--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 10:11:18 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/1res/cspA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -277.92 -280.87
2 -277.92 -281.19
--------------------------------------
TOTAL -277.92 -281.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886290 0.091671 0.367363 1.527304 0.849951 1330.19 1400.61 1.000
r(A<->C){all} 0.171482 0.020879 0.000060 0.443435 0.133224 137.58 247.18 1.000
r(A<->G){all} 0.170099 0.021387 0.000020 0.471578 0.129353 155.07 160.26 1.003
r(A<->T){all} 0.174474 0.021613 0.000002 0.467150 0.135024 186.45 203.57 1.002
r(C<->G){all} 0.157900 0.018490 0.000060 0.430618 0.119455 307.49 312.62 1.000
r(C<->T){all} 0.161085 0.019075 0.000036 0.434949 0.123345 180.85 218.43 1.000
r(G<->T){all} 0.164961 0.019867 0.000042 0.450440 0.123252 154.00 203.51 1.000
pi(A){all} 0.215695 0.000825 0.163431 0.271397 0.214772 868.63 1136.12 1.000
pi(C){all} 0.277008 0.000967 0.218965 0.339891 0.275526 1162.25 1166.39 1.000
pi(G){all} 0.296982 0.001013 0.239065 0.361990 0.296544 1075.73 1135.08 1.000
pi(T){all} 0.210315 0.000797 0.157455 0.263733 0.209736 1447.53 1463.73 1.000
alpha{1,2} 0.413733 0.230972 0.000154 1.349037 0.246623 1067.75 1088.14 1.001
alpha{3} 0.463617 0.230946 0.000107 1.426167 0.308358 1030.13 1150.39 1.000
pinvar{all} 0.991693 0.000102 0.972132 0.999998 0.995013 971.68 1047.88 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -262.868056
Model 2: PositiveSelection -262.868044
Model 0: one-ratio -262.868244
Model 7: beta -262.868044
Model 8: beta&w>1 -262.868044
Model 0 vs 1 3.7599999996018596E-4
Model 2 vs 1 2.4000000053092663E-5
Model 8 vs 7 0.0
>C1
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C2
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C3
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C4
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C5
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C6
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=67
C1 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C2 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C3 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C4 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C5 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C6 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
**************************************************
C1 EIGHSPKGPQATGVRSV
C2 EIGHSPKGPQATGVRSV
C3 EIGHSPKGPQATGVRSV
C4 EIGHSPKGPQATGVRSV
C5 EIGHSPKGPQATGVRSV
C6 EIGHSPKGPQATGVRSV
*****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 67 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 67 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2010]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2010]--->[2010]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.445 Mb, Max= 30.585 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C2 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C3 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C4 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C5 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
C6 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
**************************************************
C1 EIGHSPKGPQATGVRSV
C2 EIGHSPKGPQATGVRSV
C3 EIGHSPKGPQATGVRSV
C4 EIGHSPKGPQATGVRSV
C5 EIGHSPKGPQATGVRSV
C6 EIGHSPKGPQATGVRSV
*****************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C2 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C3 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C4 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C5 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
C6 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
**************************************************
C1 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C2 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C3 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C4 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C5 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
C6 TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
**************************************************
C1 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C2 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C3 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C4 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C5 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
C6 TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
**************************************************
C1 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C2 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C3 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C4 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C5 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C6 GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
**************************************************
C1 C
C2 C
C3 C
C4 C
C5 C
C6 C
*
>C1
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C2
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C3
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C4
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C5
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C6
ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT
TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA
TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT
GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT
C
>C1
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C2
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C3
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C4
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C5
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
>C6
MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
EIGHSPKGPQATGVRSV
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 201 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579774190
Setting output file names to "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1728906157
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 8786924235
Seed = 1885230589
Swapseed = 1579774190
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -449.847636 -- -24.965149
Chain 2 -- -449.847636 -- -24.965149
Chain 3 -- -449.847636 -- -24.965149
Chain 4 -- -449.847636 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -449.847636 -- -24.965149
Chain 2 -- -449.847610 -- -24.965149
Chain 3 -- -449.847636 -- -24.965149
Chain 4 -- -449.847636 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-449.848] (-449.848) (-449.848) (-449.848) * [-449.848] (-449.848) (-449.848) (-449.848)
500 -- (-281.818) [-282.298] (-288.557) (-290.356) * (-286.350) [-285.412] (-288.168) (-291.125) -- 0:00:00
1000 -- (-285.000) (-284.431) [-283.701] (-288.376) * (-286.763) [-288.842] (-284.976) (-292.827) -- 0:00:00
1500 -- (-284.046) [-286.861] (-294.438) (-288.048) * (-292.348) (-285.302) [-286.125] (-290.255) -- 0:00:00
2000 -- [-285.618] (-293.685) (-287.768) (-294.322) * (-279.990) (-288.109) (-298.207) [-290.386] -- 0:00:00
2500 -- (-292.347) [-288.959] (-284.093) (-287.449) * [-286.521] (-287.174) (-290.830) (-287.834) -- 0:00:00
3000 -- (-285.766) (-288.563) (-281.001) [-284.462] * (-285.802) (-287.775) (-290.601) [-294.278] -- 0:00:00
3500 -- (-285.272) (-288.053) [-282.039] (-289.297) * (-285.601) (-291.654) (-286.551) [-286.215] -- 0:00:00
4000 -- (-291.420) (-285.457) (-296.544) [-285.924] * [-287.899] (-287.301) (-294.639) (-290.531) -- 0:04:09
4500 -- [-294.985] (-283.036) (-290.143) (-287.314) * (-291.170) (-291.386) (-289.524) [-289.744] -- 0:03:41
5000 -- (-289.817) (-288.443) (-286.269) [-285.829] * (-289.142) (-283.699) [-290.916] (-285.491) -- 0:03:19
Average standard deviation of split frequencies: 0.071425
5500 -- (-285.977) (-289.590) (-286.221) [-287.347] * [-289.054] (-294.960) (-283.714) (-287.170) -- 0:03:00
6000 -- (-285.497) [-284.841] (-284.184) (-287.583) * (-288.685) [-283.585] (-295.016) (-291.935) -- 0:02:45
6500 -- (-289.049) (-290.121) (-287.471) [-285.420] * (-289.500) [-289.760] (-281.288) (-285.314) -- 0:02:32
7000 -- (-290.961) (-286.555) [-286.710] (-286.428) * (-284.753) (-291.174) (-291.687) [-291.134] -- 0:02:21
7500 -- (-287.979) (-286.092) [-289.802] (-289.189) * (-283.713) (-284.717) (-293.231) [-292.260] -- 0:02:12
8000 -- (-287.424) [-293.653] (-283.604) (-286.175) * [-289.796] (-284.329) (-285.761) (-282.101) -- 0:02:04
8500 -- (-287.443) (-290.114) [-284.605] (-284.542) * (-287.935) (-289.142) (-288.004) [-285.816] -- 0:01:56
9000 -- (-282.561) [-282.648] (-282.203) (-284.151) * (-299.175) (-286.076) [-284.236] (-294.084) -- 0:01:50
9500 -- (-285.412) (-285.744) (-285.704) [-282.931] * (-296.943) (-288.174) [-286.781] (-285.335) -- 0:01:44
10000 -- [-286.393] (-286.469) (-298.014) (-293.946) * (-290.751) (-286.602) [-288.846] (-293.280) -- 0:01:39
Average standard deviation of split frequencies: 0.062802
10500 -- (-286.202) (-294.927) (-284.929) [-289.025] * [-281.222] (-288.283) (-289.640) (-287.545) -- 0:01:34
11000 -- (-287.226) (-291.223) [-285.567] (-292.466) * (-278.080) (-292.000) [-282.360] (-289.386) -- 0:01:29
11500 -- (-285.662) (-284.322) (-285.124) [-291.711] * (-278.532) [-291.609] (-293.003) (-283.397) -- 0:01:25
12000 -- [-279.193] (-281.899) (-293.823) (-291.440) * [-278.173] (-297.195) (-289.915) (-285.672) -- 0:01:22
12500 -- (-284.040) [-279.229] (-283.934) (-291.505) * [-281.076] (-293.142) (-291.214) (-279.604) -- 0:01:19
13000 -- (-286.316) (-278.494) (-280.197) [-291.941] * (-277.585) (-287.425) (-290.693) [-278.202] -- 0:01:15
13500 -- [-286.354] (-278.721) (-295.857) (-289.523) * (-279.641) (-288.237) [-282.274] (-279.294) -- 0:01:13
14000 -- [-285.177] (-279.148) (-299.081) (-287.994) * (-276.374) (-295.649) (-297.854) [-277.799] -- 0:01:10
14500 -- (-296.742) [-278.229] (-285.541) (-293.659) * (-278.351) (-284.320) [-292.298] (-278.263) -- 0:01:07
15000 -- (-298.767) (-276.460) (-284.111) [-284.748] * (-279.870) (-288.535) (-286.902) [-280.594] -- 0:01:05
Average standard deviation of split frequencies: 0.067591
15500 -- (-287.663) (-277.433) [-287.661] (-289.164) * (-278.121) (-287.868) [-283.218] (-276.855) -- 0:01:03
16000 -- (-293.651) [-277.139] (-285.960) (-287.106) * (-276.837) [-285.022] (-284.894) (-276.739) -- 0:01:01
16500 -- (-294.870) (-277.620) (-292.091) [-289.083] * (-279.662) (-292.873) [-289.085] (-281.674) -- 0:00:59
17000 -- [-286.594] (-276.788) (-284.723) (-290.250) * [-276.774] (-290.433) (-292.450) (-277.908) -- 0:00:57
17500 -- (-296.681) (-279.271) [-287.612] (-285.016) * (-277.014) (-299.003) (-291.982) [-277.267] -- 0:00:56
18000 -- (-289.544) [-280.671] (-289.784) (-290.326) * (-278.068) (-287.461) (-290.284) [-279.255] -- 0:00:54
18500 -- (-289.877) (-281.299) (-285.494) [-290.663] * (-279.691) [-294.038] (-285.027) (-278.305) -- 0:00:53
19000 -- (-289.350) (-280.922) [-281.555] (-281.004) * (-279.775) (-285.418) [-281.590] (-277.930) -- 0:00:51
19500 -- (-285.442) [-278.308] (-292.314) (-285.367) * [-278.010] (-281.143) (-288.966) (-278.058) -- 0:00:50
20000 -- [-285.555] (-278.331) (-289.016) (-290.221) * (-277.706) [-284.714] (-292.451) (-279.442) -- 0:00:49
Average standard deviation of split frequencies: 0.058292
20500 -- (-299.840) [-278.674] (-280.922) (-292.930) * (-278.155) (-282.898) (-287.832) [-277.500] -- 0:00:47
21000 -- (-291.994) [-280.191] (-284.195) (-292.401) * [-277.090] (-279.917) (-289.156) (-278.902) -- 0:01:33
21500 -- (-302.111) (-278.011) (-282.196) [-296.107] * (-276.895) [-278.937] (-291.535) (-278.870) -- 0:01:31
22000 -- (-288.631) [-277.800] (-287.371) (-281.828) * (-278.965) (-278.942) (-290.217) [-278.668] -- 0:01:28
22500 -- (-278.024) (-279.192) [-285.052] (-299.915) * (-283.561) [-280.620] (-290.163) (-276.815) -- 0:01:26
23000 -- [-277.518] (-279.131) (-282.966) (-285.427) * (-279.949) [-279.254] (-288.431) (-280.763) -- 0:01:24
23500 -- (-280.255) (-278.368) (-287.232) [-282.601] * (-278.374) [-278.899] (-296.587) (-277.458) -- 0:01:23
24000 -- [-281.377] (-278.169) (-293.880) (-282.890) * (-277.986) (-280.337) (-285.749) [-279.078] -- 0:01:21
24500 -- [-276.585] (-276.915) (-290.973) (-286.946) * (-277.423) [-279.157] (-293.432) (-277.592) -- 0:01:19
