277.477) (-279.681) [-278.782] (-278.616) * (-278.970) [-280.872] (-279.074) (-278.947) -- 0:00:30
476000 -- (-284.304) [-277.470] (-277.442) (-281.077) * [-278.613] (-278.485) (-277.647) (-276.706) -- 0:00:30
476500 -- [-281.218] (-278.944) (-277.892) (-282.076) * (-278.305) [-276.658] (-277.676) (-279.453) -- 0:00:30
477000 -- (-281.247) (-280.268) (-279.085) [-278.857] * [-277.542] (-278.606) (-278.279) (-278.594) -- 0:00:30
477500 -- (-278.244) (-279.209) (-280.999) [-278.989] * (-284.875) (-279.829) (-277.749) [-278.140] -- 0:00:30
478000 -- (-277.865) [-277.619] (-277.278) (-278.870) * (-278.590) [-279.677] (-282.759) (-281.217) -- 0:00:30
478500 -- (-280.058) (-278.156) (-279.297) [-277.207] * [-278.997] (-279.752) (-280.586) (-279.479) -- 0:00:30
479000 -- [-278.727] (-278.269) (-279.251) (-277.715) * (-284.253) (-277.478) [-277.886] (-279.503) -- 0:00:30
479500 -- (-280.197) (-277.416) [-280.077] (-277.496) * (-281.340) [-277.237] (-281.633) (-279.827) -- 0:00:30
480000 -- (-280.170) (-282.340) (-283.582) [-276.965] * [-278.252] (-279.438) (-280.020) (-278.713) -- 0:00:30
Average standard deviation of split frequencies: 0.011340
480500 -- (-282.094) [-281.097] (-279.623) (-278.991) * (-279.565) (-278.345) [-277.915] (-279.739) -- 0:00:30
481000 -- (-279.818) (-276.475) (-278.094) [-277.353] * (-280.712) (-277.395) (-278.383) [-279.097] -- 0:00:30
481500 -- (-277.419) [-277.155] (-277.355) (-277.530) * [-279.725] (-277.868) (-279.926) (-279.651) -- 0:00:30
482000 -- [-277.835] (-277.834) (-278.291) (-278.862) * (-282.357) (-277.539) (-278.969) [-279.496] -- 0:00:30
482500 -- (-276.633) [-278.236] (-282.108) (-278.417) * [-279.184] (-278.804) (-276.772) (-279.796) -- 0:00:30
483000 -- [-276.524] (-276.612) (-278.454) (-277.628) * (-278.866) (-276.970) (-277.394) [-283.323] -- 0:00:29
483500 -- (-280.860) [-276.585] (-280.045) (-277.125) * (-279.906) (-280.020) [-279.821] (-281.469) -- 0:00:29
484000 -- (-278.870) [-277.029] (-278.174) (-277.381) * (-282.112) (-278.648) [-280.516] (-277.577) -- 0:00:29
484500 -- [-278.499] (-281.201) (-278.078) (-278.774) * [-276.748] (-277.864) (-278.977) (-281.435) -- 0:00:30
485000 -- (-278.839) [-279.084] (-279.979) (-277.135) * (-278.581) [-278.215] (-277.070) (-282.277) -- 0:00:30
Average standard deviation of split frequencies: 0.010185
485500 -- (-277.529) [-276.841] (-277.514) (-277.634) * (-277.701) [-277.754] (-278.783) (-280.953) -- 0:00:30
486000 -- [-276.674] (-277.590) (-281.659) (-278.506) * (-279.348) (-277.810) [-278.366] (-278.700) -- 0:00:30
486500 -- [-278.796] (-281.016) (-278.633) (-277.561) * [-277.366] (-282.814) (-282.174) (-277.957) -- 0:00:30
487000 -- (-278.111) [-278.951] (-279.288) (-279.951) * (-281.843) (-277.692) [-278.459] (-281.862) -- 0:00:30
487500 -- [-276.851] (-276.626) (-278.706) (-280.872) * (-277.035) [-277.348] (-276.598) (-278.210) -- 0:00:30
488000 -- [-277.244] (-277.760) (-277.499) (-277.614) * [-276.718] (-277.506) (-277.634) (-276.656) -- 0:00:30
488500 -- (-278.838) (-278.206) [-277.741] (-277.651) * (-278.215) (-278.381) (-279.583) [-278.912] -- 0:00:30
489000 -- [-277.975] (-278.981) (-280.945) (-279.346) * (-278.405) [-278.837] (-277.084) (-279.292) -- 0:00:30
489500 -- (-277.565) (-279.500) [-280.932] (-278.298) * (-278.173) (-278.232) [-278.813] (-279.858) -- 0:00:30
490000 -- (-277.889) (-277.036) [-278.264] (-281.741) * (-278.923) [-277.920] (-278.357) (-279.455) -- 0:00:30
Average standard deviation of split frequencies: 0.009367
490500 -- (-279.244) [-278.687] (-278.602) (-280.032) * [-277.677] (-284.539) (-279.418) (-279.868) -- 0:00:30
491000 -- (-279.138) (-278.526) (-277.030) [-278.480] * (-277.013) (-281.128) (-278.532) [-279.052] -- 0:00:30
491500 -- (-278.781) (-281.041) [-278.770] (-279.479) * (-277.386) [-277.546] (-278.111) (-276.878) -- 0:00:30
492000 -- [-278.591] (-277.555) (-281.540) (-277.353) * (-277.383) [-279.419] (-279.171) (-276.977) -- 0:00:29
492500 -- (-277.548) (-280.108) [-277.733] (-278.333) * (-282.816) (-276.651) (-280.115) [-279.760] -- 0:00:29
493000 -- (-278.413) (-276.408) (-279.701) [-278.488] * (-277.528) (-277.925) [-277.876] (-277.172) -- 0:00:29
493500 -- (-284.278) (-287.999) [-277.506] (-276.993) * (-276.883) (-277.253) (-280.798) [-277.139] -- 0:00:29
494000 -- (-280.549) (-280.330) (-277.967) [-279.143] * (-277.840) [-278.914] (-277.515) (-278.523) -- 0:00:29
494500 -- (-278.068) (-278.038) (-281.845) [-277.371] * (-279.898) (-278.313) [-276.781] (-279.817) -- 0:00:29
495000 -- [-278.415] (-279.268) (-284.036) (-278.383) * (-280.705) [-280.351] (-278.134) (-279.184) -- 0:00:29
Average standard deviation of split frequencies: 0.010573
495500 -- (-278.263) (-278.810) [-278.588] (-283.178) * (-278.754) (-282.345) (-282.574) [-277.101] -- 0:00:29
496000 -- [-280.280] (-279.312) (-276.992) (-278.193) * (-279.404) (-279.122) [-279.180] (-280.015) -- 0:00:29
496500 -- (-276.677) (-280.853) (-280.467) [-278.314] * (-278.523) (-280.867) (-277.649) [-281.013] -- 0:00:29
497000 -- (-279.156) (-280.431) (-278.659) [-278.394] * (-278.266) [-280.092] (-277.912) (-276.660) -- 0:00:29
497500 -- [-278.577] (-277.784) (-277.283) (-277.807) * (-278.261) [-276.979] (-278.335) (-277.185) -- 0:00:29
498000 -- [-279.298] (-280.044) (-278.276) (-279.427) * (-279.498) (-278.521) (-278.754) [-278.415] -- 0:00:29
498500 -- (-279.789) [-279.158] (-278.017) (-277.231) * (-280.581) (-279.493) (-279.149) [-276.846] -- 0:00:29
499000 -- [-278.788] (-279.542) (-277.765) (-280.558) * (-278.693) (-279.136) [-279.292] (-277.689) -- 0:00:29
499500 -- (-276.381) [-283.944] (-280.932) (-276.925) * (-285.051) (-277.037) [-282.406] (-277.642) -- 0:00:29
500000 -- (-277.990) (-285.609) [-279.997] (-279.692) * [-279.098] (-278.250) (-286.049) (-277.444) -- 0:00:29
Average standard deviation of split frequencies: 0.010745
500500 -- (-277.197) (-281.508) (-279.536) [-278.279] * [-277.220] (-276.588) (-278.110) (-281.794) -- 0:00:28
501000 -- (-278.092) [-279.391] (-277.052) (-282.600) * (-276.672) (-277.947) [-280.360] (-280.155) -- 0:00:28
501500 -- (-278.101) (-277.557) (-279.177) [-279.170] * [-280.302] (-278.644) (-278.213) (-279.572) -- 0:00:29
502000 -- (-284.618) (-278.284) (-279.446) [-277.546] * (-279.959) [-279.003] (-277.261) (-278.590) -- 0:00:29
502500 -- [-280.331] (-280.607) (-280.431) (-280.734) * (-278.360) [-278.654] (-278.233) (-278.193) -- 0:00:29
503000 -- [-278.865] (-278.099) (-280.240) (-277.363) * (-278.309) (-278.150) (-279.867) [-278.494] -- 0:00:29
503500 -- (-278.255) (-278.667) [-280.982] (-280.094) * (-277.696) (-288.063) (-278.996) [-278.592] -- 0:00:29
504000 -- [-279.661] (-276.429) (-279.350) (-277.085) * (-278.312) (-281.472) (-279.217) [-276.925] -- 0:00:29
504500 -- [-279.470] (-279.667) (-277.188) (-277.542) * (-276.644) (-282.276) (-280.157) [-277.548] -- 0:00:29
505000 -- (-278.063) (-277.742) [-276.632] (-276.862) * [-280.165] (-278.797) (-280.329) (-279.712) -- 0:00:29
Average standard deviation of split frequencies: 0.010662
505500 -- (-281.049) (-278.469) [-279.060] (-278.168) * (-279.593) [-276.920] (-279.862) (-281.979) -- 0:00:29
506000 -- (-279.951) [-280.695] (-278.574) (-277.343) * (-278.192) [-279.227] (-280.111) (-279.556) -- 0:00:29
506500 -- (-280.565) (-278.528) (-279.476) [-277.112] * (-278.307) (-278.241) (-280.407) [-279.810] -- 0:00:29
507000 -- (-279.628) (-276.812) [-279.447] (-279.786) * (-279.249) (-281.502) [-280.657] (-281.124) -- 0:00:29
507500 -- (-278.736) [-277.782] (-277.899) (-281.815) * [-278.834] (-278.928) (-277.414) (-279.508) -- 0:00:29
508000 -- (-280.676) [-278.509] (-283.130) (-277.649) * (-278.982) (-284.879) (-279.414) [-276.722] -- 0:00:29
508500 -- [-282.479] (-277.287) (-290.784) (-279.806) * [-279.362] (-277.682) (-279.731) (-278.921) -- 0:00:28
509000 -- (-281.714) (-277.339) [-276.439] (-279.144) * (-277.512) (-278.937) [-276.782] (-277.234) -- 0:00:28
509500 -- [-282.697] (-279.989) (-280.058) (-277.790) * (-277.953) (-276.789) [-277.590] (-278.099) -- 0:00:28
510000 -- [-277.078] (-277.658) (-284.810) (-277.425) * (-277.984) (-280.679) [-276.827] (-277.211) -- 0:00:28
Average standard deviation of split frequencies: 0.010962
510500 -- (-280.017) (-281.133) [-278.942] (-278.094) * [-278.255] (-277.347) (-276.421) (-276.713) -- 0:00:28
511000 -- (-279.126) (-280.100) (-277.254) [-278.296] * (-277.402) [-278.406] (-279.809) (-278.813) -- 0:00:28
511500 -- (-278.352) [-277.794] (-277.971) (-283.196) * (-279.724) (-279.827) [-280.409] (-278.787) -- 0:00:28
512000 -- (-278.186) (-278.289) [-280.225] (-278.652) * (-278.762) [-276.846] (-278.300) (-278.733) -- 0:00:28
512500 -- (-280.097) (-278.199) (-281.009) [-278.829] * [-278.718] (-277.790) (-277.144) (-281.015) -- 0:00:28
513000 -- [-281.225] (-277.567) (-281.739) (-280.678) * (-277.576) (-276.727) [-283.052] (-279.527) -- 0:00:28
513500 -- (-279.850) (-276.699) (-278.873) [-281.229] * (-277.638) (-276.837) [-280.806] (-279.532) -- 0:00:28
514000 -- (-277.274) [-277.562] (-278.647) (-279.937) * (-277.153) (-281.195) [-280.927] (-276.987) -- 0:00:28
514500 -- [-277.006] (-280.128) (-277.113) (-278.701) * (-278.878) (-277.891) [-278.087] (-281.855) -- 0:00:28
515000 -- (-278.049) (-279.891) (-277.763) [-280.343] * (-280.618) (-281.203) [-277.234] (-278.526) -- 0:00:28
Average standard deviation of split frequencies: 0.010811
515500 -- (-278.626) (-277.037) [-277.180] (-278.691) * (-280.123) (-277.339) (-277.500) [-278.705] -- 0:00:28
516000 -- (-277.300) (-282.110) (-277.489) [-278.057] * [-279.327] (-278.272) (-277.324) (-278.335) -- 0:00:28
516500 -- (-277.817) [-278.634] (-277.461) (-278.545) * [-279.421] (-278.944) (-279.057) (-281.525) -- 0:00:28
517000 -- (-278.262) [-278.064] (-277.361) (-279.714) * [-281.580] (-280.474) (-277.399) (-277.078) -- 0:00:28
517500 -- (-278.912) (-281.334) [-281.385] (-280.254) * (-280.091) [-277.977] (-277.595) (-280.832) -- 0:00:27
518000 -- (-279.769) (-282.410) [-280.443] (-278.690) * (-280.237) (-277.882) [-279.909] (-277.040) -- 0:00:27
518500 -- (-279.492) (-280.556) (-278.705) [-278.892] * [-278.580] (-277.680) (-280.567) (-278.034) -- 0:00:27
519000 -- [-278.016] (-279.120) (-278.674) (-281.840) * (-278.405) (-279.682) [-282.482] (-280.506) -- 0:00:28
519500 -- (-284.402) (-278.773) (-279.377) [-278.632] * [-277.696] (-281.397) (-279.193) (-277.443) -- 0:00:28
520000 -- (-281.400) (-282.680) [-283.809] (-278.708) * (-276.831) (-282.057) [-277.035] (-278.570) -- 0:00:28
Average standard deviation of split frequencies: 0.011066
520500 -- [-276.873] (-278.904) (-280.741) (-278.491) * (-280.860) (-281.001) (-278.472) [-277.354] -- 0:00:28
521000 -- (-279.625) (-283.316) (-277.981) [-276.340] * (-279.677) (-277.126) (-286.111) [-278.463] -- 0:00:28
521500 -- [-278.797] (-278.405) (-280.438) (-278.105) * (-279.331) [-282.817] (-278.292) (-277.323) -- 0:00:28
522000 -- (-279.382) (-277.248) (-277.536) [-277.039] * (-281.816) (-278.617) (-280.424) [-279.012] -- 0:00:28
522500 -- (-279.860) (-277.730) (-277.797) [-277.978] * (-282.965) (-276.896) (-276.896) [-279.099] -- 0:00:28
523000 -- (-280.318) [-276.927] (-276.901) (-278.370) * (-278.287) [-277.339] (-277.217) (-278.673) -- 0:00:28
523500 -- (-278.266) [-276.304] (-276.911) (-278.972) * [-279.092] (-276.835) (-277.176) (-282.653) -- 0:00:28
524000 -- (-277.657) (-279.593) [-278.418] (-284.776) * (-276.782) (-277.600) [-279.769] (-280.088) -- 0:00:28
524500 -- (-277.271) (-278.918) (-277.625) [-276.887] * [-277.574] (-282.924) (-279.142) (-278.154) -- 0:00:28
525000 -- (-277.381) (-280.108) (-277.938) [-277.209] * [-277.056] (-278.840) (-279.527) (-277.968) -- 0:00:28
Average standard deviation of split frequencies: 0.011252
525500 -- (-276.705) (-278.159) [-277.904] (-277.785) * (-276.878) (-279.521) [-278.091] (-277.959) -- 0:00:27
526000 -- [-277.415] (-277.289) (-278.465) (-279.505) * (-277.596) [-278.295] (-277.265) (-279.375) -- 0:00:27
526500 -- (-277.678) (-283.045) [-277.739] (-277.562) * (-278.250) (-278.641) (-277.529) [-277.310] -- 0:00:27
527000 -- (-278.489) (-281.357) (-280.916) [-277.460] * (-277.114) [-279.359] (-278.739) (-278.858) -- 0:00:27
527500 -- [-277.163] (-278.844) (-278.172) (-276.517) * [-282.179] (-277.067) (-277.695) (-278.259) -- 0:00:27
528000 -- (-280.426) (-281.885) [-277.363] (-280.618) * (-278.478) (-277.560) (-279.389) [-277.508] -- 0:00:27
528500 -- (-280.842) (-278.961) [-277.938] (-281.344) * [-277.271] (-277.746) (-277.901) (-278.131) -- 0:00:27
529000 -- (-279.249) (-278.046) [-278.933] (-278.183) * (-278.516) [-276.528] (-279.054) (-278.126) -- 0:00:27
529500 -- (-278.772) (-278.968) (-278.686) [-277.966] * (-277.256) (-277.053) [-277.708] (-282.536) -- 0:00:27
530000 -- [-279.196] (-280.721) (-276.787) (-277.934) * (-279.550) (-277.636) [-280.210] (-279.365) -- 0:00:27
Average standard deviation of split frequencies: 0.011339
530500 -- [-277.950] (-280.257) (-279.703) (-277.712) * [-278.613] (-278.056) (-282.520) (-282.203) -- 0:00:27
531000 -- (-279.672) [-276.865] (-279.502) (-279.345) * (-279.893) (-277.962) (-280.987) [-280.529] -- 0:00:27
531500 -- [-280.803] (-276.637) (-276.529) (-283.914) * [-279.207] (-278.383) (-278.147) (-281.474) -- 0:00:27
532000 -- (-277.714) (-279.163) (-279.689) [-278.134] * (-279.898) [-277.442] (-279.189) (-278.636) -- 0:00:27
532500 -- (-280.366) [-276.924] (-278.942) (-277.180) * (-280.202) [-277.450] (-278.464) (-279.229) -- 0:00:27
533000 -- (-282.501) (-280.210) [-278.070] (-278.151) * (-277.299) (-279.227) [-278.133] (-277.926) -- 0:00:27
533500 -- (-278.242) (-278.770) [-277.485] (-277.496) * (-277.339) [-281.259] (-279.025) (-277.049) -- 0:00:27
534000 -- (-280.330) (-279.522) (-279.155) [-279.207] * (-277.423) (-278.690) (-278.250) [-278.063] -- 0:00:27
534500 -- (-278.653) (-287.229) [-277.215] (-284.263) * (-276.894) (-281.463) [-278.760] (-282.537) -- 0:00:26
535000 -- (-276.890) (-279.422) [-280.121] (-278.221) * (-277.532) (-278.134) [-281.436] (-278.785) -- 0:00:26
Average standard deviation of split frequencies: 0.010612
535500 -- (-277.935) [-276.847] (-277.811) (-281.338) * (-276.383) [-276.690] (-280.892) (-281.522) -- 0:00:26
536000 -- [-278.647] (-280.987) (-278.647) (-282.940) * (-277.563) [-278.029] (-276.545) (-279.697) -- 0:00:27
536500 -- (-281.890) [-277.277] (-280.552) (-282.647) * (-279.818) (-276.831) [-277.193] (-280.911) -- 0:00:27
537000 -- (-278.425) (-277.080) (-278.241) [-278.298] * [-278.842] (-280.143) (-279.244) (-278.475) -- 0:00:27
537500 -- (-277.588) [-281.147] (-276.385) (-276.641) * (-278.040) (-278.170) [-280.840] (-279.626) -- 0:00:27
538000 -- (-279.330) [-277.594] (-278.012) (-278.513) * (-276.977) (-277.107) [-281.681] (-278.324) -- 0:00:27
538500 -- (-279.208) [-277.911] (-278.874) (-282.892) * (-276.899) [-278.901] (-282.879) (-279.853) -- 0:00:27
539000 -- [-276.798] (-281.524) (-281.084) (-280.349) * (-276.960) (-277.157) [-281.023] (-277.852) -- 0:00:27
539500 -- (-277.783) (-278.195) [-277.936] (-280.509) * [-278.173] (-280.670) (-278.738) (-279.026) -- 0:00:27
540000 -- [-277.092] (-276.419) (-276.942) (-280.163) * [-277.722] (-278.601) (-281.640) (-277.923) -- 0:00:27
Average standard deviation of split frequencies: 0.011008
540500 -- [-276.929] (-277.296) (-279.126) (-279.807) * [-277.580] (-280.767) (-277.978) (-279.259) -- 0:00:27
541000 -- (-279.840) [-277.459] (-276.987) (-277.817) * (-278.169) [-279.850] (-279.701) (-279.935) -- 0:00:27
541500 -- (-281.844) (-280.631) (-279.482) [-278.694] * (-277.678) (-279.968) (-278.702) [-277.718] -- 0:00:27
542000 -- (-278.337) [-277.641] (-278.591) (-277.918) * (-278.157) (-277.016) [-277.690] (-281.078) -- 0:00:27
542500 -- (-285.086) (-278.291) [-280.208] (-278.496) * (-277.366) (-279.578) (-276.696) [-282.065] -- 0:00:26
543000 -- (-279.978) (-277.840) [-278.179] (-279.279) * (-279.401) (-277.028) [-280.118] (-280.446) -- 0:00:26
543500 -- (-277.715) (-279.621) [-277.959] (-278.834) * (-278.235) (-276.886) [-278.632] (-277.314) -- 0:00:26
544000 -- (-284.765) (-278.282) [-279.972] (-277.063) * (-280.096) (-278.575) [-277.169] (-282.570) -- 0:00:26
544500 -- (-279.401) [-279.907] (-280.568) (-277.969) * (-279.935) [-276.704] (-282.814) (-278.321) -- 0:00:26
545000 -- (-277.264) (-280.112) (-279.483) [-278.424] * (-278.222) (-277.608) (-277.257) [-278.578] -- 0:00:26
Average standard deviation of split frequencies: 0.010840
545500 -- (-277.940) (-279.633) [-278.340] (-279.402) * [-280.227] (-278.805) (-283.457) (-277.112) -- 0:00:26
546000 -- [-281.389] (-277.707) (-276.636) (-276.443) * (-280.354) (-278.566) (-282.350) [-277.526] -- 0:00:26
546500 -- (-284.994) (-285.536) [-279.625] (-281.109) * (-279.355) (-277.043) [-278.966] (-281.091) -- 0:00:26
547000 -- (-279.283) (-277.546) [-278.140] (-286.496) * (-279.246) (-277.665) [-279.268] (-283.185) -- 0:00:26
547500 -- (-276.636) (-280.660) (-278.939) [-280.645] * [-277.943] (-278.541) (-277.107) (-281.975) -- 0:00:26
548000 -- [-279.238] (-278.738) (-277.846) (-280.667) * (-277.797) (-276.706) [-278.104] (-277.002) -- 0:00:26
548500 -- [-277.605] (-280.663) (-279.835) (-276.752) * (-278.074) (-277.819) (-277.547) [-279.199] -- 0:00:26
549000 -- (-278.351) (-278.150) (-278.508) [-279.570] * (-279.868) (-278.061) (-277.694) [-277.693] -- 0:00:26