25000 -- (-277.002) (-277.806) (-286.814) [-278.346] * [-279.687] (-277.763) (-290.954) (-280.846) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- [-278.375] (-277.819) (-287.711) (-276.820) * (-278.770) (-278.413) [-298.876] (-279.362) -- 0:01:16
26000 -- [-278.401] (-278.824) (-289.780) (-277.847) * (-277.958) (-280.406) [-282.987] (-280.443) -- 0:01:14
26500 -- (-276.608) [-277.067] (-290.734) (-280.249) * (-278.029) (-278.966) (-288.617) [-284.546] -- 0:01:13
27000 -- [-279.569] (-279.380) (-292.694) (-278.750) * (-277.385) (-279.075) [-285.148] (-278.606) -- 0:01:12
27500 -- (-279.480) [-278.439] (-286.311) (-278.578) * (-277.556) [-279.917] (-291.565) (-277.217) -- 0:01:10
28000 -- (-280.063) (-280.164) [-287.221] (-277.486) * (-280.880) (-277.696) [-296.520] (-277.766) -- 0:01:09
28500 -- (-278.218) (-278.687) (-292.318) [-277.673] * (-278.461) (-280.007) [-288.808] (-278.463) -- 0:01:08
29000 -- (-277.647) (-278.144) (-279.801) [-277.712] * [-278.550] (-277.231) (-287.475) (-283.131) -- 0:01:06
29500 -- (-281.454) (-281.746) [-277.603] (-277.525) * (-279.092) (-282.306) (-294.282) [-279.920] -- 0:01:05
30000 -- [-276.604] (-277.465) (-278.901) (-276.920) * (-281.450) (-276.990) [-286.870] (-281.177) -- 0:01:04
Average standard deviation of split frequencies: 0.035355
30500 -- (-276.340) (-277.268) [-277.740] (-278.596) * (-278.789) [-277.585] (-291.786) (-277.303) -- 0:01:03
31000 -- (-276.900) (-277.688) [-278.723] (-277.834) * (-278.540) (-277.353) [-285.685] (-276.960) -- 0:01:02
31500 -- (-277.332) (-282.566) [-277.276] (-279.470) * (-281.100) (-277.948) (-294.474) [-277.753] -- 0:01:01
32000 -- (-279.616) (-280.164) (-277.873) [-278.710] * (-280.897) (-276.784) (-284.685) [-277.795] -- 0:01:00
32500 -- (-281.451) [-277.872] (-279.744) (-278.598) * (-280.165) (-279.937) (-289.940) [-277.676] -- 0:00:59
33000 -- [-278.314] (-282.854) (-282.251) (-279.656) * (-278.446) (-280.907) [-284.999] (-280.500) -- 0:00:58
33500 -- (-282.075) [-279.095] (-282.833) (-282.666) * (-279.479) [-277.947] (-291.416) (-277.751) -- 0:00:57
34000 -- [-278.234] (-283.077) (-282.125) (-280.807) * (-279.460) [-279.445] (-288.076) (-277.872) -- 0:00:56
34500 -- [-278.986] (-281.050) (-282.320) (-277.922) * (-277.994) [-279.974] (-286.774) (-278.634) -- 0:00:55
35000 -- (-277.724) (-276.582) (-277.755) [-279.315] * (-278.546) [-277.286] (-292.541) (-279.371) -- 0:00:55
Average standard deviation of split frequencies: 0.034295
35500 -- (-278.312) [-277.709] (-277.609) (-280.151) * [-278.425] (-277.041) (-288.908) (-288.642) -- 0:00:54
36000 -- [-277.979] (-278.530) (-278.303) (-278.992) * (-277.417) (-277.784) (-285.226) [-278.729] -- 0:00:53
36500 -- [-279.111] (-278.064) (-283.050) (-277.965) * [-277.953] (-278.769) (-297.241) (-279.090) -- 0:00:52
37000 -- [-276.361] (-279.131) (-281.343) (-281.979) * (-279.307) (-277.818) (-286.427) [-282.237] -- 0:00:52
37500 -- (-282.572) (-276.532) (-278.887) [-281.652] * (-277.101) (-277.003) [-278.862] (-283.901) -- 0:00:51
38000 -- [-278.761] (-277.017) (-281.494) (-277.632) * [-277.235] (-278.986) (-279.592) (-276.935) -- 0:00:50
38500 -- [-276.636] (-278.698) (-286.184) (-277.155) * (-279.183) (-278.572) (-279.447) [-278.652] -- 0:01:14
39000 -- [-280.762] (-277.899) (-280.389) (-276.837) * [-279.401] (-277.211) (-278.401) (-277.307) -- 0:01:13
39500 -- [-278.379] (-276.688) (-277.248) (-280.578) * (-277.982) (-278.522) [-279.089] (-277.762) -- 0:01:12
40000 -- (-277.634) [-276.591] (-277.210) (-278.794) * (-277.378) (-277.293) [-278.253] (-278.511) -- 0:01:12
Average standard deviation of split frequencies: 0.034166
40500 -- (-277.713) (-277.573) [-277.197] (-278.753) * (-278.166) (-277.292) [-277.408] (-279.824) -- 0:01:11
41000 -- (-278.687) (-278.981) [-277.009] (-280.290) * (-278.658) (-279.662) (-280.040) [-278.211] -- 0:01:10
41500 -- (-276.649) [-276.839] (-282.044) (-277.573) * (-276.529) [-277.468] (-277.499) (-283.077) -- 0:01:09
42000 -- (-277.285) (-280.627) [-283.292] (-276.861) * (-278.257) (-277.224) (-276.736) [-277.313] -- 0:01:08
42500 -- (-278.751) (-282.088) (-278.665) [-278.833] * (-276.687) [-277.789] (-278.418) (-277.131) -- 0:01:07
43000 -- (-277.074) (-281.378) [-277.684] (-276.858) * (-276.809) [-278.185] (-280.810) (-280.173) -- 0:01:06
43500 -- (-279.701) (-277.369) (-279.368) [-277.436] * [-278.855] (-277.599) (-279.608) (-278.062) -- 0:01:05
44000 -- [-277.637] (-277.856) (-279.661) (-279.947) * (-277.479) (-278.119) [-281.513] (-280.409) -- 0:01:05
44500 -- (-277.026) (-277.982) (-277.546) [-279.726] * [-277.583] (-280.085) (-286.483) (-278.920) -- 0:01:04
45000 -- (-279.467) (-282.245) [-278.022] (-278.797) * [-279.925] (-277.311) (-278.988) (-278.743) -- 0:01:03
Average standard deviation of split frequencies: 0.033539
45500 -- (-277.170) (-279.768) (-277.694) [-277.115] * (-278.935) (-282.840) [-278.200] (-280.681) -- 0:01:02
46000 -- (-278.392) [-277.822] (-278.284) (-279.997) * (-277.368) [-280.117] (-277.481) (-277.423) -- 0:01:02
46500 -- [-282.545] (-279.686) (-281.265) (-283.804) * (-280.278) [-276.383] (-277.824) (-277.449) -- 0:01:01
47000 -- (-277.731) [-278.424] (-277.268) (-278.567) * (-278.355) (-277.039) (-284.076) [-276.277] -- 0:01:00
47500 -- (-277.604) (-278.432) [-277.522] (-279.366) * (-279.696) (-279.510) [-280.055] (-277.966) -- 0:01:00
48000 -- [-277.199] (-279.151) (-278.382) (-277.481) * (-278.949) [-279.395] (-280.483) (-280.260) -- 0:00:59
48500 -- [-279.270] (-277.457) (-276.882) (-278.195) * (-281.096) (-276.793) (-282.561) [-278.636] -- 0:00:58
49000 -- (-277.417) (-277.246) [-278.700] (-286.659) * [-284.761] (-277.768) (-283.104) (-279.518) -- 0:00:58
49500 -- (-277.787) (-282.946) [-276.777] (-278.331) * [-277.964] (-280.386) (-284.736) (-277.438) -- 0:00:57
50000 -- (-276.989) [-282.201] (-278.192) (-281.239) * (-279.827) (-280.184) [-280.351] (-277.818) -- 0:00:57
Average standard deviation of split frequencies: 0.029604
50500 -- [-278.290] (-278.015) (-280.796) (-279.921) * (-277.130) (-278.775) [-279.331] (-280.471) -- 0:00:56
51000 -- (-280.788) [-279.414] (-281.370) (-277.993) * (-279.054) (-278.266) [-277.945] (-276.620) -- 0:00:55
51500 -- (-278.002) (-279.374) [-276.513] (-277.601) * (-279.469) (-279.981) (-279.392) [-277.086] -- 0:00:55
52000 -- (-279.009) (-278.706) (-276.852) [-278.885] * (-280.539) (-284.772) (-277.314) [-278.165] -- 0:00:54
52500 -- (-278.004) (-276.993) [-280.320] (-278.059) * [-277.433] (-281.755) (-277.496) (-279.379) -- 0:00:54
53000 -- [-281.169] (-277.050) (-281.259) (-278.848) * (-281.690) (-282.187) (-283.337) [-276.801] -- 0:00:53
53500 -- (-278.084) (-277.326) (-286.067) [-276.974] * (-278.634) [-276.731] (-281.011) (-278.440) -- 0:00:53
54000 -- (-280.032) (-277.213) (-283.003) [-277.161] * (-280.313) [-283.357] (-278.727) (-277.783) -- 0:00:52
54500 -- [-282.818] (-277.197) (-277.109) (-277.949) * (-279.245) (-277.898) (-278.092) [-277.422] -- 0:00:52
55000 -- (-277.377) [-279.722] (-279.200) (-280.673) * [-278.950] (-277.927) (-277.544) (-289.855) -- 0:00:51
Average standard deviation of split frequencies: 0.032736
55500 -- [-277.873] (-279.958) (-278.203) (-282.372) * (-279.952) [-276.689] (-280.195) (-279.517) -- 0:01:08
56000 -- (-277.549) [-278.859] (-278.164) (-277.157) * (-283.039) [-277.538] (-277.289) (-277.999) -- 0:01:07
56500 -- (-280.473) [-282.179] (-276.745) (-277.843) * (-279.772) [-278.358] (-276.868) (-280.893) -- 0:01:06
57000 -- [-278.840] (-277.206) (-281.361) (-276.942) * (-283.537) (-278.244) (-287.766) [-281.900] -- 0:01:06
57500 -- (-277.883) [-278.414] (-278.218) (-279.588) * (-281.758) (-280.887) [-283.893] (-279.267) -- 0:01:05
58000 -- (-277.833) (-278.684) (-281.616) [-281.243] * (-279.857) (-279.972) [-277.562] (-281.728) -- 0:01:04
58500 -- [-278.398] (-277.868) (-277.844) (-278.934) * (-276.235) (-277.882) (-278.685) [-281.066] -- 0:01:04
59000 -- [-277.467] (-282.002) (-277.435) (-277.827) * (-278.818) [-279.641] (-277.354) (-277.492) -- 0:01:03
59500 -- [-277.157] (-278.156) (-278.043) (-280.310) * [-280.062] (-278.233) (-280.048) (-278.527) -- 0:01:03
60000 -- (-281.133) [-278.507] (-278.978) (-278.739) * (-280.236) (-279.697) [-278.302] (-277.948) -- 0:01:02
Average standard deviation of split frequencies: 0.032377
60500 -- [-278.629] (-278.300) (-279.456) (-278.591) * (-281.402) (-277.742) (-278.540) [-280.182] -- 0:01:02
61000 -- (-277.287) (-280.252) [-278.175] (-278.476) * (-280.531) (-281.252) [-277.092] (-278.750) -- 0:01:01
61500 -- (-277.698) [-277.897] (-277.868) (-277.099) * (-284.036) (-280.240) [-276.956] (-279.743) -- 0:01:01
62000 -- [-278.076] (-277.170) (-277.337) (-278.054) * (-280.481) [-279.375] (-278.895) (-277.549) -- 0:01:00
62500 -- [-278.333] (-279.133) (-278.678) (-277.653) * (-282.660) (-277.445) (-279.936) [-277.159] -- 0:01:00
63000 -- (-277.127) [-278.299] (-279.958) (-280.521) * (-279.135) [-281.315] (-282.657) (-278.356) -- 0:00:59
63500 -- (-278.159) [-280.441] (-277.700) (-277.001) * (-282.437) (-281.915) (-284.310) [-276.783] -- 0:00:58
64000 -- (-277.925) (-279.243) (-278.722) [-277.148] * (-281.723) (-278.869) (-282.839) [-277.240] -- 0:00:58
64500 -- [-277.894] (-285.611) (-278.368) (-279.772) * (-277.422) [-279.165] (-280.931) (-279.541) -- 0:00:58
65000 -- (-276.715) [-281.796] (-277.775) (-277.020) * (-278.961) (-279.484) (-280.413) [-278.267] -- 0:00:57
Average standard deviation of split frequencies: 0.031953
65500 -- (-279.313) (-282.237) [-277.927] (-281.822) * (-278.406) (-277.558) (-283.234) [-277.184] -- 0:00:57
66000 -- (-279.495) (-280.179) [-278.564] (-281.273) * [-280.353] (-279.593) (-278.990) (-279.845) -- 0:00:56
66500 -- (-280.675) [-278.827] (-277.773) (-276.815) * (-279.690) (-279.367) (-278.342) [-276.464] -- 0:00:56
67000 -- (-278.405) (-277.278) [-279.800] (-277.738) * (-278.462) (-279.618) [-277.948] (-276.580) -- 0:00:55
67500 -- [-280.457] (-277.385) (-279.280) (-278.682) * (-277.462) (-279.289) [-278.706] (-276.551) -- 0:00:55
68000 -- (-278.565) (-278.536) [-277.788] (-277.545) * (-278.746) (-278.058) (-277.610) [-277.288] -- 0:00:54
68500 -- (-277.056) (-280.191) [-279.401] (-277.323) * [-277.769] (-277.540) (-277.961) (-278.414) -- 0:00:54
69000 -- (-277.413) (-277.253) [-278.636] (-277.627) * (-277.137) (-278.467) [-279.233] (-279.763) -- 0:00:53
69500 -- [-277.952] (-278.711) (-282.913) (-281.356) * [-277.999] (-279.842) (-277.263) (-279.370) -- 0:00:53
70000 -- (-280.022) [-278.695] (-279.849) (-278.737) * [-278.042] (-279.173) (-277.809) (-279.943) -- 0:00:53
Average standard deviation of split frequencies: 0.033354
70500 -- (-278.431) (-280.937) [-277.845] (-280.556) * (-276.893) (-282.849) [-278.466] (-281.318) -- 0:00:52
71000 -- (-279.345) [-279.746] (-278.922) (-277.793) * (-278.265) (-280.071) [-277.729] (-282.226) -- 0:00:52
71500 -- (-278.528) (-278.746) (-281.080) [-278.522] * (-279.327) (-283.652) (-277.623) [-277.615] -- 0:00:51
72000 -- (-279.824) [-277.462] (-278.489) (-276.616) * (-280.315) (-282.560) (-277.400) [-279.276] -- 0:00:51
72500 -- (-276.807) [-277.802] (-279.622) (-279.232) * [-276.844] (-280.036) (-278.217) (-282.404) -- 0:00:51
73000 -- [-278.287] (-279.701) (-279.264) (-279.655) * (-276.845) (-278.381) (-281.594) [-277.515] -- 0:01:03
73500 -- [-282.111] (-276.869) (-281.571) (-278.280) * [-282.687] (-280.307) (-278.851) (-280.794) -- 0:01:03
74000 -- [-278.223] (-277.238) (-283.845) (-279.176) * (-278.516) [-278.123] (-277.928) (-276.851) -- 0:01:02
74500 -- [-278.241] (-276.485) (-278.939) (-276.963) * (-278.685) (-279.407) (-278.043) [-279.479] -- 0:01:02
75000 -- (-278.107) (-279.013) [-278.126] (-277.184) * (-279.276) [-280.341] (-277.867) (-281.256) -- 0:01:01
Average standard deviation of split frequencies: 0.027568
75500 -- (-279.275) [-277.848] (-277.451) (-281.891) * (-283.063) (-278.434) [-279.427] (-281.444) -- 0:01:01
76000 -- [-277.612] (-278.234) (-277.373) (-278.329) * [-280.807] (-276.826) (-279.482) (-278.185) -- 0:01:00
76500 -- (-278.177) [-278.929] (-280.568) (-277.443) * (-281.005) (-277.297) [-280.554] (-279.647) -- 0:01:00
77000 -- [-277.047] (-278.640) (-278.017) (-278.844) * (-276.763) (-278.346) [-276.556] (-276.382) -- 0:00:59
77500 -- [-277.702] (-278.738) (-276.804) (-283.792) * (-279.518) (-276.482) [-278.099] (-279.625) -- 0:00:59