549500 -- (-278.068) (-278.091) (-278.342) [-279.085] * (-280.398) [-279.322] (-285.001) (-279.542) -- 0:00:26
550000 -- (-281.745) (-276.808) [-280.031] (-277.660) * (-279.472) (-280.728) [-276.493] (-277.702) -- 0:00:26
Average standard deviation of split frequencies: 0.010726
550500 -- (-277.421) (-277.149) [-277.046] (-278.008) * (-278.912) (-277.744) (-277.083) [-278.092] -- 0:00:26
551000 -- (-279.481) (-281.608) [-279.502] (-284.390) * (-284.082) (-277.052) (-278.349) [-277.813] -- 0:00:26
551500 -- (-282.241) (-277.494) (-277.023) [-282.891] * (-278.568) (-277.571) (-279.813) [-277.034] -- 0:00:26
552000 -- (-278.567) (-281.108) (-277.425) [-280.840] * (-279.064) (-277.338) [-278.757] (-276.779) -- 0:00:25
552500 -- [-276.869] (-279.573) (-278.348) (-282.979) * (-281.891) (-277.476) [-277.895] (-278.995) -- 0:00:25
553000 -- (-280.267) (-277.727) (-282.744) [-277.181] * (-278.674) [-276.860] (-277.134) (-277.546) -- 0:00:26
553500 -- (-278.007) [-279.099] (-281.845) (-279.799) * (-278.583) (-280.393) (-287.424) [-276.981] -- 0:00:26
554000 -- (-281.483) (-279.485) [-278.394] (-281.013) * (-278.120) [-276.656] (-278.825) (-286.336) -- 0:00:26
554500 -- (-281.987) [-279.932] (-277.763) (-279.177) * (-277.725) (-279.840) [-278.600] (-279.120) -- 0:00:26
555000 -- (-276.800) (-279.089) [-278.147] (-277.527) * (-280.303) (-278.307) (-278.638) [-280.285] -- 0:00:26
Average standard deviation of split frequencies: 0.011172
555500 -- (-278.599) (-277.691) (-279.689) [-279.761] * [-278.629] (-281.143) (-280.330) (-277.218) -- 0:00:26
556000 -- (-279.312) (-283.051) [-279.942] (-279.204) * (-280.849) [-278.532] (-278.772) (-278.164) -- 0:00:26
556500 -- (-278.807) [-278.528] (-282.925) (-278.411) * [-277.550] (-282.670) (-277.222) (-286.847) -- 0:00:26
557000 -- (-278.036) (-276.646) [-278.925] (-279.771) * (-277.835) (-278.615) (-282.716) [-278.655] -- 0:00:26
557500 -- (-278.213) [-278.845] (-279.969) (-278.820) * [-279.414] (-278.928) (-278.580) (-276.927) -- 0:00:26
558000 -- (-276.715) [-279.508] (-277.659) (-279.026) * (-279.711) (-280.305) (-279.316) [-277.656] -- 0:00:26
558500 -- [-278.684] (-279.047) (-278.373) (-281.895) * (-278.777) [-278.955] (-278.494) (-277.216) -- 0:00:26
559000 -- (-276.944) [-277.834] (-279.669) (-286.222) * (-278.031) (-278.955) [-278.250] (-278.718) -- 0:00:26
559500 -- (-280.453) (-282.898) (-280.378) [-279.623] * (-286.235) (-277.632) (-277.050) [-282.926] -- 0:00:25
560000 -- (-276.702) (-279.684) (-280.448) [-276.363] * (-280.399) (-277.329) [-282.743] (-280.608) -- 0:00:25
Average standard deviation of split frequencies: 0.011079
560500 -- (-277.266) [-277.876] (-279.024) (-278.163) * (-279.193) [-281.787] (-277.791) (-278.938) -- 0:00:25
561000 -- [-279.549] (-277.909) (-279.624) (-284.510) * [-278.848] (-277.962) (-280.430) (-278.152) -- 0:00:25
561500 -- (-280.708) (-281.953) (-276.593) [-279.159] * (-279.110) (-280.779) (-278.527) [-277.962] -- 0:00:25
562000 -- [-277.424] (-281.839) (-279.342) (-279.454) * (-277.276) [-277.914] (-283.068) (-278.425) -- 0:00:25
562500 -- (-279.373) (-280.226) (-279.486) [-280.431] * (-280.234) (-279.398) [-277.336] (-277.756) -- 0:00:25
563000 -- [-281.577] (-279.421) (-277.946) (-280.672) * (-281.228) (-283.505) (-280.622) [-280.390] -- 0:00:25
563500 -- (-280.858) [-278.425] (-279.006) (-278.225) * (-277.941) (-279.506) (-282.234) [-277.910] -- 0:00:25
564000 -- [-277.305] (-279.652) (-278.733) (-278.413) * (-279.556) [-278.284] (-281.226) (-278.092) -- 0:00:25
564500 -- (-277.786) [-277.101] (-276.939) (-279.367) * (-278.010) (-281.718) (-278.387) [-277.765] -- 0:00:25
565000 -- (-281.932) (-280.785) [-277.127] (-279.822) * (-276.446) (-278.352) (-278.474) [-277.762] -- 0:00:25
Average standard deviation of split frequencies: 0.010876
565500 -- [-277.732] (-277.954) (-277.991) (-288.852) * (-278.769) (-281.064) (-280.203) [-279.216] -- 0:00:25
566000 -- (-277.479) (-277.129) [-278.756] (-278.985) * [-279.243] (-280.194) (-279.306) (-278.837) -- 0:00:25
566500 -- (-278.789) [-276.776] (-278.771) (-278.972) * [-280.166] (-281.546) (-278.627) (-277.337) -- 0:00:25
567000 -- [-276.900] (-277.057) (-277.334) (-276.797) * (-279.580) (-278.553) [-276.740] (-279.872) -- 0:00:25
567500 -- [-278.374] (-282.859) (-278.532) (-280.174) * (-280.711) [-281.189] (-277.504) (-281.298) -- 0:00:25
568000 -- (-277.687) [-284.101] (-276.948) (-276.779) * (-277.969) (-277.131) (-277.839) [-278.613] -- 0:00:25
568500 -- (-280.002) (-287.085) [-278.901] (-279.656) * (-277.622) [-279.386] (-278.471) (-278.559) -- 0:00:25
569000 -- [-279.521] (-283.128) (-278.929) (-276.855) * [-278.035] (-278.846) (-279.665) (-278.256) -- 0:00:24
569500 -- [-277.516] (-284.879) (-279.721) (-277.547) * (-278.991) [-277.645] (-278.357) (-276.590) -- 0:00:24
570000 -- (-277.664) (-278.535) [-278.937] (-285.113) * (-277.335) [-281.762] (-280.932) (-277.029) -- 0:00:25
Average standard deviation of split frequencies: 0.010555
570500 -- (-280.361) (-277.995) (-280.642) [-278.774] * (-277.691) (-287.877) (-276.933) [-276.755] -- 0:00:25
571000 -- [-276.961] (-277.583) (-278.507) (-277.159) * (-278.521) (-282.142) [-278.591] (-278.672) -- 0:00:25
571500 -- (-277.946) (-277.626) (-283.291) [-278.246] * (-277.894) (-280.207) (-277.043) [-277.883] -- 0:00:25
572000 -- (-278.305) (-279.987) (-284.341) [-277.162] * (-276.727) (-280.183) (-280.021) [-282.659] -- 0:00:25
572500 -- [-279.423] (-277.609) (-288.559) (-280.250) * (-277.787) [-277.322] (-283.051) (-276.968) -- 0:00:25
573000 -- (-277.074) [-280.214] (-285.569) (-277.411) * (-278.482) (-278.017) [-279.229] (-277.188) -- 0:00:25
573500 -- [-277.458] (-282.455) (-283.902) (-277.508) * (-281.149) [-278.956] (-280.348) (-277.272) -- 0:00:25
574000 -- (-278.666) [-279.615] (-281.229) (-277.051) * (-282.275) (-277.704) [-278.241] (-278.137) -- 0:00:25
574500 -- (-282.992) (-283.134) (-279.543) [-278.478] * (-278.836) (-281.279) (-279.232) [-276.998] -- 0:00:25
575000 -- [-280.073] (-281.319) (-277.818) (-279.148) * (-280.154) (-278.440) [-282.760] (-277.111) -- 0:00:25
Average standard deviation of split frequencies: 0.010503
575500 -- (-281.578) (-280.841) [-276.654] (-277.620) * (-278.214) (-280.217) [-278.234] (-278.701) -- 0:00:25
576000 -- (-280.635) (-279.288) (-279.286) [-278.629] * (-280.455) (-278.597) (-277.605) [-280.505] -- 0:00:25
576500 -- (-277.599) (-278.704) (-279.232) [-277.543] * (-278.174) (-280.717) [-277.717] (-279.609) -- 0:00:24
577000 -- (-280.076) (-279.471) [-277.549] (-281.556) * (-278.084) (-278.346) (-279.832) [-277.831] -- 0:00:24
577500 -- [-278.466] (-279.893) (-280.352) (-278.725) * [-278.084] (-279.080) (-279.017) (-279.879) -- 0:00:24
578000 -- [-281.709] (-278.482) (-281.312) (-277.773) * (-277.891) (-277.909) (-278.099) [-279.460] -- 0:00:24
578500 -- (-279.896) (-284.671) (-281.262) [-279.426] * (-278.531) [-277.113] (-280.366) (-281.850) -- 0:00:24
579000 -- (-279.833) (-279.258) [-278.380] (-280.063) * [-287.245] (-276.691) (-282.047) (-282.088) -- 0:00:24
579500 -- [-278.714] (-282.113) (-281.991) (-279.184) * (-282.601) [-276.853] (-280.326) (-278.090) -- 0:00:24
580000 -- (-277.312) (-280.813) [-281.614] (-280.061) * [-280.331] (-277.211) (-278.418) (-278.992) -- 0:00:24
Average standard deviation of split frequencies: 0.010644
580500 -- [-280.230] (-278.047) (-278.835) (-281.308) * (-284.501) (-277.353) [-281.597] (-278.779) -- 0:00:24
581000 -- [-278.443] (-278.003) (-280.002) (-278.510) * (-276.941) [-280.595] (-277.958) (-277.953) -- 0:00:24
581500 -- (-278.684) [-281.140] (-279.505) (-276.428) * (-280.813) (-277.254) [-278.174] (-278.539) -- 0:00:24
582000 -- [-278.281] (-278.060) (-277.437) (-281.129) * [-279.591] (-278.222) (-283.599) (-276.862) -- 0:00:24
582500 -- (-278.071) (-283.126) [-277.628] (-278.060) * (-279.264) (-279.001) (-281.542) [-276.597] -- 0:00:24
583000 -- (-276.973) [-278.752] (-278.610) (-279.519) * (-278.348) (-277.065) [-279.501] (-281.175) -- 0:00:24
583500 -- [-277.691] (-278.940) (-279.406) (-279.004) * (-278.978) [-278.062] (-280.879) (-281.281) -- 0:00:24
584000 -- [-278.576] (-281.219) (-279.608) (-276.636) * [-278.280] (-277.685) (-277.643) (-282.040) -- 0:00:24
584500 -- (-280.592) (-279.542) (-277.859) [-278.181] * (-278.680) (-276.389) [-278.669] (-277.875) -- 0:00:24
585000 -- [-280.449] (-279.605) (-278.508) (-277.346) * (-278.246) (-278.191) [-278.841] (-277.963) -- 0:00:24
Average standard deviation of split frequencies: 0.010637
585500 -- (-279.415) [-277.655] (-279.983) (-277.088) * (-279.367) (-279.243) [-279.253] (-282.317) -- 0:00:24
586000 -- [-277.048] (-280.695) (-277.726) (-276.935) * (-278.544) (-276.905) [-284.039] (-280.190) -- 0:00:24
586500 -- (-276.398) [-280.953] (-276.937) (-280.718) * [-282.338] (-277.501) (-277.724) (-280.033) -- 0:00:23
587000 -- [-281.805] (-278.477) (-281.251) (-283.731) * (-277.364) (-279.084) (-278.506) [-277.986] -- 0:00:24
587500 -- (-280.784) (-277.686) (-278.426) [-278.832] * (-276.739) (-279.825) (-278.066) [-281.499] -- 0:00:24
588000 -- (-279.015) (-279.019) (-278.179) [-278.918] * (-277.110) (-283.584) (-280.088) [-279.056] -- 0:00:24
588500 -- (-277.405) (-278.532) [-276.949] (-283.193) * [-280.214] (-281.114) (-282.517) (-279.755) -- 0:00:24
589000 -- [-277.547] (-278.416) (-279.415) (-281.770) * (-277.282) [-280.564] (-277.024) (-282.475) -- 0:00:24
589500 -- (-280.058) [-277.403] (-278.247) (-279.874) * [-278.595] (-278.695) (-277.777) (-277.786) -- 0:00:24
590000 -- (-278.982) [-280.249] (-277.721) (-276.854) * (-279.062) [-278.014] (-280.517) (-279.062) -- 0:00:24
Average standard deviation of split frequencies: 0.010375
590500 -- (-279.972) (-282.766) [-278.337] (-277.492) * (-278.810) [-277.613] (-281.003) (-277.090) -- 0:00:24
591000 -- (-277.247) [-278.114] (-279.259) (-280.767) * (-279.951) [-278.559] (-279.154) (-277.829) -- 0:00:24
591500 -- (-278.686) (-280.658) [-287.004] (-276.940) * (-276.849) (-277.248) [-280.330] (-278.585) -- 0:00:24
592000 -- (-278.008) (-279.319) [-276.683] (-278.850) * (-283.800) (-278.996) (-277.327) [-279.113] -- 0:00:24
592500 -- (-278.363) [-277.567] (-277.259) (-281.253) * (-278.204) [-277.983] (-278.175) (-278.436) -- 0:00:24
593000 -- (-279.005) [-277.008] (-277.854) (-279.685) * (-278.454) [-278.739] (-280.899) (-278.295) -- 0:00:24
593500 -- (-286.077) (-278.860) [-276.371] (-282.024) * [-279.688] (-278.711) (-280.036) (-277.279) -- 0:00:23
594000 -- (-279.252) (-277.710) [-278.645] (-279.604) * (-277.414) (-278.755) (-280.490) [-278.200] -- 0:00:23
594500 -- (-279.221) [-279.966] (-277.005) (-277.778) * (-282.113) (-279.795) [-279.515] (-278.162) -- 0:00:23
595000 -- (-280.842) (-277.400) [-276.978] (-278.485) * (-278.177) (-281.240) [-278.817] (-278.115) -- 0:00:23
Average standard deviation of split frequencies: 0.010326
595500 -- (-277.918) [-280.076] (-278.292) (-277.230) * (-280.557) (-277.974) [-280.367] (-281.174) -- 0:00:23
596000 -- (-276.538) [-276.870] (-278.661) (-281.455) * (-277.844) (-283.084) [-278.706] (-277.129) -- 0:00:23
596500 -- (-277.824) [-278.444] (-280.332) (-277.036) * (-277.746) (-277.769) [-279.239] (-279.354) -- 0:00:23
597000 -- (-277.700) (-281.312) [-281.246] (-277.577) * (-278.808) (-285.495) [-277.749] (-281.026) -- 0:00:23
597500 -- [-276.671] (-277.381) (-278.449) (-276.912) * [-278.227] (-279.003) (-276.612) (-281.668) -- 0:00:23
598000 -- (-277.844) (-277.450) [-279.212] (-281.528) * (-278.095) (-277.790) [-279.779] (-279.699) -- 0:00:23
598500 -- (-278.007) [-278.602] (-280.931) (-278.275) * (-278.445) (-277.072) (-278.821) [-277.804] -- 0:00:23
599000 -- (-279.644) (-280.354) (-278.567) [-280.067] * (-278.887) (-277.031) [-276.421] (-277.964) -- 0:00:23
599500 -- (-281.460) (-279.901) (-277.432) [-279.342] * (-278.271) [-278.622] (-277.463) (-281.987) -- 0:00:23
600000 -- (-276.786) (-276.274) (-279.965) [-276.676] * (-279.717) [-278.705] (-284.329) (-279.758) -- 0:00:23
Average standard deviation of split frequencies: 0.009695
600500 -- (-276.899) (-276.230) [-279.054] (-278.705) * (-276.968) (-280.983) (-284.144) [-277.206] -- 0:00:23
601000 -- (-279.034) (-277.158) [-277.039] (-276.820) * [-276.689] (-279.563) (-280.448) (-278.142) -- 0:00:23
601500 -- (-278.500) (-276.741) [-281.550] (-279.797) * (-277.704) (-277.709) [-277.577] (-281.648) -- 0:00:23
602000 -- [-278.658] (-276.538) (-280.661) (-277.918) * [-279.420] (-281.504) (-277.588) (-281.933) -- 0:00:23
602500 -- (-280.186) (-276.773) [-277.798] (-278.594) * (-279.923) [-278.903] (-277.312) (-280.144) -- 0:00:23
603000 -- (-278.985) (-277.698) (-278.607) [-278.041] * (-277.570) (-278.777) (-279.813) [-280.213] -- 0:00:23
603500 -- (-289.600) (-277.301) [-281.421] (-277.105) * (-277.837) (-277.839) (-282.019) [-279.286] -- 0:00:22
604000 -- (-281.798) [-277.626] (-279.250) (-277.806) * (-277.879) (-277.375) (-281.882) [-281.510] -- 0:00:23
604500 -- (-279.415) [-278.993] (-277.652) (-276.517) * [-277.440] (-278.812) (-282.375) (-284.245) -- 0:00:23
605000 -- [-278.197] (-279.723) (-277.641) (-276.648) * (-278.252) (-282.179) [-277.012] (-277.479) -- 0:00:23
Average standard deviation of split frequencies: 0.009701
605500 -- (-279.677) (-277.148) (-285.118) [-277.793] * (-277.952) (-278.134) [-276.806] (-276.328) -- 0:00:23
606000 -- [-277.526] (-276.958) (-277.216) (-279.667) * (-276.724) (-277.112) (-277.861) [-277.372] -- 0:00:23
606500 -- [-278.162] (-278.287) (-279.234) (-279.907) * (-277.139) (-279.708) (-280.506) [-279.234] -- 0:00:23
607000 -- [-278.635] (-278.922) (-278.080) (-281.133) * (-277.147) (-281.258) (-278.722) [-281.022] -- 0:00:23
607500 -- [-277.399] (-280.802) (-278.322) (-282.360) * (-278.112) [-280.655] (-278.101) (-282.987) -- 0:00:23
608000 -- [-277.346] (-280.180) (-279.502) (-280.462) * (-277.045) (-277.860) [-276.930] (-280.947) -- 0:00:23
608500 -- (-277.406) (-283.294) [-278.607] (-278.304) * (-277.848) (-280.347) (-277.244) [-278.577] -- 0:00:23
609000 -- (-277.438) (-279.533) [-279.302] (-277.869) * (-279.198) [-277.917] (-277.225) (-279.543) -- 0:00:23
609500 -- (-278.130) (-278.303) [-277.606] (-278.055) * (-279.063) [-277.443] (-277.829) (-280.512) -- 0:00:23
610000 -- (-279.046) [-278.377] (-278.234) (-282.047) * (-278.316) (-278.915) [-277.552] (-280.403) -- 0:00:23
Average standard deviation of split frequencies: 0.009794
610500 -- (-278.293) [-277.394] (-280.241) (-280.250) * [-276.950] (-278.449) (-277.946) (-283.454) -- 0:00:22
611000 -- (-278.929) (-277.143) (-277.515) [-278.499] * (-281.746) (-281.696) [-278.718] (-281.008) -- 0:00:22
611500 -- (-277.708) [-280.813] (-278.077) (-276.599) * (-280.358) (-277.479) [-278.726] (-280.006) -- 0:00:22
612000 -- [-277.414] (-280.487) (-278.780) (-277.191) * (-281.319) (-280.342) [-278.228] (-278.830) -- 0:00:22
612500 -- (-279.624) (-278.194) (-277.436) [-277.698] * (-277.969) (-282.350) (-278.052) [-277.042] -- 0:00:22
613000 -- [-279.192] (-277.782) (-280.336) (-281.205) * (-278.371) (-277.552) [-277.837] (-280.538) -- 0:00:22
613500 -- [-277.862] (-277.760) (-279.196) (-285.390) * [-277.095] (-277.981) (-279.874) (-279.608) -- 0:00:22
614000 -- (-277.694) [-278.521] (-279.695) (-286.979) * [-280.897] (-280.269) (-277.360) (-276.449) -- 0:00:22
614500 -- (-278.524) [-280.048] (-277.161) (-282.133) * (-277.884) [-279.721] (-276.848) (-277.554) -- 0:00:22
615000 -- (-278.343) [-278.398] (-277.704) (-277.383) * [-277.881] (-278.491) (-280.458) (-280.130) -- 0:00:22
Average standard deviation of split frequencies: 0.008944
615500 -- (-278.280) [-277.110] (-283.131) (-277.794) * (-278.602) (-280.660) [-276.885] (-278.511) -- 0:00:22
616000 -- (-279.075) (-278.266) [-276.590] (-279.003) * [-276.523] (-280.333) (-278.018) (-276.805) -- 0:00:22
616500 -- (-281.338) (-277.345) [-278.367] (-278.501) * (-278.875) (-282.754) (-279.815) [-278.587] -- 0:00:22
617000 -- (-276.614) (-279.493) (-280.588) [-278.604] * (-278.446) [-279.205] (-278.876) (-280.506) -- 0:00:22
617500 -- (-277.108) (-283.304) (-282.967) [-277.415] * (-278.298) [-283.002] (-278.822) (-279.937) -- 0:00:22
618000 -- [-276.648] (-280.530) (-280.118) (-277.953) * (-278.689) (-284.022) (-278.475) [-276.468] -- 0:00:22
618500 -- [-280.831] (-278.430) (-276.794) (-279.391) * (-279.061) (-280.222) (-277.473) [-277.290] -- 0:00:22
619000 -- (-280.214) (-281.148) [-278.276] (-281.680) * [-277.694] (-278.914) (-279.662) (-277.531) -- 0:00:22
619500 -- [-276.586] (-278.596) (-276.728) (-281.215) * (-279.819) (-278.487) [-277.110] (-280.883) -- 0:00:22
620000 -- [-277.251] (-277.558) (-276.851) (-278.124) * (-278.137) (-278.325) [-276.992] (-279.077) -- 0:00:22
Average standard deviation of split frequencies: 0.008304
620500 -- (-287.976) (-278.119) [-281.059] (-281.437) * (-279.933) [-276.468] (-280.119) (-278.167) -- 0:00:22
621000 -- [-280.991] (-276.904) (-278.642) (-276.617) * [-279.104] (-280.836) (-278.752) (-276.996) -- 0:00:22
621500 -- (-278.679) (-281.280) (-278.158) [-277.445] * (-277.749) (-283.715) (-278.746) [-277.566] -- 0:00:22
622000 -- (-277.922) (-279.058) [-281.057] (-278.736) * (-277.465) (-278.380) [-282.258] (-279.362) -- 0:00:22
622500 -- [-279.622] (-278.626) (-278.978) (-281.481) * (-278.778) [-277.681] (-282.404) (-280.212) -- 0:00:22