78000 -- [-277.076] (-281.388) (-278.093) (-278.439) * (-277.432) (-280.394) (-277.369) [-280.511] -- 0:00:59
78500 -- (-277.045) (-280.688) [-282.829] (-277.620) * [-279.079] (-279.852) (-278.562) (-276.958) -- 0:00:58
79000 -- [-278.527] (-276.902) (-278.291) (-277.297) * (-278.620) [-280.545] (-278.632) (-277.682) -- 0:00:58
79500 -- (-277.425) [-280.320] (-280.503) (-282.056) * [-279.804] (-281.768) (-279.311) (-278.462) -- 0:00:57
80000 -- (-277.473) (-277.741) (-276.364) [-276.925] * [-276.590] (-281.486) (-281.972) (-278.541) -- 0:00:57
Average standard deviation of split frequencies: 0.024999
80500 -- (-277.254) (-277.222) (-279.618) [-277.102] * (-277.185) (-282.743) [-277.563] (-278.768) -- 0:00:57
81000 -- [-277.862] (-276.609) (-282.173) (-278.556) * (-278.443) (-280.827) [-277.565] (-283.775) -- 0:00:56
81500 -- (-281.690) (-279.090) (-276.968) [-279.332] * (-283.602) [-277.769] (-277.925) (-280.770) -- 0:00:56
82000 -- (-279.370) [-279.831] (-278.897) (-276.931) * (-277.277) (-278.299) [-276.830] (-279.443) -- 0:00:55
82500 -- (-279.936) (-280.520) [-279.047] (-280.855) * (-280.210) (-277.586) (-278.061) [-278.745] -- 0:00:55
83000 -- [-278.952] (-280.554) (-277.792) (-279.063) * (-278.618) [-278.258] (-277.712) (-276.377) -- 0:00:55
83500 -- (-282.405) [-279.580] (-277.697) (-279.003) * (-276.924) (-277.654) (-277.082) [-277.454] -- 0:00:54
84000 -- (-277.670) (-278.196) (-278.330) [-279.588] * (-281.699) (-278.370) [-277.552] (-277.935) -- 0:00:54
84500 -- (-280.349) (-278.847) (-277.797) [-280.465] * [-276.588] (-279.582) (-277.143) (-282.000) -- 0:00:54
85000 -- [-281.431] (-285.627) (-279.560) (-279.523) * (-277.435) [-278.067] (-278.919) (-279.256) -- 0:00:53
Average standard deviation of split frequencies: 0.027407
85500 -- (-279.481) (-285.428) [-280.943] (-279.222) * [-278.045] (-276.394) (-278.101) (-280.262) -- 0:00:53
86000 -- (-278.564) [-279.629] (-279.495) (-281.693) * [-279.872] (-277.283) (-276.776) (-277.972) -- 0:00:53
86500 -- (-278.268) (-282.867) (-277.145) [-279.226] * [-277.647] (-279.889) (-278.834) (-278.947) -- 0:00:52
87000 -- (-284.225) (-279.922) (-276.633) [-283.176] * [-277.521] (-279.233) (-277.736) (-279.952) -- 0:00:52
87500 -- (-278.890) (-278.217) (-277.937) [-279.040] * (-280.396) (-283.411) [-277.535] (-277.041) -- 0:00:52
88000 -- (-279.248) (-281.357) (-282.295) [-278.306] * (-279.320) (-281.502) (-279.270) [-279.789] -- 0:00:51
88500 -- (-279.014) (-284.893) [-278.072] (-282.013) * (-282.321) [-277.650] (-279.017) (-276.735) -- 0:00:51
89000 -- (-278.392) (-280.603) [-279.015] (-277.769) * [-281.681] (-280.529) (-283.370) (-277.091) -- 0:00:51
89500 -- (-279.982) (-277.856) (-277.856) [-277.612] * [-276.916] (-277.118) (-281.480) (-280.534) -- 0:00:50
90000 -- (-280.240) (-277.942) [-278.273] (-282.103) * (-280.127) (-276.582) [-277.876] (-278.363) -- 0:00:50
Average standard deviation of split frequencies: 0.025419
90500 -- (-277.251) (-281.414) [-278.256] (-281.426) * [-279.191] (-281.501) (-279.238) (-278.123) -- 0:01:00
91000 -- (-276.849) (-283.597) [-279.345] (-280.367) * (-276.803) (-279.449) [-278.316] (-277.668) -- 0:00:59
91500 -- (-277.118) (-280.458) (-279.396) [-277.223] * [-278.460] (-278.812) (-277.881) (-280.826) -- 0:00:59
92000 -- [-278.171] (-279.267) (-278.062) (-278.139) * (-280.166) [-279.301] (-277.119) (-277.336) -- 0:00:59
92500 -- (-278.542) (-280.448) (-277.731) [-278.652] * (-278.956) (-279.878) [-279.341] (-279.625) -- 0:00:58
93000 -- (-279.592) (-278.806) (-279.803) [-276.952] * (-278.516) [-278.818] (-278.418) (-282.554) -- 0:00:58
93500 -- [-277.599] (-278.502) (-277.632) (-277.560) * (-279.018) (-279.091) [-277.038] (-279.648) -- 0:00:58
94000 -- [-279.189] (-278.804) (-278.010) (-278.388) * (-277.581) (-279.194) [-276.288] (-278.613) -- 0:00:57
94500 -- (-278.931) (-281.613) (-279.445) [-277.986] * (-278.334) [-278.308] (-278.661) (-278.075) -- 0:00:57
95000 -- (-277.965) (-279.178) [-280.959] (-279.563) * (-279.839) (-277.793) (-277.351) [-277.952] -- 0:00:57
Average standard deviation of split frequencies: 0.026103
95500 -- (-276.577) [-280.669] (-278.028) (-280.583) * (-277.275) [-278.358] (-276.627) (-279.728) -- 0:00:56
96000 -- (-282.372) (-276.369) (-276.777) [-277.084] * [-277.249] (-278.783) (-277.798) (-277.381) -- 0:00:56
96500 -- (-282.839) (-277.262) [-278.999] (-281.453) * (-276.635) (-278.485) [-279.558] (-279.543) -- 0:00:56
97000 -- (-280.622) (-280.027) [-279.603] (-277.754) * (-277.390) [-277.377] (-281.244) (-277.109) -- 0:00:55
97500 -- (-277.648) (-281.461) (-279.505) [-278.401] * (-279.011) (-277.856) [-278.460] (-277.513) -- 0:00:55
98000 -- (-279.809) (-277.448) (-280.031) [-277.865] * (-277.930) (-276.481) (-279.069) [-276.537] -- 0:00:55
98500 -- (-278.383) [-278.670] (-279.735) (-279.329) * (-279.282) (-276.961) (-278.275) [-280.595] -- 0:00:54
99000 -- [-277.927] (-277.923) (-282.830) (-278.043) * [-278.376] (-280.399) (-278.697) (-278.896) -- 0:00:54
99500 -- [-277.462] (-280.077) (-281.017) (-280.392) * [-277.492] (-281.316) (-283.130) (-276.856) -- 0:00:54
100000 -- [-277.337] (-277.569) (-277.707) (-281.686) * (-277.866) [-285.144] (-279.785) (-276.844) -- 0:00:54
Average standard deviation of split frequencies: 0.027111
100500 -- (-281.145) (-277.606) (-279.069) [-277.235] * (-278.044) [-279.819] (-281.049) (-278.057) -- 0:00:53
101000 -- (-278.761) [-279.830] (-279.355) (-281.977) * [-277.158] (-277.666) (-276.885) (-279.074) -- 0:00:53
101500 -- (-280.475) (-279.966) (-280.985) [-278.624] * [-279.958] (-279.660) (-283.267) (-278.749) -- 0:00:53
102000 -- (-277.282) [-277.720] (-277.179) (-277.895) * [-276.802] (-276.894) (-279.199) (-278.914) -- 0:00:52
102500 -- (-277.417) (-283.131) (-277.825) [-280.646] * (-277.961) (-276.470) [-280.062] (-278.078) -- 0:00:52
103000 -- [-279.970] (-279.384) (-278.431) (-277.958) * [-277.091] (-277.934) (-281.524) (-277.171) -- 0:00:52
103500 -- [-278.091] (-279.378) (-278.891) (-277.617) * (-278.523) (-277.053) (-278.742) [-277.993] -- 0:00:51
104000 -- [-277.551] (-278.225) (-278.714) (-277.751) * (-277.385) (-278.750) [-277.293] (-280.093) -- 0:00:51
104500 -- [-278.663] (-278.699) (-278.747) (-278.021) * (-279.044) (-278.996) (-276.948) [-279.145] -- 0:00:51
105000 -- (-281.130) (-277.674) [-277.887] (-278.140) * (-278.221) (-280.701) (-277.645) [-277.454] -- 0:00:51
Average standard deviation of split frequencies: 0.029258
105500 -- (-277.506) (-277.512) [-277.930] (-278.286) * (-282.614) [-276.515] (-279.791) (-278.724) -- 0:00:50
106000 -- (-277.280) (-280.961) (-277.565) [-280.865] * [-277.194] (-277.920) (-280.251) (-281.262) -- 0:00:50
106500 -- (-279.950) (-281.865) (-281.790) [-279.997] * (-276.800) (-278.913) (-277.997) [-277.670] -- 0:00:50
107000 -- (-280.577) (-277.751) (-282.112) [-279.447] * [-278.199] (-277.019) (-281.994) (-279.582) -- 0:00:50
107500 -- [-280.286] (-284.746) (-279.303) (-279.428) * (-278.526) [-278.073] (-276.745) (-280.820) -- 0:00:58
108000 -- (-277.614) (-279.970) (-283.958) [-279.169] * (-277.750) (-279.869) [-278.870] (-279.890) -- 0:00:57
108500 -- (-278.026) [-278.976] (-280.761) (-282.496) * (-282.328) (-280.175) [-277.589] (-277.452) -- 0:00:57
109000 -- (-284.095) (-284.310) (-282.518) [-278.004] * [-276.889] (-279.014) (-277.667) (-277.076) -- 0:00:57
109500 -- [-278.774] (-277.590) (-277.785) (-278.089) * (-281.474) (-280.020) (-277.350) [-279.295] -- 0:00:56
110000 -- (-279.287) (-277.838) (-282.779) [-278.813] * (-277.295) (-278.542) [-282.179] (-278.354) -- 0:00:56
Average standard deviation of split frequencies: 0.026231
110500 -- (-281.415) (-277.998) (-276.851) [-280.501] * (-276.815) (-278.736) [-281.258] (-279.255) -- 0:00:56
111000 -- [-280.007] (-281.484) (-277.720) (-281.232) * (-277.676) (-278.176) [-279.738] (-277.088) -- 0:00:56
111500 -- [-279.553] (-280.523) (-278.804) (-278.209) * [-277.502] (-278.507) (-276.751) (-276.789) -- 0:00:55
112000 -- (-277.519) (-279.729) [-278.373] (-278.614) * (-282.384) [-280.849] (-279.611) (-279.436) -- 0:00:55
112500 -- (-276.310) [-278.814] (-281.517) (-278.681) * (-277.448) [-278.717] (-283.075) (-278.200) -- 0:00:55
113000 -- (-280.985) (-285.269) (-282.882) [-281.861] * (-277.214) [-276.782] (-278.664) (-277.224) -- 0:00:54
113500 -- (-279.292) [-284.265] (-277.826) (-278.218) * (-277.339) (-277.207) (-277.712) [-278.226] -- 0:00:54
114000 -- [-279.419] (-278.919) (-278.668) (-280.215) * [-276.455] (-278.870) (-276.540) (-278.910) -- 0:00:54
114500 -- [-277.293] (-283.086) (-280.873) (-279.218) * (-279.080) (-278.337) (-279.313) [-280.193] -- 0:00:54
115000 -- [-279.095] (-283.450) (-276.445) (-277.198) * (-283.064) [-278.822] (-278.318) (-280.621) -- 0:00:53
Average standard deviation of split frequencies: 0.025880
115500 -- (-280.179) (-279.305) (-276.630) [-276.541] * [-277.709] (-278.101) (-277.046) (-279.175) -- 0:00:53
116000 -- (-280.964) (-277.223) [-277.714] (-279.793) * (-277.431) (-277.091) [-278.017] (-278.386) -- 0:00:53
116500 -- (-277.363) [-276.697] (-278.482) (-278.014) * (-280.780) (-281.163) [-279.192] (-281.310) -- 0:00:53
117000 -- (-278.322) (-283.088) (-283.827) [-277.480] * (-280.651) [-280.294] (-280.252) (-276.775) -- 0:00:52
117500 -- [-276.912] (-280.793) (-283.178) (-277.699) * [-280.408] (-278.596) (-277.155) (-278.315) -- 0:00:52
118000 -- (-282.018) (-282.945) (-278.275) [-276.950] * (-281.275) (-277.847) (-280.182) [-279.387] -- 0:00:52
118500 -- (-276.974) [-281.911] (-277.472) (-278.798) * (-278.960) [-277.151] (-281.762) (-278.033) -- 0:00:52
119000 -- (-279.670) [-278.808] (-278.623) (-283.666) * [-277.342] (-277.378) (-280.003) (-279.481) -- 0:00:51
119500 -- (-282.955) (-277.083) (-277.524) [-279.440] * (-277.423) (-278.250) [-280.616] (-279.468) -- 0:00:51
120000 -- (-277.323) (-283.603) [-279.044] (-277.185) * (-276.848) (-281.081) [-277.694] (-285.950) -- 0:00:51
Average standard deviation of split frequencies: 0.023657
120500 -- (-280.099) [-278.407] (-278.658) (-284.209) * [-278.479] (-278.352) (-277.498) (-279.724) -- 0:00:51
121000 -- (-278.747) [-281.166] (-281.359) (-278.041) * (-283.271) (-279.916) [-278.712] (-279.484) -- 0:00:50
121500 -- (-276.747) (-280.705) (-280.438) [-276.804] * (-278.260) [-279.951] (-277.107) (-280.865) -- 0:00:50
122000 -- (-277.656) [-279.067] (-279.874) (-278.197) * (-280.930) [-277.347] (-277.752) (-279.360) -- 0:00:50
122500 -- (-278.181) [-276.728] (-279.151) (-281.124) * (-280.415) (-278.645) (-277.245) [-278.539] -- 0:00:50
123000 -- [-278.479] (-278.516) (-279.104) (-276.709) * (-277.285) (-279.604) (-277.527) [-277.339] -- 0:00:49
123500 -- [-278.020] (-277.420) (-279.711) (-278.023) * (-277.940) (-276.951) [-278.186] (-276.903) -- 0:00:49
124000 -- [-277.216] (-277.448) (-279.676) (-282.924) * (-280.265) (-278.265) [-277.529] (-277.542) -- 0:00:49
124500 -- (-277.397) (-278.039) [-277.910] (-278.044) * (-279.309) (-278.209) (-278.755) [-279.398] -- 0:00:56
125000 -- (-278.363) [-278.035] (-279.958) (-278.412) * (-285.722) (-280.568) (-281.109) [-279.132] -- 0:00:56
Average standard deviation of split frequencies: 0.021069
125500 -- [-280.842] (-281.781) (-276.867) (-278.034) * (-281.667) [-279.215] (-278.460) (-279.277) -- 0:00:55
126000 -- (-280.168) (-281.760) [-278.573] (-277.884) * (-281.932) (-280.976) [-276.511] (-280.291) -- 0:00:55
126500 -- (-280.460) [-278.653] (-282.643) (-277.680) * [-278.947] (-280.522) (-280.209) (-279.482) -- 0:00:55
127000 -- (-277.309) (-279.930) (-280.065) [-276.938] * (-279.117) (-277.963) (-277.649) [-279.506] -- 0:00:54
127500 -- (-278.166) [-280.835] (-277.493) (-277.513) * [-281.749] (-279.971) (-278.905) (-277.477) -- 0:00:54
128000 -- (-280.362) (-283.035) (-280.544) [-278.553] * (-277.296) [-277.520] (-278.109) (-277.752) -- 0:00:54
128500 -- (-282.369) [-277.269] (-276.652) (-282.311) * (-281.627) (-277.863) (-279.406) [-279.633] -- 0:00:54
129000 -- [-278.280] (-277.314) (-276.593) (-285.150) * (-277.264) (-281.920) (-278.400) [-279.301] -- 0:00:54
129500 -- (-277.883) (-277.313) [-277.621] (-279.442) * (-278.368) (-280.036) (-277.655) [-277.834] -- 0:00:53
130000 -- (-279.009) (-277.187) [-277.530] (-279.951) * [-278.030] (-279.483) (-278.148) (-278.468) -- 0:00:53
Average standard deviation of split frequencies: 0.024115