623000 -- (-277.172) (-279.143) [-279.498] (-279.062) * (-277.933) [-277.614] (-281.194) (-278.684) -- 0:00:22
623500 -- (-279.044) (-280.532) [-281.153] (-277.820) * (-279.931) [-279.643] (-281.607) (-279.311) -- 0:00:22
624000 -- (-279.747) (-280.225) (-277.045) [-279.159] * (-278.763) [-279.747] (-276.754) (-281.258) -- 0:00:22
624500 -- (-284.610) (-280.543) (-277.190) [-277.347] * (-277.386) (-278.882) (-281.557) [-279.321] -- 0:00:22
625000 -- [-277.171] (-278.774) (-280.743) (-281.850) * [-276.954] (-276.687) (-279.657) (-278.024) -- 0:00:22
Average standard deviation of split frequencies: 0.008635
625500 -- [-278.476] (-277.855) (-277.782) (-279.757) * (-277.104) [-277.237] (-278.616) (-276.806) -- 0:00:22
626000 -- (-277.068) [-276.873] (-277.925) (-277.671) * (-278.779) (-279.316) (-278.323) [-277.029] -- 0:00:22
626500 -- (-277.738) [-280.859] (-281.487) (-283.302) * (-277.667) (-278.119) (-276.688) [-281.677] -- 0:00:22
627000 -- (-276.909) [-283.654] (-278.647) (-279.030) * (-279.393) (-277.224) (-278.927) [-277.809] -- 0:00:22
627500 -- (-277.917) (-280.829) (-279.096) [-276.598] * (-281.129) (-277.342) (-279.870) [-278.458] -- 0:00:21
628000 -- [-277.378] (-279.447) (-278.238) (-280.464) * (-277.321) (-279.975) [-278.118] (-277.218) -- 0:00:21
628500 -- [-277.432] (-276.526) (-278.474) (-277.593) * (-278.678) (-280.256) (-282.530) [-276.702] -- 0:00:21
629000 -- (-277.811) (-277.665) [-277.460] (-281.492) * (-277.939) (-276.669) [-279.644] (-278.512) -- 0:00:21
629500 -- [-279.230] (-277.064) (-279.010) (-280.575) * (-280.164) (-277.098) [-276.616] (-278.422) -- 0:00:21
630000 -- (-277.782) (-280.828) (-281.179) [-279.888] * (-280.949) (-277.364) (-279.135) [-280.487] -- 0:00:21
Average standard deviation of split frequencies: 0.008322
630500 -- (-281.018) (-278.302) [-277.268] (-281.501) * (-277.113) (-281.831) (-277.640) [-276.495] -- 0:00:21
631000 -- (-279.794) (-280.066) [-279.119] (-277.615) * (-281.776) [-278.099] (-278.659) (-279.447) -- 0:00:21
631500 -- [-281.957] (-279.957) (-279.379) (-279.817) * (-280.798) (-279.671) [-278.337] (-282.755) -- 0:00:21
632000 -- (-280.390) [-277.214] (-280.066) (-280.872) * (-279.232) (-278.486) [-277.652] (-279.426) -- 0:00:21
632500 -- (-282.333) (-276.955) (-276.567) [-278.695] * (-282.275) [-279.845] (-277.944) (-279.567) -- 0:00:21
633000 -- (-280.118) (-278.027) (-279.171) [-279.067] * (-279.076) [-279.810] (-279.654) (-278.614) -- 0:00:21
633500 -- (-280.259) (-278.118) [-276.651] (-278.017) * [-277.079] (-278.118) (-278.988) (-280.313) -- 0:00:21
634000 -- (-277.955) (-277.871) (-277.914) [-278.977] * (-279.692) [-278.332] (-277.551) (-280.385) -- 0:00:21
634500 -- (-277.395) [-276.867] (-283.630) (-276.996) * (-285.127) (-280.863) [-280.259] (-278.083) -- 0:00:21
635000 -- (-276.864) (-279.788) (-281.971) [-279.101] * (-282.330) [-279.069] (-278.297) (-277.294) -- 0:00:21
Average standard deviation of split frequencies: 0.008598
635500 -- [-278.085] (-278.384) (-280.401) (-281.292) * (-278.928) (-276.977) [-277.470] (-278.453) -- 0:00:21
636000 -- (-282.965) (-284.230) (-280.133) [-282.394] * (-278.528) (-284.238) (-280.916) [-277.503] -- 0:00:21
636500 -- (-281.537) [-283.449] (-276.638) (-278.711) * (-278.957) (-278.401) (-279.950) [-278.505] -- 0:00:21
637000 -- (-278.519) (-279.175) (-276.261) [-280.116] * (-278.516) (-277.763) [-279.570] (-277.063) -- 0:00:21
637500 -- [-277.610] (-280.071) (-282.834) (-279.475) * (-277.695) (-278.975) (-281.222) [-279.991] -- 0:00:21
638000 -- (-276.807) [-280.302] (-277.005) (-281.328) * [-281.210] (-276.548) (-281.308) (-277.052) -- 0:00:21
638500 -- (-277.325) (-282.633) (-280.397) [-278.302] * (-278.953) (-276.564) [-277.637] (-281.556) -- 0:00:21
639000 -- (-280.059) [-279.413] (-280.861) (-277.969) * (-276.852) (-277.852) [-278.930] (-278.575) -- 0:00:21
639500 -- [-278.481] (-279.584) (-280.823) (-277.087) * (-278.878) (-277.008) [-278.309] (-280.697) -- 0:00:21
640000 -- (-280.380) (-280.498) (-278.351) [-279.370] * (-277.590) (-278.257) [-278.020] (-279.716) -- 0:00:21
Average standard deviation of split frequencies: 0.007849
640500 -- (-277.323) (-277.775) [-277.993] (-279.904) * (-278.116) (-277.507) (-277.561) [-278.895] -- 0:00:21
641000 -- (-278.293) (-285.418) [-278.292] (-276.674) * (-280.769) [-277.093] (-280.407) (-283.030) -- 0:00:21
641500 -- (-277.895) [-283.927] (-278.176) (-276.952) * [-282.050] (-279.674) (-277.076) (-284.773) -- 0:00:21
642000 -- (-278.688) [-278.087] (-277.889) (-280.955) * (-277.391) [-277.082] (-277.073) (-280.739) -- 0:00:21
642500 -- (-280.198) (-285.327) (-278.543) [-277.020] * [-279.063] (-282.222) (-280.955) (-280.354) -- 0:00:21
643000 -- [-280.013] (-287.638) (-277.488) (-279.403) * [-277.612] (-279.828) (-281.500) (-277.804) -- 0:00:21
643500 -- (-280.164) (-279.195) (-279.030) [-278.137] * [-278.515] (-278.414) (-277.302) (-276.335) -- 0:00:21
644000 -- [-277.904] (-280.713) (-279.921) (-278.131) * (-276.666) (-278.224) (-279.303) [-276.451] -- 0:00:21
644500 -- [-281.102] (-278.863) (-279.899) (-280.091) * (-277.837) (-278.180) [-277.322] (-278.714) -- 0:00:20
645000 -- (-278.588) (-276.904) [-278.956] (-279.285) * (-278.207) [-278.303] (-277.756) (-280.129) -- 0:00:20
Average standard deviation of split frequencies: 0.008124
645500 -- (-278.277) (-280.827) [-280.486] (-278.871) * (-288.170) (-276.630) [-277.504] (-281.494) -- 0:00:20
646000 -- (-277.955) [-277.320] (-282.283) (-279.271) * (-281.511) (-279.029) (-277.300) [-277.769] -- 0:00:20
646500 -- (-280.246) (-278.433) (-279.464) [-278.454] * (-283.064) (-277.304) [-278.842] (-277.521) -- 0:00:20
647000 -- (-276.964) (-281.083) (-281.674) [-280.312] * (-281.131) (-278.753) [-278.980] (-278.686) -- 0:00:20
647500 -- (-279.244) [-279.486] (-279.193) (-277.842) * [-278.929] (-279.062) (-279.400) (-280.567) -- 0:00:20
648000 -- (-277.866) [-280.020] (-278.528) (-279.158) * (-281.214) (-278.290) [-280.826] (-282.017) -- 0:00:20
648500 -- [-277.231] (-281.987) (-280.040) (-277.529) * (-279.742) (-279.061) (-280.108) [-277.025] -- 0:00:20
649000 -- (-279.410) (-279.692) (-278.948) [-277.125] * (-277.422) [-278.938] (-280.051) (-278.866) -- 0:00:20
649500 -- (-284.403) (-278.473) (-277.564) [-276.867] * (-279.313) (-280.882) [-277.565] (-277.583) -- 0:00:20
650000 -- (-277.613) [-277.095] (-277.929) (-277.251) * [-279.928] (-278.145) (-280.903) (-280.066) -- 0:00:20
Average standard deviation of split frequencies: 0.007969
650500 -- (-277.222) (-278.485) [-279.283] (-279.015) * (-280.333) [-278.670] (-277.082) (-279.749) -- 0:00:20
651000 -- (-280.171) [-278.191] (-279.899) (-280.788) * [-279.986] (-281.067) (-279.041) (-282.740) -- 0:00:20
651500 -- (-279.797) (-279.868) [-279.901] (-278.337) * [-282.988] (-281.864) (-276.515) (-282.785) -- 0:00:20
652000 -- (-278.785) (-280.322) (-278.631) [-278.160] * (-279.132) (-279.256) [-277.031] (-276.851) -- 0:00:20
652500 -- (-279.625) (-278.059) (-278.313) [-277.628] * (-278.507) (-278.889) (-277.324) [-281.508] -- 0:00:20
653000 -- (-279.009) (-278.193) (-278.314) [-276.915] * (-278.792) (-288.929) (-278.185) [-279.001] -- 0:00:20
653500 -- [-277.068] (-278.679) (-280.720) (-277.020) * (-281.795) [-281.375] (-277.676) (-278.362) -- 0:00:20
654000 -- (-277.748) (-283.629) (-276.969) [-278.631] * (-278.852) (-278.096) (-276.926) [-277.872] -- 0:00:20
654500 -- (-277.933) (-279.849) [-277.475] (-278.165) * [-282.870] (-278.832) (-277.961) (-279.950) -- 0:00:20
655000 -- [-278.136] (-280.052) (-278.484) (-277.036) * (-280.150) [-281.571] (-283.275) (-282.880) -- 0:00:20
Average standard deviation of split frequencies: 0.008240
655500 -- (-277.329) [-279.944] (-280.015) (-282.091) * (-278.090) (-278.923) (-279.505) [-282.045] -- 0:00:20
656000 -- (-276.792) (-278.737) (-281.987) [-277.138] * (-277.147) (-278.426) (-277.137) [-280.257] -- 0:00:20
656500 -- [-279.571] (-280.200) (-279.955) (-278.127) * [-278.772] (-277.597) (-281.067) (-278.560) -- 0:00:20
657000 -- (-277.487) (-279.356) (-279.033) [-277.525] * (-277.106) [-280.086] (-283.348) (-286.932) -- 0:00:20
657500 -- (-278.686) (-280.280) (-279.768) [-276.529] * (-278.111) (-281.600) [-276.677] (-279.312) -- 0:00:20
658000 -- (-281.170) (-280.670) (-280.259) [-277.408] * (-278.513) [-278.227] (-277.612) (-277.387) -- 0:00:20
658500 -- (-278.451) (-279.790) [-276.608] (-279.234) * (-278.858) [-279.221] (-284.742) (-279.217) -- 0:00:20
659000 -- (-279.050) (-279.652) (-276.654) [-277.701] * (-278.108) (-278.407) [-280.702] (-278.015) -- 0:00:20
659500 -- [-280.683] (-281.545) (-276.486) (-280.839) * [-278.337] (-279.692) (-278.873) (-278.051) -- 0:00:20
660000 -- [-283.058] (-278.180) (-280.606) (-277.707) * (-279.754) (-278.908) (-278.858) [-286.360] -- 0:00:20
Average standard deviation of split frequencies: 0.008610
660500 -- (-279.579) (-278.094) [-280.591] (-277.218) * (-278.766) (-280.965) [-278.032] (-278.467) -- 0:00:20
661000 -- [-277.500] (-277.890) (-283.153) (-279.598) * (-281.045) [-278.782] (-276.647) (-277.729) -- 0:00:20
661500 -- [-277.154] (-277.166) (-277.973) (-277.062) * (-280.993) (-278.728) [-276.306] (-279.273) -- 0:00:19
662000 -- (-279.422) [-280.780] (-278.568) (-281.410) * (-279.894) (-279.177) [-276.790] (-279.984) -- 0:00:19
662500 -- (-283.236) [-277.066] (-279.399) (-280.237) * (-276.710) (-279.456) [-277.802] (-277.628) -- 0:00:19
663000 -- (-277.623) [-278.668] (-287.107) (-277.971) * (-278.151) [-278.061] (-278.738) (-279.400) -- 0:00:19
663500 -- (-277.541) (-277.992) (-278.727) [-280.750] * (-279.422) (-280.462) (-279.744) [-278.703] -- 0:00:19
664000 -- (-279.580) (-281.422) [-279.260] (-278.387) * (-276.976) (-278.072) [-280.055] (-277.776) -- 0:00:19
664500 -- (-276.773) (-278.557) [-277.186] (-277.952) * (-277.678) (-277.513) [-280.037] (-278.459) -- 0:00:19
665000 -- (-278.634) (-277.538) [-277.020] (-279.567) * (-277.641) (-277.322) (-279.232) [-278.261] -- 0:00:19
Average standard deviation of split frequencies: 0.008352
665500 -- (-279.068) [-277.125] (-277.628) (-279.844) * (-282.916) [-277.052] (-279.065) (-281.261) -- 0:00:19
666000 -- (-280.390) [-276.668] (-280.984) (-280.737) * (-277.852) (-280.396) [-279.185] (-278.152) -- 0:00:19
666500 -- [-276.750] (-281.877) (-282.225) (-281.811) * (-276.477) (-279.373) [-283.469] (-283.196) -- 0:00:19
667000 -- (-277.586) (-279.838) [-276.769] (-279.659) * (-279.564) (-278.535) [-281.304] (-279.644) -- 0:00:19
667500 -- [-277.235] (-278.417) (-278.529) (-277.807) * [-276.998] (-279.387) (-279.984) (-279.968) -- 0:00:19
668000 -- [-276.510] (-278.900) (-281.059) (-282.448) * (-280.215) (-278.248) (-281.918) [-277.239] -- 0:00:19
668500 -- (-278.252) [-278.123] (-277.783) (-278.620) * (-279.161) (-279.652) [-279.131] (-282.019) -- 0:00:19
669000 -- [-277.369] (-279.188) (-277.963) (-277.654) * (-278.261) (-277.453) (-277.612) [-276.894] -- 0:00:19
669500 -- [-279.349] (-276.524) (-277.286) (-278.163) * (-278.812) (-279.774) (-276.909) [-278.704] -- 0:00:19
670000 -- (-279.607) (-277.082) (-277.792) [-280.559] * (-278.134) (-279.139) (-284.340) [-279.901] -- 0:00:19
Average standard deviation of split frequencies: 0.008341
670500 -- [-279.792] (-278.161) (-278.410) (-279.125) * [-278.674] (-277.951) (-279.472) (-278.461) -- 0:00:19
671000 -- (-278.633) (-276.422) (-279.787) [-280.563] * (-279.011) (-276.565) [-280.328] (-279.721) -- 0:00:19
671500 -- (-280.816) (-276.438) [-279.312] (-280.749) * (-280.307) (-276.880) [-277.292] (-279.461) -- 0:00:19
672000 -- (-276.461) [-276.678] (-278.118) (-280.303) * [-277.880] (-279.934) (-282.063) (-278.101) -- 0:00:19
672500 -- (-277.948) [-277.036] (-278.165) (-277.683) * (-277.530) (-279.521) (-284.019) [-282.178] -- 0:00:19
673000 -- [-277.035] (-280.365) (-282.484) (-277.541) * (-278.597) (-283.040) [-278.041] (-280.657) -- 0:00:19
673500 -- (-276.933) (-279.194) (-279.081) [-278.705] * [-277.868] (-278.331) (-279.037) (-280.851) -- 0:00:19
674000 -- [-276.842] (-277.412) (-280.995) (-277.388) * [-279.007] (-278.347) (-277.100) (-278.352) -- 0:00:19
674500 -- (-276.884) (-278.419) [-281.856] (-276.773) * [-277.990] (-277.093) (-279.885) (-278.168) -- 0:00:19
675000 -- [-278.963] (-281.905) (-280.552) (-276.927) * (-280.393) [-276.950] (-278.363) (-278.649) -- 0:00:19
Average standard deviation of split frequencies: 0.008740
675500 -- (-278.285) (-277.230) (-279.869) [-277.269] * (-277.945) (-278.591) (-280.786) [-277.527] -- 0:00:19
676000 -- (-280.386) (-278.230) (-277.369) [-277.503] * (-279.351) (-282.469) [-278.525] (-279.284) -- 0:00:19
676500 -- (-280.844) (-277.894) (-279.128) [-280.656] * [-276.689] (-280.402) (-284.295) (-277.638) -- 0:00:19
677000 -- (-281.290) [-277.615] (-278.978) (-278.818) * (-276.951) [-277.855] (-278.459) (-279.004) -- 0:00:19
677500 -- (-278.343) (-278.663) [-278.423] (-279.754) * (-277.642) [-279.560] (-279.115) (-278.996) -- 0:00:19
678000 -- (-282.622) (-277.973) [-279.963] (-281.424) * [-278.025] (-278.000) (-279.838) (-281.310) -- 0:00:18
678500 -- (-278.335) [-278.706] (-280.256) (-276.992) * (-278.803) [-280.036] (-278.773) (-279.133) -- 0:00:18
679000 -- (-278.788) (-279.122) (-280.836) [-277.010] * (-280.138) (-279.740) (-278.319) [-280.336] -- 0:00:18
679500 -- [-277.902] (-277.666) (-277.141) (-279.491) * (-277.322) (-278.912) (-277.174) [-279.637] -- 0:00:18
680000 -- (-284.619) [-279.122] (-283.639) (-284.656) * (-279.158) [-279.373] (-278.398) (-278.645) -- 0:00:18
Average standard deviation of split frequencies: 0.008634
680500 -- (-279.441) (-279.435) [-278.131] (-280.204) * (-280.400) (-280.675) (-279.059) [-278.584] -- 0:00:18
681000 -- (-278.306) [-278.163] (-281.508) (-277.599) * [-276.743] (-276.426) (-278.491) (-277.225) -- 0:00:18
681500 -- (-278.667) (-278.721) [-278.683] (-281.805) * (-281.444) (-280.010) [-278.202] (-277.980) -- 0:00:18
682000 -- (-278.372) [-277.332] (-280.488) (-277.667) * (-279.104) (-278.566) (-278.544) [-278.057] -- 0:00:18
682500 -- (-278.410) [-279.001] (-281.660) (-277.243) * (-277.957) [-280.270] (-276.732) (-280.272) -- 0:00:18
683000 -- (-280.673) (-278.308) [-279.489] (-277.005) * (-278.225) (-276.972) (-276.929) [-276.461] -- 0:00:18
683500 -- (-280.879) [-277.982] (-281.240) (-278.024) * (-277.080) (-279.130) (-277.228) [-279.195] -- 0:00:18
684000 -- (-278.755) (-277.316) [-281.355] (-277.983) * (-279.683) [-280.964] (-276.929) (-279.777) -- 0:00:18
684500 -- [-277.693] (-277.603) (-279.731) (-277.615) * (-277.927) (-279.491) (-280.064) [-281.410] -- 0:00:18
685000 -- (-278.724) (-279.604) (-279.814) [-276.964] * [-277.859] (-277.477) (-279.220) (-282.514) -- 0:00:18
Average standard deviation of split frequencies: 0.009191
685500 -- [-279.184] (-282.922) (-281.273) (-277.863) * [-277.387] (-277.289) (-277.725) (-280.068) -- 0:00:18
686000 -- (-279.802) (-280.115) [-276.867] (-280.100) * (-278.131) (-279.246) [-277.810] (-282.413) -- 0:00:18
686500 -- (-278.811) [-277.096] (-276.947) (-277.310) * (-285.021) (-279.103) [-279.379] (-279.482) -- 0:00:18
687000 -- (-279.264) (-276.970) [-277.470] (-277.937) * [-279.002] (-278.008) (-279.646) (-277.856) -- 0:00:18
687500 -- [-280.518] (-277.749) (-279.110) (-277.084) * [-279.404] (-277.573) (-281.223) (-280.649) -- 0:00:18
688000 -- [-278.871] (-279.707) (-278.197) (-279.594) * (-279.688) [-280.680] (-281.039) (-278.031) -- 0:00:18
688500 -- (-280.357) (-277.998) [-277.248] (-277.949) * [-281.808] (-279.718) (-281.651) (-279.273) -- 0:00:18
689000 -- [-277.736] (-278.344) (-278.515) (-278.937) * (-281.168) [-279.704] (-283.573) (-276.694) -- 0:00:18
689500 -- (-280.595) (-280.079) [-278.435] (-277.642) * (-278.925) [-277.838] (-278.581) (-276.912) -- 0:00:18
690000 -- (-279.199) (-279.046) [-278.382] (-278.381) * (-278.372) [-278.699] (-283.212) (-277.533) -- 0:00:18
Average standard deviation of split frequencies: 0.009086
690500 -- (-284.505) (-279.682) [-279.815] (-277.790) * (-277.595) (-279.534) (-279.457) [-277.099] -- 0:00:18
691000 -- (-278.159) (-278.861) [-278.684] (-281.068) * (-279.959) [-278.316] (-279.010) (-277.508) -- 0:00:18
691500 -- (-278.482) (-277.874) [-277.757] (-280.754) * [-278.056] (-278.203) (-276.529) (-280.195) -- 0:00:18
692000 -- [-278.447] (-277.671) (-278.670) (-277.323) * (-277.721) (-276.536) [-277.505] (-277.903) -- 0:00:18
692500 -- (-279.757) (-278.166) [-281.865] (-276.628) * (-281.146) [-281.023] (-278.847) (-279.949) -- 0:00:18
693000 -- (-283.799) [-278.131] (-280.853) (-276.787) * (-279.968) [-279.253] (-279.933) (-280.413) -- 0:00:18
693500 -- (-278.767) (-276.859) [-279.182] (-277.780) * (-277.199) (-276.774) (-279.363) [-277.778] -- 0:00:18
694000 -- [-279.609] (-278.076) (-278.453) (-277.710) * (-277.096) [-278.647] (-277.102) (-280.506) -- 0:00:18
694500 -- (-277.639) (-279.078) (-284.724) [-277.844] * [-277.909] (-278.470) (-279.313) (-279.817) -- 0:00:18
695000 -- [-279.421] (-282.097) (-281.306) (-279.091) * (-278.659) (-279.252) (-279.191) [-278.879] -- 0:00:17
Average standard deviation of split frequencies: 0.009355
695500 -- [-279.502] (-283.769) (-279.561) (-279.429) * (-277.662) (-282.111) (-278.502) [-276.936] -- 0:00:17
696000 -- [-280.510] (-280.169) (-280.717) (-280.659) * [-277.774] (-280.976) (-284.424) (-277.472) -- 0:00:17