130500 -- [-277.349] (-279.954) (-278.986) (-277.196) * (-279.450) (-279.617) (-278.230) [-277.860] -- 0:00:53
131000 -- (-279.252) (-279.636) (-278.694) [-276.874] * (-278.486) (-278.817) [-280.623] (-278.822) -- 0:00:53
131500 -- (-278.706) (-277.899) (-278.310) [-278.624] * (-277.831) (-279.168) (-278.349) [-277.822] -- 0:00:52
132000 -- (-282.858) [-276.610] (-278.823) (-281.642) * [-279.032] (-278.367) (-278.621) (-286.544) -- 0:00:52
132500 -- [-277.015] (-277.612) (-280.373) (-280.291) * [-280.166] (-277.353) (-290.024) (-280.368) -- 0:00:52
133000 -- (-280.023) [-277.910] (-279.688) (-277.783) * (-277.752) (-280.871) (-277.233) [-276.825] -- 0:00:52
133500 -- (-276.377) (-278.436) (-278.599) [-279.325] * (-279.092) (-280.050) [-276.940] (-276.454) -- 0:00:51
134000 -- (-276.910) (-277.221) [-278.199] (-278.140) * (-278.490) (-280.091) [-277.930] (-281.191) -- 0:00:51
134500 -- (-279.010) (-277.749) (-276.868) [-278.446] * (-280.264) [-279.629] (-277.608) (-277.198) -- 0:00:51
135000 -- (-280.057) [-277.660] (-278.102) (-280.598) * (-276.740) (-278.458) [-280.793] (-277.918) -- 0:00:51
Average standard deviation of split frequencies: 0.023716
135500 -- (-279.459) [-279.053] (-280.142) (-277.977) * [-279.237] (-281.208) (-277.521) (-276.300) -- 0:00:51
136000 -- (-281.349) [-278.848] (-280.945) (-278.749) * (-278.398) (-278.610) (-277.400) [-279.994] -- 0:00:50
136500 -- (-278.243) [-277.859] (-280.814) (-278.595) * [-276.475] (-278.015) (-277.438) (-277.399) -- 0:00:50
137000 -- (-278.222) (-283.510) (-278.492) [-277.844] * [-279.155] (-278.496) (-288.766) (-280.785) -- 0:00:50
137500 -- (-276.548) (-277.836) (-287.923) [-277.086] * (-278.040) (-277.291) [-281.510] (-278.202) -- 0:00:50
138000 -- (-279.675) (-277.136) [-280.042] (-277.125) * (-277.703) [-277.330] (-281.301) (-277.411) -- 0:00:49
138500 -- (-278.270) (-287.676) (-280.909) [-278.994] * (-279.522) [-278.080] (-278.294) (-281.453) -- 0:00:49
139000 -- (-276.719) (-280.137) (-279.850) [-279.508] * (-277.678) (-278.879) [-278.490] (-278.760) -- 0:00:49
139500 -- (-278.543) (-276.311) (-279.706) [-277.181] * (-278.536) [-277.611] (-277.251) (-279.727) -- 0:00:49
140000 -- [-277.173] (-277.943) (-281.260) (-278.142) * (-276.723) (-277.192) (-277.801) [-282.546] -- 0:00:49
Average standard deviation of split frequencies: 0.022400
140500 -- [-278.466] (-280.395) (-279.943) (-279.562) * [-279.036] (-278.764) (-279.411) (-280.666) -- 0:00:48
141000 -- (-281.973) [-283.270] (-280.356) (-281.502) * [-279.202] (-279.838) (-278.124) (-280.052) -- 0:00:48
141500 -- (-277.345) [-281.870] (-281.556) (-280.749) * (-285.771) (-278.517) [-278.798] (-277.383) -- 0:00:54
142000 -- (-277.582) [-280.007] (-279.003) (-284.081) * (-281.409) (-278.599) [-276.484] (-277.688) -- 0:00:54
142500 -- (-277.351) (-277.552) [-277.396] (-279.760) * (-276.818) (-278.258) [-278.625] (-277.546) -- 0:00:54
143000 -- (-277.823) (-281.739) [-278.104] (-277.286) * (-276.489) [-280.073] (-281.611) (-277.389) -- 0:00:53
143500 -- (-278.818) (-279.644) (-278.155) [-278.571] * (-277.812) [-280.287] (-279.905) (-279.593) -- 0:00:53
144000 -- (-278.633) (-280.762) (-277.077) [-277.452] * (-279.462) [-282.517] (-280.765) (-279.411) -- 0:00:53
144500 -- (-278.448) (-280.624) (-278.453) [-276.588] * (-277.550) (-278.976) [-281.238] (-282.550) -- 0:00:53
145000 -- (-277.210) (-276.959) [-278.410] (-278.254) * [-278.103] (-279.925) (-279.169) (-281.281) -- 0:00:53
Average standard deviation of split frequencies: 0.023086
145500 -- [-278.451] (-277.045) (-279.771) (-277.663) * (-278.939) (-278.272) [-277.783] (-277.492) -- 0:00:52
146000 -- (-277.697) (-279.421) (-278.314) [-277.114] * (-280.784) (-279.641) [-277.714] (-278.064) -- 0:00:52
146500 -- (-276.915) [-276.642] (-278.947) (-280.587) * [-278.140] (-277.118) (-277.690) (-277.695) -- 0:00:52
147000 -- (-278.393) (-278.355) [-277.904] (-280.250) * (-282.267) (-276.610) (-280.111) [-279.196] -- 0:00:52
147500 -- (-278.160) (-279.388) (-276.241) [-277.662] * (-279.570) [-277.614] (-278.018) (-280.558) -- 0:00:52
148000 -- (-279.142) (-280.044) (-276.892) [-277.709] * (-277.602) (-277.704) [-280.902] (-279.689) -- 0:00:51
148500 -- (-281.122) (-276.983) [-278.249] (-277.236) * [-277.003] (-276.656) (-276.647) (-277.474) -- 0:00:51
149000 -- (-278.478) [-279.925] (-278.269) (-278.753) * (-277.831) (-279.182) [-278.568] (-278.695) -- 0:00:51
149500 -- [-277.158] (-277.838) (-279.967) (-278.783) * [-278.478] (-277.677) (-279.103) (-278.777) -- 0:00:51
150000 -- (-276.468) [-280.183] (-277.360) (-279.969) * (-278.219) [-277.829] (-277.900) (-286.057) -- 0:00:51
Average standard deviation of split frequencies: 0.023391
150500 -- (-277.425) (-281.203) (-279.329) [-278.294] * (-281.494) [-279.896] (-278.609) (-280.344) -- 0:00:50
151000 -- (-279.567) [-278.170] (-278.429) (-280.586) * (-280.134) (-278.998) (-278.674) [-277.645] -- 0:00:50
151500 -- (-277.250) (-277.775) (-278.784) [-278.137] * (-280.419) (-278.569) (-277.349) [-278.867] -- 0:00:50
152000 -- (-282.888) (-279.908) (-276.861) [-276.775] * [-277.410] (-278.621) (-276.997) (-277.063) -- 0:00:50
152500 -- (-279.935) [-277.132] (-279.060) (-278.443) * (-277.371) (-279.169) (-277.654) [-282.645] -- 0:00:50
153000 -- (-279.759) (-278.657) (-279.964) [-279.722] * (-276.673) (-278.247) (-279.805) [-277.039] -- 0:00:49
153500 -- [-279.914] (-277.029) (-279.992) (-277.135) * (-279.035) (-279.616) (-281.058) [-280.659] -- 0:00:49
154000 -- [-279.344] (-278.846) (-280.580) (-278.426) * [-277.333] (-281.108) (-276.657) (-280.512) -- 0:00:49
154500 -- [-277.201] (-278.455) (-281.530) (-279.094) * [-278.517] (-284.636) (-280.671) (-278.214) -- 0:00:49
155000 -- (-281.643) (-279.824) [-279.972] (-279.612) * (-279.244) [-278.054] (-279.089) (-277.079) -- 0:00:49
Average standard deviation of split frequencies: 0.024175
155500 -- (-277.828) (-277.935) [-276.637] (-278.665) * (-283.576) (-277.924) (-279.373) [-278.225] -- 0:00:48
156000 -- (-278.057) (-279.009) (-278.532) [-277.478] * [-277.897] (-278.240) (-276.418) (-279.260) -- 0:00:48
156500 -- (-280.116) [-279.208] (-282.438) (-278.462) * (-277.865) (-277.620) (-279.297) [-279.481] -- 0:00:48
157000 -- [-281.951] (-277.693) (-277.649) (-278.455) * (-278.237) (-281.603) [-277.808] (-278.738) -- 0:00:48
157500 -- (-279.888) (-279.388) [-278.112] (-281.703) * (-279.089) (-281.966) [-277.343] (-278.678) -- 0:00:48
158000 -- (-283.169) (-283.849) (-277.864) [-280.152] * [-279.620] (-279.421) (-276.663) (-278.095) -- 0:00:47
158500 -- (-284.024) (-283.347) [-277.594] (-278.209) * (-277.223) (-277.010) [-277.937] (-279.800) -- 0:00:47
159000 -- (-280.877) (-281.388) [-279.232] (-278.051) * (-277.746) (-276.778) [-278.028] (-279.005) -- 0:00:52
159500 -- (-277.348) (-278.902) [-277.299] (-279.225) * (-282.639) [-279.792] (-277.592) (-277.156) -- 0:00:52
160000 -- (-278.833) (-276.799) (-276.739) [-277.271] * (-286.783) (-276.898) (-281.722) [-277.595] -- 0:00:52
Average standard deviation of split frequencies: 0.026080
160500 -- [-283.171] (-279.862) (-279.283) (-279.250) * [-284.576] (-278.234) (-280.888) (-281.898) -- 0:00:52
161000 -- [-278.255] (-278.474) (-277.531) (-283.010) * [-280.410] (-278.746) (-281.633) (-278.395) -- 0:00:52
161500 -- [-277.893] (-278.376) (-280.621) (-281.693) * (-277.555) (-280.963) [-277.797] (-279.031) -- 0:00:51
162000 -- (-282.327) (-277.849) [-276.366] (-276.773) * [-280.208] (-280.722) (-278.330) (-279.708) -- 0:00:51
162500 -- [-279.111] (-280.324) (-279.426) (-277.239) * (-278.431) [-277.084] (-276.801) (-279.572) -- 0:00:51
163000 -- (-277.291) [-278.120] (-281.955) (-277.748) * [-277.725] (-278.074) (-278.118) (-277.355) -- 0:00:51
163500 -- (-277.684) (-277.247) (-281.652) [-277.935] * (-281.196) (-277.931) [-278.348] (-278.033) -- 0:00:51
164000 -- [-280.183] (-277.888) (-282.125) (-277.108) * (-278.301) [-279.160] (-278.596) (-278.047) -- 0:00:50
164500 -- (-277.999) [-277.378] (-281.676) (-279.252) * [-276.685] (-279.096) (-280.529) (-277.472) -- 0:00:50
165000 -- (-280.888) (-277.220) (-279.028) [-278.501] * (-279.628) (-280.996) [-278.391] (-276.328) -- 0:00:50
Average standard deviation of split frequencies: 0.028082
165500 -- (-281.070) [-277.153] (-280.534) (-277.408) * [-278.737] (-279.271) (-279.190) (-277.572) -- 0:00:50
166000 -- (-277.355) (-282.687) (-279.826) [-283.594] * [-278.906] (-277.617) (-278.039) (-280.601) -- 0:00:50
166500 -- (-278.560) (-277.925) [-278.330] (-283.130) * (-277.419) [-282.512] (-281.625) (-277.610) -- 0:00:50
167000 -- (-278.681) (-278.359) (-278.044) [-280.539] * (-279.946) (-278.571) (-281.458) [-279.994] -- 0:00:49
167500 -- (-280.662) (-277.908) (-276.856) [-277.442] * (-278.261) (-278.181) (-280.291) [-278.523] -- 0:00:49
168000 -- (-280.107) (-280.479) [-276.901] (-279.511) * (-277.270) [-280.440] (-277.645) (-278.682) -- 0:00:49
168500 -- (-276.954) [-277.733] (-279.427) (-278.679) * [-279.136] (-282.135) (-279.123) (-279.729) -- 0:00:49
169000 -- (-279.980) (-277.984) [-276.787] (-277.477) * (-278.914) [-278.697] (-280.946) (-277.778) -- 0:00:49
169500 -- [-278.554] (-280.615) (-276.409) (-279.935) * (-281.223) [-277.819] (-278.058) (-276.984) -- 0:00:48
170000 -- (-277.794) [-278.154] (-277.619) (-281.085) * (-278.230) (-277.827) [-280.510] (-277.716) -- 0:00:48
Average standard deviation of split frequencies: 0.026854
170500 -- (-278.359) (-279.365) [-279.992] (-285.649) * (-289.314) (-285.447) [-278.814] (-278.622) -- 0:00:48
171000 -- (-278.098) [-278.904] (-282.835) (-278.440) * (-285.983) [-284.696] (-279.857) (-277.865) -- 0:00:48
171500 -- (-281.751) (-278.783) (-278.984) [-279.134] * (-279.474) (-279.841) [-279.240] (-277.237) -- 0:00:48
172000 -- (-283.451) [-276.679] (-277.723) (-278.324) * [-280.108] (-280.817) (-278.138) (-280.619) -- 0:00:48
172500 -- (-279.135) (-276.829) (-278.957) [-277.845] * (-282.062) [-278.338] (-280.633) (-279.565) -- 0:00:47
173000 -- [-278.247] (-280.523) (-280.065) (-277.047) * [-280.809] (-277.340) (-281.717) (-277.775) -- 0:00:47
173500 -- [-281.482] (-280.885) (-278.133) (-278.103) * (-284.402) [-276.453] (-276.637) (-278.509) -- 0:00:47
174000 -- (-279.065) [-277.585] (-280.651) (-279.868) * [-278.147] (-281.194) (-279.062) (-279.645) -- 0:00:47
174500 -- (-279.702) (-279.404) [-281.456] (-279.939) * (-278.236) (-279.786) (-277.509) [-276.886] -- 0:00:47
175000 -- (-279.024) (-277.649) [-277.108] (-280.532) * (-279.843) [-279.637] (-279.072) (-280.969) -- 0:00:47
Average standard deviation of split frequencies: 0.024701
175500 -- (-279.907) [-280.020] (-283.522) (-282.118) * (-277.580) [-278.949] (-281.065) (-277.375) -- 0:00:46
176000 -- (-280.023) (-283.302) (-280.852) [-277.189] * (-281.986) (-278.480) (-277.876) [-278.002] -- 0:00:51
176500 -- (-277.601) (-281.059) (-276.693) [-276.726] * (-278.124) (-280.348) (-276.758) [-277.913] -- 0:00:51
177000 -- (-278.899) [-280.636] (-277.546) (-278.860) * (-278.975) (-277.674) (-277.947) [-277.728] -- 0:00:51
177500 -- [-278.060] (-284.126) (-277.496) (-279.626) * [-277.525] (-280.268) (-276.802) (-278.639) -- 0:00:50
178000 -- [-282.096] (-278.697) (-279.589) (-280.102) * (-278.761) [-279.472] (-276.567) (-280.733) -- 0:00:50
178500 -- (-282.066) [-278.579] (-279.014) (-278.348) * (-280.158) (-277.420) (-278.439) [-278.459] -- 0:00:50
179000 -- [-279.117] (-279.832) (-278.072) (-281.957) * (-276.939) (-278.663) (-277.994) [-277.160] -- 0:00:50
179500 -- (-281.783) (-280.228) [-277.516] (-278.112) * (-279.215) [-277.946] (-278.604) (-278.222) -- 0:00:50
180000 -- (-277.924) (-285.419) [-279.570] (-280.146) * (-278.775) [-277.633] (-276.838) (-280.661) -- 0:00:50
Average standard deviation of split frequencies: 0.024097
180500 -- (-277.273) (-280.415) (-277.913) [-280.097] * (-278.178) (-280.201) (-277.753) [-278.573] -- 0:00:49
181000 -- (-282.506) (-277.817) [-279.332] (-277.298) * (-277.286) (-279.145) (-280.273) [-278.739] -- 0:00:49
181500 -- [-277.827] (-279.503) (-282.931) (-279.067) * [-277.477] (-277.329) (-278.283) (-280.309) -- 0:00:49
182000 -- (-278.140) (-282.382) [-278.652] (-277.380) * (-277.109) (-277.428) (-281.767) [-280.182] -- 0:00:49
182500 -- [-277.602] (-279.503) (-277.649) (-277.182) * (-280.054) (-277.415) (-279.551) [-278.202] -- 0:00:49
183000 -- (-278.773) [-277.525] (-277.251) (-278.431) * (-277.243) [-282.469] (-279.908) (-282.890) -- 0:00:49
183500 -- (-279.939) (-282.540) (-278.112) [-277.996] * (-277.278) (-278.885) [-277.566] (-279.571) -- 0:00:48
184000 -- (-281.034) [-277.747] (-278.604) (-277.689) * [-277.334] (-280.024) (-278.508) (-278.859) -- 0:00:48
184500 -- (-278.842) (-278.314) [-278.604] (-279.275) * (-277.654) (-278.785) [-278.532] (-278.325) -- 0:00:48
185000 -- [-278.623] (-276.927) (-277.939) (-279.765) * (-281.122) (-278.127) [-278.342] (-279.894) -- 0:00:48
Average standard deviation of split frequencies: 0.022810
185500 -- (-278.867) (-276.534) [-278.575] (-279.377) * (-282.865) (-280.318) (-277.000) [-277.614] -- 0:00:48
186000 -- (-279.023) (-276.581) [-280.041] (-276.911) * (-279.055) [-277.120] (-278.123) (-277.769) -- 0:00:48
186500 -- (-281.173) (-278.255) [-278.968] (-278.303) * [-277.041] (-277.772) (-276.932) (-281.480) -- 0:00:47
187000 -- (-278.763) (-277.255) (-282.793) [-280.086] * (-281.091) (-284.535) [-279.636] (-280.367) -- 0:00:47
187500 -- (-276.753) (-276.479) [-277.249] (-277.900) * [-279.273] (-276.173) (-278.576) (-280.103) -- 0:00:47
188000 -- (-279.020) (-278.817) (-278.638) [-277.982] * (-280.240) (-281.573) (-280.248) [-280.351] -- 0:00:47
188500 -- (-279.500) [-277.433] (-277.381) (-279.108) * [-280.423] (-279.837) (-278.688) (-279.648) -- 0:00:47
189000 -- (-277.840) (-278.510) [-281.129] (-278.556) * (-277.355) (-277.775) [-279.442] (-280.995) -- 0:00:47
189500 -- [-278.607] (-278.876) (-278.105) (-278.143) * (-281.530) [-277.843] (-279.283) (-281.927) -- 0:00:47
190000 -- (-278.445) (-281.440) (-279.413) [-278.617] * [-280.338] (-277.023) (-278.712) (-278.642) -- 0:00:46
Average standard deviation of split frequencies: 0.020797
190500 -- (-276.648) (-280.437) (-279.029) [-277.150] * (-278.966) (-281.069) [-282.867] (-281.352) -- 0:00:46
191000 -- [-276.276] (-277.190) (-276.671) (-277.586) * (-280.185) (-278.524) (-277.852) [-282.018] -- 0:00:46
191500 -- (-276.557) (-277.754) [-277.550] (-277.158) * (-280.666) (-277.888) (-278.286) [-278.038] -- 0:00:46
192000 -- (-276.632) (-278.681) (-279.817) [-279.792] * (-278.098) [-277.714] (-278.365) (-278.050) -- 0:00:46
192500 -- (-278.215) (-276.370) (-281.336) [-279.407] * (-279.248) (-279.527) [-281.979] (-282.747) -- 0:00:46
193000 -- (-279.545) (-278.452) (-278.012) [-279.400] * [-276.805] (-276.875) (-281.550) (-278.991) -- 0:00:45
193500 -- [-280.935] (-278.547) (-278.017) (-283.964) * (-278.576) (-276.353) [-277.437] (-282.043) -- 0:00:50
194000 -- (-278.629) (-281.236) [-279.600] (-276.848) * [-279.160] (-276.951) (-286.090) (-278.920) -- 0:00:49
194500 -- (-277.077) (-279.572) [-278.566] (-277.953) * (-279.204) [-276.907] (-279.607) (-277.589) -- 0:00:49
195000 -- (-278.292) [-278.648] (-279.126) (-280.146) * (-277.928) (-277.353) [-277.954] (-277.415) -- 0:00:49
Average standard deviation of split frequencies: 0.021363
195500 -- (-278.228) [-278.563] (-277.393) (-280.503) * (-279.756) (-276.584) [-278.294] (-282.692) -- 0:00:49
196000 -- (-279.096) (-278.707) [-278.058] (-281.342) * (-278.373) [-277.054] (-277.303) (-278.295) -- 0:00:49
196500 -- [-278.510] (-281.672) (-277.844) (-282.283) * [-279.628] (-287.173) (-277.658) (-278.292) -- 0:00:49
197000 -- (-283.214) [-278.690] (-278.526) (-279.887) * [-278.374] (-278.212) (-280.241) (-278.393) -- 0:00:48
197500 -- (-281.772) (-281.721) [-278.232] (-280.833) * (-277.599) [-279.322] (-277.093) (-276.942) -- 0:00:48
198000 -- (-277.137) (-283.491) [-279.121] (-280.818) * (-278.758) (-276.884) (-278.357) [-279.253] -- 0:00:48
198500 -- [-278.143] (-279.207) (-279.901) (-280.490) * (-282.314) (-278.896) [-276.901] (-280.004) -- 0:00:48
199000 -- [-278.279] (-278.885) (-277.974) (-276.945) * (-281.276) (-278.182) (-276.914) [-277.362] -- 0:00:48
199500 -- [-277.478] (-278.942) (-277.340) (-278.321) * (-279.029) (-277.519) [-277.610] (-276.596) -- 0:00:48
200000 -- (-279.196) [-276.763] (-276.913) (-277.614) * (-277.668) (-280.214) [-276.487] (-277.338) -- 0:00:48
Average standard deviation of split frequencies: 0.021695
200500 -- (-277.704) (-278.336) (-278.001) [-281.135] * [-277.666] (-277.454) (-279.027) (-278.545) -- 0:00:47
201000 -- (-279.182) (-277.679) (-278.984) [-280.930] * (-277.441) [-281.351] (-278.713) (-281.852) -- 0:00:47
201500 -- (-278.521) (-279.717) (-281.130) [-278.315] * (-282.385) [-277.090] (-278.985) (-279.740) -- 0:00:47
202000 -- (-278.866) (-279.705) [-281.104] (-276.740) * (-278.054) (-277.890) (-279.831) [-276.960] -- 0:00:47
202500 -- (-278.523) (-277.933) (-281.826) [-278.029] * (-278.072) (-277.126) [-279.183] (-277.739) -- 0:00:47
203000 -- [-278.152] (-277.119) (-281.368) (-277.712) * (-280.230) (-279.148) (-280.105) [-279.812] -- 0:00:47
203500 -- (-276.969) (-282.042) (-278.832) [-277.669] * (-278.377) (-281.111) [-280.291] (-278.086) -- 0:00:46
204000 -- (-276.934) (-280.169) [-277.507] (-277.703) * (-280.903) [-278.326] (-281.935) (-277.458) -- 0:00:46
204500 -- (-278.508) (-278.752) (-277.208) [-278.598] * (-280.973) (-278.615) (-280.119) [-277.760] -- 0:00:46
205000 -- (-278.848) (-276.574) [-279.020] (-278.168) * (-277.549) [-280.345] (-279.202) (-283.043) -- 0:00:46
Average standard deviation of split frequencies: 0.021403
205500 -- (-279.640) (-279.414) [-278.782] (-279.062) * (-279.603) (-276.760) (-282.351) [-281.388] -- 0:00:46
206000 -- (-282.418) (-277.402) (-280.216) [-279.168] * [-276.499] (-280.689) (-278.658) (-281.835) -- 0:00:46
206500 -- (-278.647) [-277.418] (-277.149) (-277.956) * [-277.017] (-279.137) (-282.726) (-277.632) -- 0:00:46
207000 -- (-278.129) (-279.596) [-277.621] (-276.479) * (-278.450) (-280.885) (-282.213) [-276.889] -- 0:00:45
207500 -- [-278.745] (-278.895) (-278.999) (-281.176) * (-283.165) (-278.759) [-280.604] (-281.204) -- 0:00:45
208000 -- (-279.246) (-277.059) [-278.060] (-279.609) * (-279.500) (-277.682) (-277.103) [-277.095] -- 0:00:45
208500 -- (-277.306) (-279.719) [-280.406] (-277.402) * (-278.451) (-278.338) (-280.435) [-278.885] -- 0:00:45
209000 -- (-280.110) (-281.356) (-277.829) [-279.026] * (-283.549) [-280.414] (-279.889) (-278.311) -- 0:00:45
209500 -- (-283.825) [-276.920] (-277.594) (-279.105) * (-279.709) (-278.382) [-278.841] (-279.666) -- 0:00:45
210000 -- [-278.376] (-278.026) (-277.719) (-279.074) * (-278.493) (-279.245) [-277.272] (-280.730) -- 0:00:45
Average standard deviation of split frequencies: 0.020666
210500 -- (-277.882) (-277.277) (-282.500) [-278.834] * (-276.977) [-276.881] (-279.382) (-286.772) -- 0:00:48
211000 -- (-282.453) (-282.019) [-278.192] (-277.112) * (-276.404) (-281.219) (-278.312) [-277.589] -- 0:00:48
211500 -- [-279.891] (-279.547) (-278.104) (-278.644) * (-276.428) (-276.595) (-280.584) [-280.866] -- 0:00:48
212000 -- (-278.103) [-277.066] (-280.553) (-277.166) * [-277.445] (-279.860) (-279.335) (-282.518) -- 0:00:48
212500 -- [-278.459] (-277.705) (-277.548) (-278.403) * [-277.686] (-277.812) (-278.443) (-278.758) -- 0:00:48
213000 -- [-279.755] (-277.473) (-277.795) (-279.538) * (-276.901) (-278.635) [-278.864] (-277.475) -- 0:00:48
213500 -- (-282.356) (-279.513) [-279.296] (-278.784) * (-277.728) (-277.307) [-277.686] (-279.283) -- 0:00:47
214000 -- (-282.655) (-280.773) [-276.975] (-280.921) * (-278.951) (-277.092) (-277.599) [-278.282] -- 0:00:47
214500 -- (-280.051) (-276.717) (-276.898) [-280.627] * [-278.910] (-277.883) (-281.009) (-279.586) -- 0:00:47
215000 -- (-277.297) [-278.471] (-279.031) (-278.539) * (-279.418) [-277.308] (-280.163) (-276.998) -- 0:00:47
Average standard deviation of split frequencies: 0.021568
215500 -- (-279.413) (-280.707) [-277.044] (-283.915) * [-279.979] (-277.948) (-278.061) (-277.253) -- 0:00:47
216000 -- [-278.706] (-278.929) (-279.374) (-280.497) * (-278.691) (-278.655) (-279.216) [-277.276] -- 0:00:47
216500 -- [-282.072] (-282.032) (-281.818) (-280.185) * [-277.968] (-277.825) (-278.360) (-277.517) -- 0:00:47
217000 -- (-281.490) (-279.665) (-276.996) [-279.569] * (-280.537) (-281.542) (-277.819) [-278.520] -- 0:00:46
217500 -- [-279.508] (-277.642) (-279.711) (-280.841) * [-276.945] (-277.198) (-278.036) (-277.757) -- 0:00:46
218000 -- (-283.239) [-277.586] (-279.249) (-279.942) * (-281.466) (-278.886) [-278.163] (-280.425) -- 0:00:46
218500 -- (-278.828) [-277.878] (-277.446) (-279.974) * (-279.654) [-278.375] (-278.307) (-278.320) -- 0:00:46
219000 -- (-284.718) (-277.408) (-279.602) [-277.663] * (-277.177) (-278.491) [-277.032] (-278.591) -- 0:00:46
219500 -- (-276.904) (-280.985) (-278.603) [-277.906] * (-278.054) (-278.419) (-278.138) [-277.273] -- 0:00:46
220000 -- [-280.730] (-279.863) (-277.100) (-279.269) * (-276.979) (-278.033) (-278.353) [-277.322] -- 0:00:46
Average standard deviation of split frequencies: 0.020860
220500 -- (-277.462) (-279.007) [-281.066] (-279.176) * [-277.384] (-278.027) (-277.049) (-278.836) -- 0:00:45
221000 -- (-283.231) (-280.638) [-278.415] (-278.894) * [-276.881] (-276.854) (-278.387) (-279.576) -- 0:00:45
221500 -- (-281.770) (-278.802) [-281.011] (-279.978) * (-278.773) (-277.836) (-280.029) [-280.221] -- 0:00:45
222000 -- (-277.954) (-280.068) [-277.575] (-280.584) * [-278.504] (-278.848) (-277.780) (-279.912) -- 0:00:45
222500 -- (-279.894) (-278.699) (-277.985) [-277.608] * [-277.280] (-277.775) (-281.781) (-279.616) -- 0:00:45
223000 -- (-277.216) (-277.360) (-277.256) [-278.961] * (-279.178) [-282.270] (-282.211) (-278.489) -- 0:00:45
223500 -- (-279.702) (-282.516) [-276.918] (-285.219) * (-278.767) [-276.757] (-283.328) (-279.350) -- 0:00:45
224000 -- (-279.851) (-280.387) (-280.971) [-277.862] * (-278.865) (-279.050) (-286.639) [-279.174] -- 0:00:45
224500 -- (-277.533) (-283.202) (-278.906) [-278.187] * [-280.841] (-278.090) (-278.740) (-279.458) -- 0:00:44
225000 -- (-280.011) (-278.486) (-278.339) [-279.327] * [-279.161] (-279.191) (-280.146) (-279.924) -- 0:00:44
Average standard deviation of split frequencies: 0.019086
225500 -- (-278.074) [-278.883] (-280.038) (-283.325) * (-277.626) (-281.932) [-284.919] (-278.482) -- 0:00:44
226000 -- [-278.814] (-280.788) (-276.886) (-278.906) * [-279.979] (-280.112) (-282.643) (-280.015) -- 0:00:44
226500 -- (-278.094) (-280.567) [-276.669] (-277.041) * [-278.758] (-279.016) (-279.053) (-277.851) -- 0:00:44
227000 -- (-278.346) [-278.940] (-279.528) (-277.074) * (-278.553) [-278.457] (-276.689) (-278.408) -- 0:00:44
227500 -- (-277.588) [-280.793] (-279.627) (-277.549) * (-277.658) (-276.757) [-277.587] (-277.065) -- 0:00:47
228000 -- (-277.281) [-281.814] (-279.411) (-278.669) * (-277.452) (-279.307) (-277.354) [-276.268] -- 0:00:47
228500 -- (-279.008) [-282.591] (-281.857) (-277.315) * (-278.750) [-279.198] (-277.480) (-277.370) -- 0:00:47
229000 -- (-282.070) [-278.111] (-283.231) (-280.235) * (-276.885) (-279.647) [-278.160] (-277.221) -- 0:00:47
229500 -- (-280.616) [-281.335] (-280.449) (-281.937) * (-277.612) (-277.272) (-278.420) [-277.637] -- 0:00:47
230000 -- [-279.211] (-281.430) (-280.164) (-283.109) * (-280.126) [-278.545] (-280.173) (-277.604) -- 0:00:46
Average standard deviation of split frequencies: 0.017780
230500 -- (-278.682) (-277.776) (-280.526) [-280.075] * (-281.053) (-277.417) [-277.891] (-278.365) -- 0:00:46
231000 -- (-279.524) [-276.534] (-280.386) (-280.370) * [-277.779] (-279.684) (-280.598) (-283.373) -- 0:00:46
231500 -- (-285.002) [-276.950] (-277.947) (-278.433) * (-278.791) (-280.145) [-278.624] (-277.480) -- 0:00:46
232000 -- [-282.548] (-277.881) (-280.563) (-277.546) * [-278.046] (-280.519) (-276.550) (-276.963) -- 0:00:46
232500 -- [-280.335] (-277.850) (-277.747) (-279.058) * [-278.034] (-280.332) (-278.183) (-282.218) -- 0:00:46
233000 -- [-277.837] (-278.044) (-278.689) (-279.407) * (-279.054) (-287.640) (-278.085) [-284.647] -- 0:00:46
233500 -- [-278.801] (-277.423) (-282.095) (-277.649) * (-279.868) (-278.931) [-277.605] (-279.022) -- 0:00:45
234000 -- (-279.683) (-279.569) [-276.462] (-282.630) * (-279.365) (-278.858) (-278.137) [-280.895] -- 0:00:45
234500 -- (-277.645) [-277.260] (-278.783) (-278.429) * [-278.512] (-278.992) (-278.981) (-280.503) -- 0:00:45
235000 -- (-278.252) (-281.365) (-280.985) [-277.353] * [-277.152] (-281.694) (-279.085) (-278.016) -- 0:00:45
Average standard deviation of split frequencies: 0.017155
235500 -- (-276.824) (-280.384) [-284.660] (-279.601) * (-281.163) (-277.785) (-280.761) [-276.539] -- 0:00:45