696500 -- (-284.276) (-278.732) (-277.500) [-279.351] * (-277.548) (-279.566) (-285.714) [-277.263] -- 0:00:17
697000 -- (-279.182) (-278.073) (-277.031) [-282.699] * [-277.808] (-281.315) (-277.906) (-277.265) -- 0:00:17
697500 -- (-279.383) [-277.877] (-279.897) (-279.214) * (-279.108) [-278.907] (-277.905) (-278.652) -- 0:00:17
698000 -- (-277.495) (-280.497) (-278.989) [-279.872] * (-277.611) (-279.922) (-278.269) [-278.344] -- 0:00:17
698500 -- (-277.379) [-277.160] (-282.358) (-278.969) * [-277.158] (-279.881) (-277.119) (-282.075) -- 0:00:17
699000 -- (-286.455) (-277.515) [-277.236] (-281.953) * (-278.504) (-278.696) (-281.254) [-277.448] -- 0:00:17
699500 -- (-285.558) (-277.465) [-276.619] (-279.940) * (-278.074) [-278.684] (-279.809) (-278.260) -- 0:00:17
700000 -- (-280.733) (-276.976) [-276.394] (-282.939) * [-278.348] (-280.372) (-278.301) (-279.059) -- 0:00:17
Average standard deviation of split frequencies: 0.010013
700500 -- (-278.920) [-276.909] (-279.209) (-280.213) * (-277.774) (-279.068) [-282.436] (-286.133) -- 0:00:17
701000 -- (-276.289) [-277.769] (-285.104) (-280.194) * [-278.660] (-277.376) (-278.376) (-277.072) -- 0:00:17
701500 -- (-279.432) (-282.847) (-276.872) [-277.902] * (-278.435) (-282.781) (-279.685) [-277.303] -- 0:00:17
702000 -- (-280.897) (-276.432) (-276.883) [-276.898] * [-278.316] (-282.716) (-280.225) (-278.299) -- 0:00:17
702500 -- (-285.002) (-279.756) [-277.473] (-277.029) * (-280.227) (-277.615) (-277.613) [-277.839] -- 0:00:17
703000 -- [-279.721] (-281.036) (-276.774) (-276.653) * [-279.094] (-276.693) (-282.009) (-277.515) -- 0:00:17
703500 -- [-278.159] (-277.428) (-277.768) (-277.407) * (-279.433) (-276.997) [-278.985] (-277.103) -- 0:00:17
704000 -- (-277.093) (-276.894) (-279.110) [-279.831] * (-279.206) (-276.512) [-279.459] (-277.474) -- 0:00:17
704500 -- (-282.037) [-280.273] (-277.876) (-282.982) * (-279.925) (-277.830) (-277.116) [-277.581] -- 0:00:17
705000 -- [-281.499] (-281.779) (-279.900) (-276.991) * [-277.806] (-276.686) (-279.930) (-278.535) -- 0:00:17
Average standard deviation of split frequencies: 0.010094
705500 -- (-280.759) (-280.413) [-278.118] (-277.998) * (-278.816) (-276.844) [-279.799] (-276.782) -- 0:00:17
706000 -- (-281.137) (-279.803) [-277.804] (-278.547) * [-278.224] (-276.660) (-280.625) (-277.435) -- 0:00:17
706500 -- (-279.122) [-277.215] (-279.161) (-280.002) * (-278.201) (-276.775) (-278.231) [-278.405] -- 0:00:17
707000 -- (-282.204) (-280.182) [-277.910] (-281.352) * (-277.639) [-279.285] (-280.054) (-280.655) -- 0:00:17
707500 -- (-276.891) (-278.722) (-279.465) [-278.530] * [-283.224] (-277.349) (-277.296) (-279.309) -- 0:00:17
708000 -- (-277.110) (-278.305) [-278.139] (-278.025) * (-278.888) [-281.570] (-278.529) (-280.377) -- 0:00:17
708500 -- [-276.978] (-276.476) (-276.517) (-279.907) * (-279.057) (-279.184) [-277.637] (-278.657) -- 0:00:17
709000 -- (-279.640) (-281.645) [-276.836] (-277.206) * (-279.976) [-278.277] (-282.000) (-280.489) -- 0:00:17
709500 -- [-277.525] (-278.593) (-276.523) (-278.272) * (-277.220) (-280.171) (-278.661) [-279.859] -- 0:00:17
710000 -- (-279.831) [-279.374] (-279.321) (-279.406) * [-276.436] (-279.912) (-277.295) (-277.142) -- 0:00:17
Average standard deviation of split frequencies: 0.010240
710500 -- (-278.773) (-276.986) [-280.922] (-280.153) * [-277.348] (-277.736) (-279.578) (-281.024) -- 0:00:17
711000 -- (-277.292) (-277.091) [-277.850] (-281.159) * (-277.271) [-279.042] (-278.695) (-276.921) -- 0:00:17
711500 -- [-279.611] (-278.454) (-283.135) (-282.160) * (-278.532) [-277.053] (-277.232) (-278.757) -- 0:00:17
712000 -- (-278.440) (-280.057) [-279.083] (-283.245) * (-280.317) [-278.631] (-284.443) (-277.416) -- 0:00:16
712500 -- (-283.823) [-279.390] (-278.148) (-281.011) * (-278.857) (-277.950) (-279.139) [-278.307] -- 0:00:16
713000 -- (-278.377) [-277.522] (-278.272) (-281.890) * (-277.914) (-282.521) [-278.417] (-281.267) -- 0:00:16
713500 -- (-277.509) (-280.348) [-278.577] (-282.991) * (-277.693) [-279.019] (-279.565) (-278.727) -- 0:00:16
714000 -- (-280.047) (-277.963) (-277.500) [-279.411] * (-279.212) (-283.891) (-278.149) [-278.268] -- 0:00:16
714500 -- [-279.095] (-278.090) (-278.874) (-277.525) * (-279.974) (-277.161) [-277.350] (-280.940) -- 0:00:16
715000 -- [-277.582] (-277.481) (-278.193) (-278.392) * (-278.480) [-277.514] (-277.875) (-279.011) -- 0:00:16
Average standard deviation of split frequencies: 0.010164
715500 -- (-278.431) [-278.046] (-279.675) (-280.704) * [-282.074] (-280.158) (-277.774) (-278.668) -- 0:00:16
716000 -- (-278.604) [-277.232] (-279.022) (-279.014) * (-278.642) (-277.686) [-276.929] (-279.216) -- 0:00:16
716500 -- [-279.106] (-279.239) (-277.759) (-278.443) * (-281.107) (-280.579) [-276.951] (-278.377) -- 0:00:16
717000 -- (-282.845) [-277.023] (-278.855) (-278.494) * (-281.226) (-277.687) [-278.846] (-279.566) -- 0:00:16
717500 -- (-280.059) (-276.879) [-279.159] (-277.549) * (-278.755) (-280.574) (-278.190) [-279.358] -- 0:00:16
718000 -- (-279.384) (-276.847) [-277.839] (-277.429) * [-279.185] (-280.788) (-282.508) (-278.675) -- 0:00:16
718500 -- (-283.742) (-283.395) (-281.662) [-281.310] * (-281.147) (-279.464) (-276.989) [-278.985] -- 0:00:16
719000 -- (-280.704) [-281.085] (-278.177) (-281.658) * (-280.489) (-277.416) [-277.342] (-279.403) -- 0:00:16
719500 -- (-277.256) [-278.479] (-277.523) (-285.047) * (-279.789) (-276.741) (-278.947) [-278.230] -- 0:00:16
720000 -- (-276.571) (-279.957) [-279.652] (-280.586) * [-278.098] (-278.106) (-279.608) (-277.020) -- 0:00:16
Average standard deviation of split frequencies: 0.010302
720500 -- (-283.459) [-280.885] (-281.338) (-285.276) * (-276.750) [-277.831] (-276.852) (-277.880) -- 0:00:16
721000 -- [-279.419] (-279.355) (-279.404) (-277.074) * (-278.865) [-280.537] (-277.895) (-279.033) -- 0:00:16
721500 -- [-277.980] (-282.864) (-277.524) (-277.968) * [-279.039] (-277.409) (-277.421) (-279.352) -- 0:00:16
722000 -- (-277.614) [-278.244] (-280.679) (-277.396) * (-277.696) (-283.776) [-277.596] (-285.525) -- 0:00:16
722500 -- (-276.803) (-277.598) [-277.846] (-280.007) * (-276.665) (-281.539) [-276.756] (-279.655) -- 0:00:16
723000 -- (-277.404) (-278.033) [-278.223] (-278.789) * [-277.998] (-280.194) (-278.810) (-284.096) -- 0:00:16
723500 -- (-280.220) (-277.520) (-278.825) [-278.214] * (-278.123) (-280.210) [-279.595] (-287.216) -- 0:00:16
724000 -- (-281.025) [-278.084] (-280.155) (-279.043) * [-277.922] (-279.279) (-277.907) (-279.443) -- 0:00:16
724500 -- (-280.679) (-277.812) (-278.018) [-279.223] * (-277.374) (-278.307) (-277.580) [-277.231] -- 0:00:16
725000 -- (-277.946) (-277.418) [-278.222] (-283.030) * (-277.354) (-278.844) (-281.784) [-278.289] -- 0:00:16
Average standard deviation of split frequencies: 0.009969
725500 -- (-279.565) (-280.486) (-282.162) [-277.272] * (-280.125) (-279.753) (-279.052) [-278.840] -- 0:00:16
726000 -- (-278.801) (-277.036) (-277.014) [-276.782] * (-281.830) (-280.387) (-277.684) [-281.660] -- 0:00:16
726500 -- [-276.910] (-278.397) (-278.273) (-277.111) * (-280.187) [-277.478] (-278.311) (-277.826) -- 0:00:16
727000 -- (-278.092) [-278.918] (-277.492) (-278.398) * (-279.949) (-278.080) [-277.247] (-278.139) -- 0:00:16
727500 -- (-277.275) (-281.446) (-278.352) [-281.886] * (-283.179) (-280.334) [-277.392] (-278.131) -- 0:00:16
728000 -- [-279.123] (-279.561) (-277.508) (-278.080) * (-276.865) (-280.572) (-277.134) [-278.023] -- 0:00:16
728500 -- (-278.244) [-277.365] (-281.732) (-277.506) * (-276.715) (-278.201) [-277.503] (-278.028) -- 0:00:16
729000 -- (-277.835) (-277.210) [-279.805] (-277.147) * (-281.283) (-276.872) (-282.612) [-279.058] -- 0:00:15
729500 -- (-276.487) (-277.518) (-276.449) [-279.989] * (-283.284) (-278.370) (-279.539) [-276.771] -- 0:00:15
730000 -- (-276.509) [-277.167] (-281.812) (-281.340) * (-277.972) (-280.586) (-278.077) [-278.880] -- 0:00:15
Average standard deviation of split frequencies: 0.009919
730500 -- [-278.511] (-277.235) (-280.880) (-279.110) * (-279.108) [-276.874] (-280.506) (-278.260) -- 0:00:15
731000 -- (-279.638) (-283.579) [-277.863] (-281.317) * (-288.427) [-278.737] (-278.841) (-278.278) -- 0:00:15
731500 -- (-279.621) (-280.933) [-279.336] (-281.209) * [-278.655] (-279.512) (-277.471) (-276.982) -- 0:00:15
732000 -- (-277.072) (-279.326) (-280.488) [-281.638] * [-277.157] (-280.256) (-278.708) (-276.595) -- 0:00:15
732500 -- [-279.734] (-277.762) (-282.238) (-282.529) * (-278.279) [-279.762] (-279.480) (-277.661) -- 0:00:15
733000 -- [-277.728] (-277.270) (-280.120) (-279.158) * (-276.627) (-281.320) (-283.110) [-276.827] -- 0:00:15