236000 -- (-277.986) [-279.046] (-279.186) (-277.289) * (-279.889) (-278.123) (-279.323) [-278.620] -- 0:00:45
236500 -- (-279.308) [-283.385] (-282.021) (-279.479) * (-280.730) [-279.128] (-283.309) (-280.134) -- 0:00:45
237000 -- [-283.349] (-280.723) (-280.957) (-281.134) * [-278.275] (-278.249) (-280.721) (-282.287) -- 0:00:45
237500 -- [-277.762] (-278.503) (-281.240) (-279.556) * (-278.220) (-277.467) [-278.578] (-279.886) -- 0:00:44
238000 -- [-278.294] (-278.274) (-279.021) (-278.970) * (-277.262) (-277.445) (-279.814) [-277.907] -- 0:00:44
238500 -- [-278.895] (-277.875) (-277.648) (-280.072) * [-277.147] (-277.410) (-278.116) (-277.610) -- 0:00:44
239000 -- (-277.762) [-279.298] (-277.970) (-279.068) * (-276.768) (-277.455) (-279.372) [-278.124] -- 0:00:44
239500 -- [-277.866] (-277.059) (-277.259) (-276.433) * (-279.063) [-277.408] (-280.986) (-280.547) -- 0:00:44
240000 -- [-279.920] (-280.123) (-276.676) (-277.789) * (-277.965) (-277.982) [-277.469] (-277.313) -- 0:00:44
Average standard deviation of split frequencies: 0.019370
240500 -- (-286.474) [-278.886] (-278.169) (-276.732) * (-277.957) [-279.357] (-277.726) (-279.476) -- 0:00:44
241000 -- (-278.907) (-280.445) (-276.608) [-277.668] * (-281.136) [-278.021] (-283.079) (-277.601) -- 0:00:44
241500 -- (-277.971) [-279.118] (-277.826) (-277.794) * (-276.793) (-278.925) (-278.256) [-280.532] -- 0:00:43
242000 -- [-276.839] (-277.836) (-279.429) (-277.643) * (-282.149) (-281.384) [-277.625] (-279.249) -- 0:00:43
242500 -- [-280.915] (-279.185) (-279.173) (-278.400) * (-280.656) (-281.270) [-278.344] (-279.201) -- 0:00:43
243000 -- [-278.438] (-278.275) (-279.622) (-278.564) * (-281.013) (-278.460) (-279.071) [-278.078] -- 0:00:43
243500 -- (-276.258) [-280.053] (-281.484) (-279.584) * (-278.211) (-279.171) (-278.051) [-277.372] -- 0:00:43
244000 -- (-277.193) (-284.503) (-283.333) [-279.942] * (-278.328) (-279.404) (-277.397) [-280.402] -- 0:00:43
244500 -- (-280.661) [-277.698] (-282.059) (-277.729) * (-280.494) (-279.235) (-277.487) [-277.975] -- 0:00:43
245000 -- (-278.824) (-278.031) (-283.307) [-278.176] * (-279.941) (-281.802) (-281.102) [-276.710] -- 0:00:46
Average standard deviation of split frequencies: 0.019062
245500 -- (-283.377) (-278.374) [-277.013] (-276.912) * (-279.985) [-280.144] (-281.884) (-277.637) -- 0:00:46
246000 -- (-276.850) (-283.233) [-280.093] (-277.922) * (-279.065) (-278.331) [-277.273] (-277.415) -- 0:00:45
246500 -- (-280.453) (-282.672) (-277.533) [-281.583] * (-279.255) (-278.861) [-282.225] (-278.778) -- 0:00:45
247000 -- (-280.862) (-282.392) [-278.219] (-278.947) * (-279.065) (-280.723) [-277.420] (-280.498) -- 0:00:45
247500 -- [-279.780] (-287.557) (-279.233) (-279.431) * (-279.996) (-278.185) (-277.989) [-280.764] -- 0:00:45
248000 -- [-279.070] (-279.793) (-278.368) (-280.173) * [-278.889] (-280.925) (-279.618) (-278.782) -- 0:00:45
248500 -- (-280.264) (-278.098) [-276.995] (-277.545) * (-279.208) (-285.622) (-278.051) [-280.217] -- 0:00:45
249000 -- (-277.790) [-277.115] (-277.225) (-276.847) * [-280.674] (-280.141) (-284.198) (-279.639) -- 0:00:45
249500 -- (-282.206) (-278.538) (-276.588) [-277.585] * (-279.696) (-278.755) (-278.256) [-277.434] -- 0:00:45
250000 -- (-280.291) (-281.702) [-277.728] (-278.973) * (-278.263) (-278.209) (-279.709) [-279.890] -- 0:00:45
Average standard deviation of split frequencies: 0.019224
250500 -- (-277.725) (-284.559) [-277.410] (-285.556) * (-277.701) (-279.313) (-281.344) [-279.928] -- 0:00:44
251000 -- (-280.015) (-279.703) (-276.989) [-278.620] * [-279.465] (-278.580) (-277.005) (-277.561) -- 0:00:44
251500 -- (-280.379) (-279.803) (-278.987) [-278.970] * (-278.127) [-276.276] (-278.616) (-280.279) -- 0:00:44
252000 -- (-276.991) (-276.960) [-278.618] (-278.876) * (-277.043) [-277.817] (-279.337) (-276.881) -- 0:00:44
252500 -- (-280.940) (-280.140) [-277.292] (-278.972) * (-276.519) [-278.894] (-280.773) (-280.012) -- 0:00:44
253000 -- (-278.046) (-277.426) [-280.371] (-281.306) * (-277.108) (-279.281) (-276.690) [-279.693] -- 0:00:44
253500 -- (-277.003) (-277.993) [-280.646] (-280.037) * [-279.707] (-277.862) (-277.585) (-282.152) -- 0:00:44
254000 -- (-279.062) (-280.830) (-279.843) [-278.835] * [-278.725] (-283.232) (-279.260) (-284.121) -- 0:00:44
254500 -- (-282.724) [-277.901] (-280.763) (-278.747) * (-278.689) (-278.644) [-276.940] (-280.018) -- 0:00:43
255000 -- [-278.015] (-276.941) (-280.531) (-279.019) * (-277.822) (-278.932) [-277.954] (-282.024) -- 0:00:43
Average standard deviation of split frequencies: 0.017391
255500 -- (-284.597) (-277.644) [-279.072] (-279.296) * (-284.517) (-277.631) [-279.219] (-278.287) -- 0:00:43
256000 -- (-280.775) (-278.894) [-278.452] (-279.038) * (-279.471) [-277.356] (-276.704) (-279.940) -- 0:00:43
256500 -- (-278.888) (-277.161) [-276.450] (-279.807) * (-279.164) [-276.958] (-277.756) (-279.680) -- 0:00:43
257000 -- (-278.156) (-277.446) (-285.617) [-277.596] * (-278.449) [-277.133] (-279.364) (-278.060) -- 0:00:43
257500 -- (-276.514) (-277.535) (-279.518) [-278.594] * (-279.420) (-283.698) (-283.113) [-280.139] -- 0:00:43
258000 -- (-280.258) (-278.586) [-278.840] (-280.359) * (-283.309) [-279.192] (-279.724) (-279.456) -- 0:00:43
258500 -- (-280.865) (-277.229) (-280.604) [-278.978] * [-280.511] (-280.282) (-281.833) (-278.477) -- 0:00:43
259000 -- (-278.694) (-277.551) [-277.478] (-279.191) * (-281.414) (-280.332) (-277.587) [-278.265] -- 0:00:42
259500 -- (-276.868) [-279.026] (-280.078) (-278.100) * (-279.034) (-278.538) [-276.705] (-278.339) -- 0:00:42
260000 -- [-276.909] (-278.399) (-278.477) (-277.248) * (-277.117) (-279.528) (-278.110) [-278.890] -- 0:00:42
Average standard deviation of split frequencies: 0.015485
260500 -- (-281.723) [-277.928] (-277.462) (-284.054) * (-279.351) (-277.613) (-277.179) [-278.965] -- 0:00:42
261000 -- (-278.915) [-278.013] (-278.133) (-280.379) * (-278.849) (-276.966) [-281.833] (-278.903) -- 0:00:42
261500 -- (-279.950) (-279.442) [-278.856] (-281.180) * [-277.277] (-276.781) (-279.704) (-279.628) -- 0:00:42
262000 -- (-277.259) (-278.702) (-277.281) [-280.525] * (-278.680) [-278.727] (-278.609) (-278.175) -- 0:00:45
262500 -- (-278.041) [-278.000] (-280.016) (-278.338) * (-283.252) (-278.489) (-279.180) [-279.422] -- 0:00:44
263000 -- (-283.966) (-279.767) (-286.084) [-279.539] * (-281.017) (-279.263) (-281.948) [-280.024] -- 0:00:44
263500 -- (-280.788) (-277.029) (-282.719) [-277.965] * (-276.768) (-282.129) [-277.257] (-281.139) -- 0:00:44
264000 -- (-277.697) [-277.378] (-281.746) (-280.734) * (-277.532) (-282.782) (-277.632) [-278.687] -- 0:00:44
264500 -- [-278.936] (-277.938) (-279.612) (-282.573) * (-280.038) (-284.090) (-279.974) [-277.636] -- 0:00:44
265000 -- [-280.891] (-283.267) (-279.947) (-281.051) * (-278.130) [-283.685] (-279.473) (-278.530) -- 0:00:44
Average standard deviation of split frequencies: 0.016976
265500 -- [-279.667] (-277.401) (-278.328) (-276.703) * (-278.220) (-278.523) (-282.617) [-277.027] -- 0:00:44
266000 -- (-279.927) (-277.533) (-279.455) [-277.804] * (-278.555) (-279.170) (-281.315) [-280.169] -- 0:00:44
266500 -- (-278.528) (-278.917) [-279.619] (-281.579) * (-284.626) [-279.510] (-278.816) (-277.857) -- 0:00:44
267000 -- (-282.231) (-277.779) [-279.079] (-277.719) * (-281.001) (-279.279) [-280.034] (-279.405) -- 0:00:43
267500 -- [-278.062] (-279.116) (-279.135) (-276.862) * (-277.397) (-277.176) [-278.587] (-281.255) -- 0:00:43
268000 -- (-279.059) (-280.037) [-278.378] (-280.101) * [-280.242] (-278.891) (-277.783) (-278.292) -- 0:00:43
268500 -- (-283.938) (-278.124) (-278.115) [-277.771] * (-281.425) (-278.710) [-277.556] (-278.575) -- 0:00:43
269000 -- (-280.709) (-279.410) (-278.812) [-278.307] * (-281.741) (-278.940) [-278.471] (-277.693) -- 0:00:43
269500 -- (-279.749) (-277.206) [-280.445] (-276.770) * (-278.978) [-278.471] (-278.641) (-279.931) -- 0:00:43
270000 -- (-283.274) (-276.495) (-279.308) [-277.610] * (-279.308) [-279.646] (-277.627) (-278.960) -- 0:00:43
Average standard deviation of split frequencies: 0.017900
270500 -- (-280.519) (-280.031) [-278.414] (-284.185) * (-281.365) [-277.825] (-278.409) (-276.377) -- 0:00:43
271000 -- (-280.638) (-278.293) (-277.249) [-279.224] * (-277.334) (-277.393) [-277.592] (-279.310) -- 0:00:43
271500 -- (-280.217) [-277.034] (-283.382) (-277.543) * (-276.813) [-277.310] (-280.576) (-279.120) -- 0:00:42
272000 -- (-285.293) [-276.756] (-282.958) (-280.852) * (-278.219) (-277.813) [-277.200] (-277.972) -- 0:00:42
272500 -- (-283.195) (-279.950) (-284.018) [-282.026] * (-281.973) (-276.610) (-276.737) [-278.222] -- 0:00:42
273000 -- (-278.324) (-283.046) (-279.837) [-277.008] * (-279.776) [-276.611] (-277.104) (-279.694) -- 0:00:42
273500 -- (-276.571) [-281.574] (-278.017) (-277.760) * (-280.072) [-278.769] (-278.768) (-279.058) -- 0:00:42
274000 -- (-281.267) (-282.103) (-279.083) [-278.256] * (-278.346) (-278.221) (-278.509) [-279.409] -- 0:00:42
274500 -- [-280.118] (-278.655) (-279.578) (-279.161) * [-277.560] (-279.735) (-280.961) (-278.448) -- 0:00:42
275000 -- (-277.902) (-276.792) (-277.943) [-277.509] * (-284.803) (-280.986) [-278.218] (-276.928) -- 0:00:42
Average standard deviation of split frequencies: 0.017744
275500 -- (-276.923) (-277.709) (-278.590) [-279.347] * (-278.867) (-281.457) [-279.046] (-276.995) -- 0:00:42
276000 -- (-278.060) (-279.095) (-284.991) [-277.389] * (-281.344) [-277.111] (-279.087) (-280.924) -- 0:00:41
276500 -- (-278.559) [-277.070] (-287.013) (-277.609) * (-279.022) (-279.411) (-277.562) [-277.946] -- 0:00:41
277000 -- (-278.599) [-277.072] (-277.938) (-281.033) * (-280.784) (-278.805) [-279.271] (-279.061) -- 0:00:41
277500 -- (-280.130) (-282.534) [-279.557] (-278.055) * (-278.267) [-278.628] (-278.996) (-278.786) -- 0:00:41
278000 -- (-278.569) (-279.532) [-280.689] (-280.165) * (-277.151) (-279.233) (-277.280) [-278.630] -- 0:00:41
278500 -- [-277.616] (-278.974) (-281.514) (-276.821) * [-280.403] (-281.026) (-282.879) (-280.030) -- 0:00:41
279000 -- [-276.516] (-277.474) (-281.891) (-281.988) * (-278.060) (-279.055) [-283.433] (-278.389) -- 0:00:43
279500 -- (-278.978) (-277.615) (-283.651) [-278.780] * (-277.753) [-277.864] (-277.867) (-280.092) -- 0:00:43
280000 -- [-279.493] (-277.016) (-282.656) (-279.141) * (-280.114) (-277.531) [-277.906] (-276.685) -- 0:00:43
Average standard deviation of split frequencies: 0.016423
280500 -- (-277.963) (-276.437) [-281.381] (-278.790) * (-278.696) (-276.823) [-279.383] (-279.734) -- 0:00:43
281000 -- (-277.774) (-279.175) (-278.376) [-278.178] * (-276.915) [-276.409] (-279.303) (-279.279) -- 0:00:43
281500 -- (-278.856) (-277.511) [-277.504] (-278.263) * [-278.824] (-279.458) (-278.631) (-279.744) -- 0:00:43
282000 -- (-282.602) (-277.274) [-277.832] (-282.437) * (-281.297) (-280.798) [-277.140] (-279.120) -- 0:00:43
282500 -- (-283.781) (-280.911) (-276.625) [-277.512] * (-278.093) [-277.500] (-277.220) (-278.263) -- 0:00:43
283000 -- (-278.391) (-277.017) [-277.354] (-281.472) * (-282.830) (-276.870) (-278.003) [-281.749] -- 0:00:43
283500 -- (-276.601) (-277.246) (-277.477) [-278.233] * (-276.692) (-278.625) [-276.950] (-277.707) -- 0:00:42
284000 -- (-280.417) (-277.851) (-277.432) [-278.681] * (-277.625) (-278.297) [-279.377] (-277.171) -- 0:00:42
284500 -- [-278.773] (-281.317) (-279.037) (-278.159) * (-277.137) (-278.885) [-278.640] (-278.895) -- 0:00:42
285000 -- (-278.205) (-279.221) (-277.665) [-281.258] * (-279.669) [-278.173] (-279.120) (-279.990) -- 0:00:42
Average standard deviation of split frequencies: 0.016222
285500 -- (-279.583) [-278.165] (-280.039) (-279.845) * (-279.929) [-276.922] (-279.980) (-280.108) -- 0:00:42
286000 -- (-279.484) (-277.478) [-279.346] (-281.718) * (-281.520) [-280.030] (-279.860) (-277.362) -- 0:00:42
286500 -- (-281.292) [-278.290] (-279.422) (-278.605) * (-279.007) (-278.261) (-278.917) [-277.762] -- 0:00:42
287000 -- (-277.156) [-279.573] (-280.816) (-281.348) * (-279.341) [-277.440] (-287.585) (-277.557) -- 0:00:42
287500 -- [-277.756] (-279.219) (-285.231) (-280.424) * [-277.504] (-276.490) (-280.102) (-278.814) -- 0:00:42
288000 -- (-283.339) [-277.984] (-280.035) (-278.102) * (-278.934) (-278.123) (-277.005) [-277.350] -- 0:00:42
288500 -- [-277.898] (-281.257) (-279.672) (-281.199) * (-280.294) [-278.280] (-277.915) (-278.513) -- 0:00:41
289000 -- (-279.030) (-279.137) [-279.867] (-278.680) * (-280.468) (-279.055) (-279.174) [-281.942] -- 0:00:41
289500 -- (-279.240) [-281.133] (-279.332) (-279.103) * (-279.649) [-277.647] (-279.384) (-279.941) -- 0:00:41
290000 -- [-279.675] (-279.501) (-279.384) (-281.191) * [-277.282] (-279.981) (-277.402) (-280.246) -- 0:00:41
Average standard deviation of split frequencies: 0.015621
290500 -- (-280.880) (-277.695) (-280.539) [-280.278] * (-279.109) (-277.222) (-278.380) [-277.113] -- 0:00:41
291000 -- (-278.918) (-279.345) (-277.279) [-276.989] * [-277.778] (-276.865) (-278.731) (-276.848) -- 0:00:41
291500 -- (-277.722) (-276.708) (-277.689) [-278.815] * (-277.250) (-278.623) [-278.269] (-279.750) -- 0:00:41
292000 -- (-277.410) [-277.903] (-278.531) (-281.916) * [-277.273] (-280.740) (-277.362) (-279.340) -- 0:00:41
292500 -- (-277.460) (-280.340) (-278.491) [-277.800] * (-277.589) (-278.292) (-279.625) [-278.417] -- 0:00:41
293000 -- [-277.437] (-280.673) (-277.011) (-279.689) * (-278.251) (-276.870) (-277.374) [-278.242] -- 0:00:41
293500 -- [-278.677] (-277.513) (-278.257) (-276.720) * (-278.620) (-281.279) [-278.193] (-279.963) -- 0:00:40
294000 -- (-277.227) [-277.678] (-284.404) (-278.299) * (-282.017) (-285.169) (-280.945) [-278.152] -- 0:00:40
294500 -- (-278.238) [-276.937] (-279.892) (-278.137) * (-279.135) [-280.847] (-280.079) (-279.450) -- 0:00:40
295000 -- [-278.494] (-277.896) (-279.144) (-279.714) * [-278.080] (-276.501) (-279.848) (-278.563) -- 0:00:40
Average standard deviation of split frequencies: 0.013979
295500 -- (-277.846) [-281.270] (-277.876) (-277.740) * (-278.070) (-278.663) (-277.167) [-277.839] -- 0:00:40
296000 -- (-281.156) [-278.439] (-277.145) (-277.471) * (-279.300) [-277.907] (-277.721) (-277.853) -- 0:00:42
296500 -- (-280.423) [-278.589] (-278.439) (-278.003) * (-276.846) [-279.287] (-278.098) (-277.631) -- 0:00:42
297000 -- (-280.885) (-278.032) [-278.843] (-281.187) * (-277.690) [-279.113] (-281.073) (-279.569) -- 0:00:42
297500 -- (-279.137) (-277.045) [-277.408] (-279.955) * (-277.349) (-277.413) (-278.567) [-278.453] -- 0:00:42
298000 -- (-280.776) [-279.326] (-279.256) (-286.817) * (-280.273) (-277.261) (-278.447) [-276.793] -- 0:00:42
298500 -- (-284.361) (-279.087) (-282.127) [-282.727] * (-279.419) (-281.790) (-277.285) [-277.009] -- 0:00:42
299000 -- (-278.129) (-278.819) (-282.890) [-278.041] * [-278.270] (-283.090) (-277.123) (-281.312) -- 0:00:42
299500 -- [-278.353] (-284.679) (-279.211) (-283.273) * (-281.715) (-277.401) [-276.649] (-278.021) -- 0:00:42
300000 -- (-279.150) (-279.498) (-277.860) [-281.603] * [-279.315] (-277.090) (-280.127) (-277.655) -- 0:00:42
Average standard deviation of split frequencies: 0.013066
300500 -- (-278.496) (-279.331) (-283.180) [-277.744] * (-282.592) (-276.947) (-279.392) [-277.245] -- 0:00:41
301000 -- (-279.618) (-279.571) [-276.893] (-276.798) * (-280.674) (-278.232) [-276.819] (-278.332) -- 0:00:41
301500 -- (-279.084) (-279.895) [-276.790] (-283.416) * (-279.803) (-278.410) (-277.685) [-278.858] -- 0:00:41
302000 -- [-277.639] (-278.399) (-278.701) (-279.213) * (-279.489) (-277.894) (-278.696) [-277.211] -- 0:00:41
302500 -- (-280.009) [-276.961] (-279.421) (-278.732) * (-280.733) [-276.996] (-277.933) (-276.967) -- 0:00:41
303000 -- (-279.066) [-278.012] (-279.000) (-278.583) * (-282.794) (-276.703) (-290.651) [-277.739] -- 0:00:41
303500 -- (-279.834) (-277.258) (-280.501) [-278.674] * (-276.829) [-280.905] (-284.762) (-279.175) -- 0:00:41
304000 -- [-278.979] (-278.632) (-279.166) (-279.112) * (-282.066) [-279.277] (-280.112) (-280.576) -- 0:00:41
304500 -- (-279.452) [-278.714] (-280.577) (-281.425) * [-279.185] (-277.590) (-278.573) (-279.080) -- 0:00:41
305000 -- (-277.528) (-282.021) [-279.036] (-281.011) * (-277.393) (-278.638) (-278.271) [-279.677] -- 0:00:41
Average standard deviation of split frequencies: 0.012892
305500 -- (-279.963) (-277.290) (-279.563) [-279.200] * [-279.059] (-279.361) (-281.162) (-283.243) -- 0:00:40
306000 -- (-278.182) (-279.713) (-278.457) [-280.165] * (-277.007) (-277.840) [-277.143] (-280.218) -- 0:00:40
306500 -- (-277.096) (-277.534) (-276.654) [-277.744] * (-278.628) [-279.161] (-279.289) (-278.120) -- 0:00:40
307000 -- (-277.477) [-278.214] (-277.289) (-277.980) * (-278.853) (-280.443) [-277.293] (-280.506) -- 0:00:40
307500 -- (-280.089) (-277.659) [-280.628] (-278.637) * (-277.625) [-276.885] (-278.119) (-280.285) -- 0:00:40
308000 -- (-277.245) (-277.897) (-281.680) [-276.725] * (-277.007) [-277.136] (-277.468) (-276.979) -- 0:00:40
308500 -- [-277.205] (-277.241) (-276.944) (-278.508) * (-279.735) (-281.748) [-277.153] (-281.707) -- 0:00:40
309000 -- (-277.893) (-278.565) (-278.522) [-280.073] * (-278.863) (-284.119) (-277.807) [-281.146] -- 0:00:40
309500 -- [-278.295] (-277.918) (-277.734) (-279.515) * (-277.944) (-281.273) (-278.043) [-277.047] -- 0:00:40
310000 -- (-281.267) [-280.600] (-279.477) (-278.658) * (-280.803) (-278.713) (-276.763) [-278.994] -- 0:00:40
Average standard deviation of split frequencies: 0.012698
310500 -- [-277.368] (-279.023) (-278.093) (-277.430) * (-281.170) (-282.383) (-278.540) [-281.450] -- 0:00:39
311000 -- (-280.157) (-283.165) [-278.554] (-277.045) * (-278.835) [-278.913] (-279.740) (-277.786) -- 0:00:39
311500 -- (-280.263) [-280.544] (-278.535) (-278.430) * (-278.490) [-278.546] (-284.351) (-277.816) -- 0:00:39
312000 -- (-277.022) (-279.608) [-280.298] (-277.858) * (-278.050) (-279.177) (-279.369) [-276.925] -- 0:00:39
312500 -- (-282.293) (-280.064) [-278.414] (-277.493) * [-277.115] (-281.335) (-280.164) (-277.066) -- 0:00:39
313000 -- (-282.301) (-277.901) (-277.475) [-279.307] * (-278.549) (-278.835) (-278.668) [-277.905] -- 0:00:41
313500 -- (-281.281) (-284.276) (-276.960) [-277.816] * (-283.077) (-278.535) [-277.906] (-279.054) -- 0:00:41
314000 -- [-277.695] (-277.931) (-278.306) (-278.281) * (-282.890) (-280.003) [-277.773] (-278.106) -- 0:00:41
314500 -- (-279.522) (-282.422) [-278.997] (-278.687) * (-279.939) (-277.943) (-276.572) [-279.534] -- 0:00:41
315000 -- (-279.240) [-278.872] (-279.332) (-277.875) * (-279.689) (-284.480) [-279.067] (-283.408) -- 0:00:41
Average standard deviation of split frequencies: 0.014172
315500 -- (-283.112) [-279.153] (-278.913) (-281.628) * (-278.099) [-276.968] (-277.397) (-277.239) -- 0:00:41
316000 -- [-278.405] (-280.833) (-280.042) (-278.323) * (-277.318) (-277.654) [-278.574] (-276.884) -- 0:00:41
316500 -- (-277.752) (-277.328) [-282.874] (-278.218) * (-278.493) (-280.474) [-277.630] (-276.840) -- 0:00:41
317000 -- (-278.397) (-279.612) (-277.825) [-276.415] * (-278.757) [-279.083] (-280.088) (-278.925) -- 0:00:40
317500 -- [-279.352] (-276.831) (-279.764) (-279.051) * [-278.530] (-277.829) (-281.838) (-281.553) -- 0:00:40
318000 -- [-281.370] (-277.788) (-276.723) (-278.838) * [-279.653] (-277.922) (-280.815) (-286.569) -- 0:00:40
318500 -- (-280.733) (-280.192) [-278.007] (-282.626) * [-284.153] (-278.894) (-279.465) (-279.642) -- 0:00:40
319000 -- [-277.828] (-279.821) (-281.705) (-280.696) * (-277.841) (-282.090) (-278.534) [-279.885] -- 0:00:40
319500 -- (-277.943) (-282.820) [-278.865] (-281.499) * (-277.472) [-279.222] (-278.362) (-280.353) -- 0:00:40
320000 -- (-278.553) (-280.512) (-279.177) [-281.407] * (-277.378) (-278.729) [-278.316] (-280.955) -- 0:00:40
Average standard deviation of split frequencies: 0.013850
320500 -- (-277.589) (-281.282) (-279.128) [-280.668] * (-286.259) (-277.900) [-276.316] (-278.088) -- 0:00:40
321000 -- (-279.170) [-278.056] (-280.552) (-279.106) * (-280.618) (-279.409) (-280.440) [-279.531] -- 0:00:40
321500 -- [-277.125] (-279.293) (-278.572) (-278.351) * (-278.386) (-278.618) [-277.555] (-278.500) -- 0:00:40
322000 -- [-278.705] (-278.923) (-278.521) (-278.184) * [-278.868] (-277.551) (-280.165) (-279.062) -- 0:00:40
322500 -- (-280.218) (-277.270) [-279.061] (-282.754) * (-278.144) (-279.680) (-279.658) [-278.276] -- 0:00:39
323000 -- (-279.354) (-277.179) [-276.968] (-277.065) * (-282.297) [-276.642] (-283.313) (-279.878) -- 0:00:39
323500 -- (-283.464) (-283.546) [-277.504] (-281.704) * (-277.543) (-277.527) (-279.975) [-279.015] -- 0:00:39
324000 -- (-282.096) (-280.431) (-277.237) [-281.637] * (-277.070) (-277.217) (-281.519) [-277.518] -- 0:00:39
324500 -- (-278.250) (-277.458) [-278.487] (-280.975) * (-283.224) (-279.599) (-280.985) [-277.327] -- 0:00:39
325000 -- (-278.952) (-281.178) [-280.353] (-276.774) * (-279.867) [-279.267] (-282.470) (-280.643) -- 0:00:39
Average standard deviation of split frequencies: 0.013376
325500 -- [-281.108] (-280.265) (-280.488) (-276.963) * (-280.758) (-278.448) [-279.351] (-277.936) -- 0:00:39
326000 -- (-281.117) (-278.756) (-281.169) [-279.264] * (-277.329) [-277.837] (-277.018) (-280.501) -- 0:00:39
326500 -- (-278.882) (-276.760) [-276.805] (-280.941) * [-277.020] (-279.169) (-277.484) (-281.859) -- 0:00:39
327000 -- (-277.560) [-277.486] (-277.196) (-278.021) * (-279.305) [-282.311] (-276.557) (-279.226) -- 0:00:39
327500 -- [-276.831] (-282.972) (-280.211) (-278.345) * (-277.024) (-279.392) (-277.001) [-282.174] -- 0:00:39
328000 -- [-280.031] (-278.144) (-279.245) (-284.301) * (-276.822) [-277.134] (-277.586) (-277.441) -- 0:00:38
328500 -- (-277.640) (-280.545) (-278.623) [-278.404] * (-280.199) [-276.870] (-280.375) (-276.959) -- 0:00:38
329000 -- [-278.205] (-280.772) (-277.508) (-280.137) * [-277.964] (-277.403) (-277.360) (-278.589) -- 0:00:38
329500 -- (-277.497) (-281.318) (-277.567) [-278.704] * (-278.741) (-277.593) [-279.034] (-277.470) -- 0:00:38
330000 -- (-279.487) (-279.290) [-278.254] (-277.769) * [-277.814] (-280.321) (-278.668) (-279.152) -- 0:00:38
Average standard deviation of split frequencies: 0.013330
330500 -- (-278.402) [-277.933] (-284.669) (-277.716) * [-276.990] (-281.567) (-279.162) (-276.976) -- 0:00:40
331000 -- (-277.354) (-280.215) (-280.373) [-278.485] * (-277.697) (-278.664) [-280.889] (-276.933) -- 0:00:40
331500 -- [-276.437] (-280.719) (-280.176) (-281.758) * (-278.432) (-279.741) (-286.482) [-276.766] -- 0:00:40
332000 -- (-279.445) (-282.573) (-282.146) [-279.071] * (-282.116) (-278.538) (-279.248) [-278.078] -- 0:00:40
332500 -- (-281.634) (-280.743) (-277.766) [-276.823] * (-281.308) (-279.704) [-278.830] (-278.705) -- 0:00:40
333000 -- (-278.650) (-277.011) [-277.885] (-280.003) * (-279.266) [-278.036] (-277.087) (-281.498) -- 0:00:40
333500 -- (-279.371) (-280.904) [-277.807] (-280.158) * (-278.150) (-278.832) [-278.552] (-278.005) -- 0:00:39
334000 -- [-279.682] (-281.218) (-277.107) (-279.040) * (-278.032) [-277.690] (-281.333) (-278.747) -- 0:00:39
334500 -- (-276.608) (-279.275) [-278.410] (-278.376) * [-279.164] (-280.971) (-279.940) (-277.992) -- 0:00:39
335000 -- (-278.319) (-278.964) (-280.296) [-276.897] * [-278.796] (-281.119) (-281.758) (-278.846) -- 0:00:39
Average standard deviation of split frequencies: 0.013882
335500 -- (-278.276) [-279.299] (-277.247) (-282.673) * (-281.044) (-277.181) [-282.814] (-277.912) -- 0:00:39
336000 -- (-277.503) [-278.492] (-276.716) (-278.605) * [-276.734] (-278.579) (-281.908) (-278.461) -- 0:00:39
336500 -- (-279.945) (-279.908) [-277.997] (-280.820) * (-279.984) (-277.149) (-280.119) [-281.942] -- 0:00:39
337000 -- (-281.799) (-281.716) (-277.150) [-282.310] * (-278.694) (-281.049) [-282.001] (-278.831) -- 0:00:39
337500 -- (-279.210) [-279.282] (-279.870) (-285.907) * (-277.835) (-280.317) (-277.613) [-280.483] -- 0:00:39
338000 -- (-281.148) [-278.139] (-278.129) (-281.466) * (-280.369) (-278.177) (-278.957) [-277.085] -- 0:00:39
338500 -- (-283.108) [-278.826] (-282.256) (-279.059) * (-277.497) (-279.485) (-277.272) [-279.982] -- 0:00:39
339000 -- (-281.474) (-282.834) (-277.916) [-280.102] * (-277.490) [-278.711] (-279.219) (-276.776) -- 0:00:38
339500 -- (-279.500) (-278.187) [-277.453] (-277.665) * (-278.017) (-276.806) (-283.056) [-279.376] -- 0:00:38
340000 -- (-280.906) (-280.746) [-278.010] (-280.047) * (-278.364) [-277.564] (-280.114) (-279.959) -- 0:00:38
Average standard deviation of split frequencies: 0.014114
340500 -- (-279.900) [-280.642] (-278.132) (-278.431) * (-278.373) (-278.636) (-278.113) [-280.614] -- 0:00:38