733500 -- (-280.112) (-278.743) [-277.860] (-278.727) * (-277.894) (-281.993) [-280.309] (-278.453) -- 0:00:15
734000 -- (-281.253) [-278.082] (-278.839) (-276.769) * [-276.699] (-281.966) (-278.990) (-277.895) -- 0:00:15
734500 -- [-277.387] (-278.635) (-280.416) (-277.262) * [-276.885] (-282.266) (-279.319) (-280.559) -- 0:00:15
735000 -- (-277.256) (-278.992) [-278.771] (-279.144) * (-278.572) (-276.358) [-279.468] (-279.808) -- 0:00:15
Average standard deviation of split frequencies: 0.009768
735500 -- (-284.116) (-282.631) (-278.691) [-277.299] * (-277.568) (-276.665) [-277.864] (-281.708) -- 0:00:15
736000 -- (-279.870) (-278.753) (-279.317) [-276.985] * (-277.416) (-277.404) (-279.679) [-281.084] -- 0:00:15
736500 -- (-279.601) [-281.848] (-282.159) (-279.306) * (-276.646) (-277.508) (-280.478) [-278.730] -- 0:00:15
737000 -- (-278.661) (-277.662) [-276.789] (-276.728) * (-278.125) [-276.695] (-277.227) (-277.827) -- 0:00:15
737500 -- (-280.403) [-278.299] (-280.932) (-277.221) * (-277.178) [-277.513] (-278.446) (-279.267) -- 0:00:15
738000 -- (-280.594) (-276.972) (-280.329) [-278.493] * [-279.579] (-280.012) (-277.080) (-279.326) -- 0:00:15
738500 -- (-277.401) [-277.742] (-277.152) (-277.543) * (-278.868) (-279.727) [-278.752] (-282.505) -- 0:00:15
739000 -- [-278.963] (-279.888) (-277.775) (-279.700) * (-278.042) [-279.034] (-281.322) (-281.091) -- 0:00:15
739500 -- (-278.914) (-277.145) (-277.961) [-278.984] * (-277.063) (-280.061) (-279.019) [-280.233] -- 0:00:15
740000 -- (-278.380) (-278.990) [-283.671] (-280.393) * [-278.874] (-279.825) (-277.843) (-281.670) -- 0:00:15
Average standard deviation of split frequencies: 0.009666
740500 -- (-280.771) (-282.092) [-277.554] (-277.689) * (-279.047) (-283.968) [-277.448] (-279.017) -- 0:00:15
741000 -- (-280.004) (-279.305) (-277.727) [-279.127] * (-277.046) [-279.461] (-277.326) (-279.075) -- 0:00:15
741500 -- (-281.076) [-279.498] (-281.196) (-277.096) * (-277.427) (-278.966) [-282.334] (-277.171) -- 0:00:15
742000 -- [-278.513] (-280.199) (-277.130) (-278.781) * (-279.410) (-280.004) [-279.508] (-278.485) -- 0:00:15
742500 -- [-277.938] (-277.390) (-279.443) (-279.408) * (-279.731) [-279.753] (-280.399) (-278.833) -- 0:00:15
743000 -- [-279.314] (-278.648) (-279.933) (-278.673) * (-279.117) [-278.364] (-285.026) (-284.048) -- 0:00:15
743500 -- (-276.940) (-277.600) (-280.216) [-279.442] * (-276.823) (-279.981) [-276.957] (-281.983) -- 0:00:15
744000 -- (-278.498) (-278.279) (-280.598) [-280.634] * (-276.682) (-278.491) (-278.734) [-279.421] -- 0:00:15
744500 -- (-280.338) (-278.974) (-279.920) [-278.734] * (-279.582) (-277.572) (-281.706) [-276.688] -- 0:00:15
745000 -- (-279.165) (-278.840) (-282.314) [-276.900] * (-281.466) (-278.603) (-277.260) [-280.158] -- 0:00:15
Average standard deviation of split frequencies: 0.010427
745500 -- [-278.445] (-278.233) (-278.930) (-278.030) * (-279.198) (-277.015) [-278.518] (-282.252) -- 0:00:15
746000 -- (-278.406) (-279.071) (-277.855) [-280.391] * (-279.059) (-281.611) [-276.958] (-280.298) -- 0:00:14
746500 -- (-279.334) [-277.586] (-278.446) (-277.307) * (-278.386) (-279.461) [-278.473] (-277.724) -- 0:00:14
747000 -- (-279.564) [-278.414] (-281.177) (-277.877) * (-278.513) (-280.428) (-277.200) [-278.731] -- 0:00:14
747500 -- (-276.590) [-278.394] (-277.794) (-278.712) * (-278.110) (-279.808) (-277.440) [-280.057] -- 0:00:14
748000 -- (-279.392) (-278.056) [-277.989] (-277.030) * (-281.212) (-278.351) (-277.412) [-277.428] -- 0:00:14
748500 -- [-276.849] (-279.899) (-280.037) (-283.176) * (-277.038) (-278.056) [-277.352] (-277.747) -- 0:00:14
749000 -- (-278.922) (-278.797) (-280.235) [-279.426] * (-276.873) (-277.372) [-278.916] (-279.182) -- 0:00:14
749500 -- (-279.069) (-278.611) (-278.601) [-279.311] * (-277.291) [-277.615] (-278.769) (-279.290) -- 0:00:14
750000 -- (-278.938) (-283.825) (-279.287) [-277.761] * (-277.543) (-278.936) (-279.099) [-277.518] -- 0:00:14
Average standard deviation of split frequencies: 0.010833
750500 -- (-280.119) (-276.772) [-279.539] (-278.006) * [-277.823] (-283.988) (-277.034) (-280.922) -- 0:00:14
751000 -- (-278.732) (-277.057) (-280.244) [-276.843] * (-281.159) (-279.372) (-277.284) [-279.216] -- 0:00:14
751500 -- (-277.763) (-285.017) [-278.578] (-279.384) * (-277.550) [-280.622] (-278.995) (-277.168) -- 0:00:14
752000 -- (-280.618) (-280.981) [-278.355] (-283.622) * (-281.495) [-277.977] (-277.940) (-279.232) -- 0:00:14
752500 -- (-279.080) (-279.289) [-278.500] (-278.086) * (-281.521) (-279.547) (-277.726) [-276.802] -- 0:00:14
753000 -- (-280.320) [-280.730] (-277.954) (-278.604) * (-279.663) (-278.184) (-283.987) [-276.638] -- 0:00:14
753500 -- (-279.193) (-277.790) [-278.277] (-277.389) * (-279.663) [-278.166] (-284.673) (-279.931) -- 0:00:14
754000 -- (-282.658) (-278.788) (-277.990) [-279.602] * (-276.597) (-277.968) [-278.026] (-279.207) -- 0:00:14
754500 -- (-279.596) (-277.818) [-276.262] (-282.268) * [-278.636] (-280.740) (-278.105) (-279.904) -- 0:00:14
755000 -- [-278.335] (-277.842) (-278.383) (-279.502) * (-281.067) (-279.265) (-277.144) [-277.687] -- 0:00:14
Average standard deviation of split frequencies: 0.010678
755500 -- [-280.012] (-276.778) (-277.056) (-281.137) * [-276.954] (-281.793) (-277.011) (-277.798) -- 0:00:14
756000 -- (-277.843) (-279.373) (-278.884) [-280.087] * (-284.316) (-279.038) (-278.823) [-278.008] -- 0:00:14
756500 -- (-277.357) (-279.727) [-280.258] (-277.592) * [-279.529] (-281.831) (-278.126) (-278.383) -- 0:00:14
757000 -- (-279.528) (-280.558) [-277.476] (-279.589) * (-278.624) (-279.786) [-279.008] (-276.979) -- 0:00:14
757500 -- [-278.865] (-278.480) (-277.142) (-277.408) * [-279.937] (-277.950) (-279.751) (-279.295) -- 0:00:14
758000 -- (-277.045) [-279.102] (-276.955) (-282.158) * [-277.035] (-278.419) (-278.452) (-280.169) -- 0:00:14
758500 -- (-278.375) [-278.652] (-276.526) (-280.107) * [-277.102] (-278.493) (-281.235) (-279.246) -- 0:00:14
759000 -- (-278.092) (-279.865) [-277.643] (-278.826) * (-276.859) (-278.499) [-278.031] (-278.112) -- 0:00:14
759500 -- (-279.757) (-277.410) [-277.992] (-280.379) * (-280.160) (-277.728) [-277.171] (-278.238) -- 0:00:14
760000 -- (-278.107) [-276.962] (-278.294) (-278.249) * (-279.177) [-278.982] (-280.873) (-276.684) -- 0:00:14
Average standard deviation of split frequencies: 0.010264
760500 -- [-277.386] (-290.415) (-277.800) (-279.434) * (-279.818) (-280.869) [-277.119] (-277.252) -- 0:00:14
761000 -- (-276.561) [-278.609] (-281.527) (-278.354) * (-278.586) (-285.020) [-281.459] (-278.820) -- 0:00:14
761500 -- (-279.323) (-277.307) [-277.734] (-280.814) * (-277.690) (-281.791) [-278.904] (-276.976) -- 0:00:14
762000 -- (-277.192) (-278.999) [-276.823] (-276.443) * (-279.806) [-282.703] (-277.883) (-282.753) -- 0:00:14
762500 -- (-282.972) [-280.590] (-279.134) (-277.134) * (-282.223) [-281.353] (-277.106) (-280.690) -- 0:00:14
763000 -- (-279.330) (-282.028) (-278.952) [-279.232] * (-280.776) (-280.914) [-278.568] (-279.009) -- 0:00:13
763500 -- (-280.173) (-282.600) (-280.278) [-276.755] * (-281.030) [-278.787] (-277.757) (-280.242) -- 0:00:13
764000 -- [-277.754] (-283.979) (-277.793) (-280.492) * (-277.985) (-279.910) [-278.702] (-277.539) -- 0:00:13
764500 -- (-281.407) (-280.290) [-277.794] (-279.419) * (-278.312) (-278.163) (-281.347) [-277.579] -- 0:00:13
765000 -- [-278.694] (-283.643) (-277.004) (-278.234) * (-277.403) [-277.724] (-281.489) (-278.633) -- 0:00:13
Average standard deviation of split frequencies: 0.010626
765500 -- (-277.811) (-278.602) (-276.842) [-277.217] * (-280.686) (-277.453) (-277.834) [-277.304] -- 0:00:13
766000 -- [-278.229] (-280.414) (-279.626) (-278.916) * (-278.725) [-277.905] (-283.036) (-279.343) -- 0:00:13
766500 -- (-278.506) (-278.448) [-276.930] (-278.240) * (-277.261) [-278.530] (-281.177) (-280.476) -- 0:00:13
767000 -- [-277.736] (-277.706) (-280.959) (-277.431) * (-278.823) [-276.236] (-281.585) (-277.875) -- 0:00:13
767500 -- (-279.255) (-278.367) (-281.182) [-277.790] * (-279.030) [-277.107] (-279.670) (-276.678) -- 0:00:13
768000 -- (-281.056) (-278.175) [-277.471] (-279.417) * [-281.472] (-277.752) (-281.322) (-278.591) -- 0:00:13
768500 -- (-282.839) (-280.845) [-277.943] (-279.417) * (-279.011) (-277.763) [-277.390] (-277.105) -- 0:00:13
769000 -- (-278.412) [-277.866] (-278.216) (-278.318) * (-277.159) (-279.026) (-278.918) [-277.504] -- 0:00:13
769500 -- (-280.285) (-278.251) (-279.625) [-277.053] * (-277.848) (-277.998) [-281.630] (-279.832) -- 0:00:13
770000 -- (-280.215) (-278.852) (- 