341000 -- [-278.429] (-277.029) (-278.424) (-278.331) * (-277.662) [-278.033] (-277.974) (-278.273) -- 0:00:38
341500 -- (-279.673) (-277.831) [-281.046] (-277.169) * [-279.722] (-277.206) (-278.774) (-280.301) -- 0:00:38
342000 -- (-277.456) (-278.942) (-277.165) [-277.756] * (-278.206) (-277.163) [-281.186] (-279.160) -- 0:00:38
342500 -- (-277.066) (-277.535) [-278.144] (-279.245) * (-277.703) [-277.107] (-282.552) (-277.509) -- 0:00:38
343000 -- (-280.219) (-278.792) [-279.860] (-281.838) * (-281.960) [-278.358] (-284.704) (-278.481) -- 0:00:38
343500 -- (-281.812) (-278.498) [-278.852] (-277.085) * (-277.672) [-277.085] (-279.285) (-279.421) -- 0:00:38
344000 -- (-278.831) (-277.974) (-281.328) [-277.628] * (-277.450) (-278.413) (-278.977) [-277.819] -- 0:00:38
344500 -- (-277.421) (-280.677) [-282.816] (-282.994) * (-279.742) [-277.322] (-278.361) (-278.279) -- 0:00:38
345000 -- (-280.242) (-278.195) [-276.808] (-278.770) * (-286.069) (-277.530) (-276.659) [-277.082] -- 0:00:37
Average standard deviation of split frequencies: 0.013624
345500 -- (-277.838) (-278.544) [-278.391] (-279.975) * (-287.291) (-278.373) (-278.956) [-278.462] -- 0:00:37
346000 -- [-279.688] (-278.231) (-277.453) (-279.163) * (-283.206) (-278.170) [-276.704] (-278.927) -- 0:00:37
346500 -- (-276.914) (-279.090) (-277.532) [-278.536] * (-279.738) (-281.086) [-278.050] (-280.775) -- 0:00:37
347000 -- [-280.164] (-277.002) (-277.486) (-278.623) * [-278.414] (-280.839) (-276.380) (-279.075) -- 0:00:37
347500 -- (-284.274) (-277.515) [-277.042] (-278.276) * (-281.034) (-277.907) (-278.404) [-280.190] -- 0:00:39
348000 -- [-279.469] (-277.917) (-279.389) (-278.420) * [-278.160] (-277.050) (-279.822) (-277.610) -- 0:00:39
348500 -- (-279.337) (-279.923) [-280.157] (-277.811) * (-281.406) (-277.710) [-277.791] (-277.334) -- 0:00:39
349000 -- (-285.212) (-279.932) [-280.332] (-278.448) * (-281.052) (-276.704) (-277.181) [-276.306] -- 0:00:39
349500 -- (-279.878) [-277.213] (-278.563) (-282.180) * [-280.354] (-280.563) (-279.032) (-276.296) -- 0:00:39
350000 -- (-280.447) [-278.263] (-277.627) (-281.640) * (-276.922) [-279.182] (-278.520) (-279.442) -- 0:00:39
Average standard deviation of split frequencies: 0.012311
350500 -- (-279.308) (-279.995) (-277.538) [-277.603] * (-277.264) (-278.101) (-277.886) [-279.392] -- 0:00:38
351000 -- (-279.271) (-278.242) (-278.146) [-276.721] * [-280.323] (-280.710) (-281.133) (-281.862) -- 0:00:38
351500 -- (-277.082) (-277.322) [-279.448] (-279.274) * [-278.267] (-278.891) (-276.737) (-279.345) -- 0:00:38
352000 -- (-276.490) [-281.004] (-279.513) (-279.848) * [-276.287] (-279.266) (-278.199) (-279.133) -- 0:00:38
352500 -- [-278.539] (-279.213) (-279.109) (-282.526) * (-278.772) (-281.176) (-277.958) [-280.741] -- 0:00:38
353000 -- (-276.632) (-279.659) [-282.599] (-282.177) * (-280.308) [-278.835] (-277.639) (-279.073) -- 0:00:38
353500 -- (-281.235) [-280.364] (-277.424) (-279.737) * (-277.996) (-280.634) [-280.158] (-279.496) -- 0:00:38
354000 -- (-278.225) (-278.394) [-285.234] (-277.873) * (-279.230) (-282.724) (-279.247) [-282.951] -- 0:00:38
354500 -- (-279.930) [-277.580] (-277.755) (-279.953) * (-278.294) (-281.207) [-280.766] (-282.217) -- 0:00:38
355000 -- (-278.268) (-278.429) (-281.413) [-278.310] * [-278.492] (-277.982) (-279.327) (-281.981) -- 0:00:38
Average standard deviation of split frequencies: 0.013311
355500 -- (-278.789) [-279.446] (-279.916) (-277.625) * (-277.549) (-279.794) (-277.108) [-278.426] -- 0:00:38
356000 -- (-277.166) (-277.546) [-277.425] (-277.746) * (-278.932) (-277.609) (-281.522) [-277.624] -- 0:00:37
356500 -- (-279.618) [-277.283] (-279.295) (-277.123) * (-277.993) (-278.230) [-276.429] (-282.282) -- 0:00:37
357000 -- (-279.687) (-278.091) (-283.746) [-280.860] * [-277.826] (-277.886) (-280.100) (-277.561) -- 0:00:37
357500 -- (-277.921) (-277.920) (-279.984) [-278.087] * (-281.348) (-277.212) (-276.981) [-278.545] -- 0:00:37
358000 -- (-277.257) (-276.840) (-277.083) [-279.213] * (-280.706) (-281.846) (-280.160) [-277.273] -- 0:00:37
358500 -- (-278.485) (-278.478) (-277.832) [-277.193] * (-277.555) (-281.472) (-276.719) [-278.358] -- 0:00:37
359000 -- (-280.084) (-278.839) (-279.140) [-277.220] * (-281.751) (-278.675) (-280.758) [-277.325] -- 0:00:37
359500 -- (-282.856) [-279.634] (-279.318) (-277.395) * [-276.965] (-278.839) (-286.044) (-278.530) -- 0:00:37
360000 -- [-278.077] (-276.540) (-278.597) (-278.522) * (-282.098) [-278.768] (-279.914) (-281.966) -- 0:00:37
Average standard deviation of split frequencies: 0.013208
360500 -- (-278.972) (-279.117) [-278.422] (-277.609) * [-285.488] (-278.716) (-279.184) (-277.253) -- 0:00:37
361000 -- (-280.635) [-278.637] (-277.835) (-277.063) * (-279.714) (-280.633) [-277.593] (-280.871) -- 0:00:37
361500 -- (-277.771) (-280.894) [-281.747] (-277.019) * [-276.579] (-279.624) (-284.970) (-278.637) -- 0:00:37
362000 -- (-280.723) (-283.809) (-279.564) [-280.532] * (-276.633) (-281.798) (-283.149) [-277.205] -- 0:00:37
362500 -- (-276.866) [-277.607] (-280.762) (-277.473) * (-281.926) (-279.516) (-278.491) [-278.037] -- 0:00:36
363000 -- [-276.620] (-285.478) (-284.638) (-276.981) * (-280.732) [-278.454] (-278.525) (-281.217) -- 0:00:36
363500 -- (-277.303) [-279.064] (-278.198) (-279.659) * (-277.849) (-278.037) (-279.529) [-277.756] -- 0:00:36
364000 -- (-278.291) [-278.269] (-282.065) (-282.150) * [-278.789] (-284.457) (-278.390) (-278.526) -- 0:00:36
364500 -- (-277.812) (-278.028) (-280.457) [-277.795] * (-279.831) [-279.273] (-277.781) (-277.750) -- 0:00:36
365000 -- [-277.222] (-279.126) (-277.979) (-278.975) * (-280.648) (-277.136) [-279.704] (-276.927) -- 0:00:38
Average standard deviation of split frequencies: 0.013083
365500 -- [-277.998] (-279.620) (-277.242) (-278.771) * (-281.592) [-280.629] (-278.368) (-278.981) -- 0:00:38
366000 -- [-281.432] (-278.114) (-284.313) (-281.409) * (-277.461) [-279.194] (-280.564) (-277.011) -- 0:00:38
366500 -- (-284.050) (-278.434) [-277.616] (-283.428) * (-277.553) (-281.394) [-278.724] (-277.496) -- 0:00:38
367000 -- [-281.310] (-279.693) (-277.995) (-282.724) * (-279.221) (-282.518) (-277.099) [-276.921] -- 0:00:37
367500 -- (-278.108) (-278.674) [-278.584] (-281.223) * (-278.956) (-278.100) (-285.893) [-277.951] -- 0:00:37
368000 -- (-280.090) (-277.644) [-278.167] (-277.808) * (-278.190) (-276.709) (-276.841) [-277.063] -- 0:00:37
368500 -- (-276.826) (-277.468) (-277.638) [-279.809] * (-277.065) [-276.765] (-281.345) (-276.439) -- 0:00:37
369000 -- (-277.087) [-278.542] (-279.789) (-279.813) * (-277.449) (-277.970) [-279.193] (-279.353) -- 0:00:37
369500 -- (-279.112) (-276.333) (-280.393) [-279.813] * (-279.224) [-278.876] (-277.360) (-279.363) -- 0:00:37
370000 -- [-278.855] (-277.284) (-277.048) (-277.288) * (-279.779) [-278.772] (-279.731) (-279.803) -- 0:00:37
Average standard deviation of split frequencies: 0.013417
370500 -- (-278.813) (-279.142) (-277.568) [-280.672] * (-278.977) (-286.285) (-278.087) [-277.047] -- 0:00:37
371000 -- [-279.009] (-280.563) (-280.314) (-279.162) * (-277.774) (-278.473) [-278.559] (-281.302) -- 0:00:37
371500 -- [-278.709] (-277.717) (-277.133) (-281.773) * (-277.710) (-277.815) (-276.560) [-277.315] -- 0:00:37
372000 -- (-278.794) (-280.278) (-278.325) [-279.113] * (-278.196) (-277.265) (-277.915) [-277.324] -- 0:00:37
372500 -- (-277.441) (-283.898) (-278.964) [-280.907] * (-277.775) [-279.804] (-279.765) (-279.113) -- 0:00:37
373000 -- (-281.215) [-279.960] (-280.622) (-278.141) * (-279.655) (-277.868) [-279.713] (-279.004) -- 0:00:36
373500 -- (-279.972) [-280.204] (-280.955) (-278.080) * [-277.365] (-276.916) (-280.861) (-278.580) -- 0:00:36
374000 -- (-281.563) [-279.516] (-277.966) (-277.567) * (-280.955) [-280.004] (-278.775) (-281.210) -- 0:00:36
374500 -- [-277.715] (-278.956) (-277.416) (-277.741) * (-279.840) (-277.324) (-279.054) [-281.584] -- 0:00:36
375000 -- (-277.101) (-278.810) [-276.919] (-278.813) * (-280.466) [-278.673] (-277.648) (-279.114) -- 0:00:36
Average standard deviation of split frequencies: 0.013461
375500 -- [-276.601] (-278.363) (-277.176) (-278.359) * (-277.405) (-280.742) (-277.119) [-278.189] -- 0:00:36
376000 -- (-280.959) [-277.969] (-280.955) (-281.315) * (-283.385) (-284.214) (-278.698) [-279.504] -- 0:00:36
376500 -- (-281.016) [-277.958] (-278.022) (-279.438) * (-278.054) [-277.831] (-277.166) (-278.529) -- 0:00:36
377000 -- (-279.659) [-277.307] (-286.068) (-278.198) * (-281.009) (-280.479) [-279.046] (-277.218) -- 0:00:36
377500 -- (-281.344) (-277.001) [-280.738] (-278.878) * (-280.312) (-280.965) (-278.961) [-277.707] -- 0:00:36
378000 -- (-278.952) (-277.163) [-278.292] (-277.156) * (-278.674) (-277.715) (-277.581) [-277.583] -- 0:00:36
378500 -- (-279.022) [-277.115] (-280.944) (-277.947) * [-279.518] (-278.640) (-278.611) (-278.250) -- 0:00:36
379000 -- (-280.010) (-278.148) (-283.899) [-277.723] * [-280.816] (-278.439) (-277.520) (-277.263) -- 0:00:36
379500 -- (-279.720) (-278.786) (-281.407) [-279.075] * (-279.716) (-277.348) (-277.936) [-277.777] -- 0:00:35
380000 -- (-279.416) (-279.339) [-278.548] (-279.195) * (-277.243) (-281.606) [-276.604] (-277.737) -- 0:00:35
Average standard deviation of split frequencies: 0.013361
380500 -- (-279.859) [-278.160] (-279.535) (-278.082) * (-278.487) (-283.988) [-277.327] (-282.127) -- 0:00:35
381000 -- (-280.670) (-279.322) [-278.101] (-278.549) * (-277.722) (-277.031) [-277.186] (-280.725) -- 0:00:35
381500 -- (-282.862) [-278.354] (-278.464) (-277.008) * (-279.437) (-278.552) [-277.652] (-278.547) -- 0:00:35
382000 -- (-281.629) (-280.360) [-277.571] (-277.883) * (-277.235) (-279.062) [-278.549] (-277.858) -- 0:00:37
382500 -- (-279.157) (-277.573) (-278.171) [-277.609] * [-279.737] (-281.104) (-278.411) (-279.873) -- 0:00:37
383000 -- (-281.112) (-276.843) [-279.735] (-278.340) * (-277.057) [-278.874] (-282.663) (-279.793) -- 0:00:37
383500 -- (-281.901) (-279.265) [-281.204] (-279.780) * [-277.576] (-278.945) (-277.821) (-278.609) -- 0:00:36
384000 -- [-276.999] (-278.408) (-277.242) (-278.601) * (-277.067) (-279.077) [-278.445] (-277.667) -- 0:00:36
384500 -- (-278.636) (-279.740) (-277.981) [-278.957] * (-280.884) [-277.224] (-278.691) (-276.582) -- 0:00:36
385000 -- (-279.001) (-279.081) [-278.759] (-278.761) * (-279.877) (-277.685) (-277.488) [-277.447] -- 0:00:36
Average standard deviation of split frequencies: 0.012945
385500 -- (-279.889) (-277.028) (-277.926) [-278.694] * (-282.823) (-281.103) (-278.146) [-282.303] -- 0:00:36
386000 -- (-278.912) (-277.079) (-279.909) [-277.675] * (-282.433) (-276.902) (-281.427) [-278.580] -- 0:00:36
386500 -- (-278.179) [-277.452] (-278.805) (-279.457) * (-279.441) (-279.965) (-279.157) [-277.962] -- 0:00:36
387000 -- [-279.930] (-280.927) (-277.378) (-281.306) * (-279.348) (-279.745) [-277.957] (-279.848) -- 0:00:36
387500 -- (-279.847) [-278.886] (-276.634) (-282.371) * (-279.125) (-280.630) (-276.877) [-278.009] -- 0:00:36
388000 -- (-279.213) [-279.116] (-276.827) (-282.886) * (-279.500) (-277.836) (-278.756) [-278.224] -- 0:00:36
388500 -- (-279.312) (-280.361) (-277.964) [-284.202] * (-278.839) (-279.493) [-279.071] (-277.270) -- 0:00:36
389000 -- (-277.044) (-276.868) [-278.433] (-284.032) * (-279.955) [-279.089] (-278.924) (-277.449) -- 0:00:36
389500 -- (-277.205) (-278.758) [-277.418] (-279.979) * (-277.421) (-281.378) (-279.094) [-280.483] -- 0:00:36
390000 -- (-282.574) (-278.702) [-277.286] (-279.683) * (-278.365) (-277.347) [-281.476] (-282.264) -- 0:00:35
Average standard deviation of split frequencies: 0.012194
390500 -- (-279.866) (-276.876) [-278.082] (-279.155) * (-278.388) (-278.235) (-282.791) [-281.737] -- 0:00:35
391000 -- (-279.574) (-280.714) (-278.576) [-277.203] * (-277.948) (-276.916) [-285.990] (-282.575) -- 0:00:35
391500 -- (-278.812) (-277.028) [-277.415] (-277.950) * [-279.858] (-281.851) (-279.709) (-276.934) -- 0:00:35
392000 -- [-279.837] (-276.699) (-277.315) (-278.931) * (-280.779) (-280.386) [-277.046] (-284.931) -- 0:00:35
392500 -- (-281.240) (-283.273) (-279.754) [-278.132] * (-278.957) (-277.401) (-278.217) [-278.542] -- 0:00:35
393000 -- (-281.903) [-277.745] (-280.500) (-278.113) * (-279.069) (-278.842) (-279.189) [-276.516] -- 0:00:35
393500 -- [-279.226] (-278.087) (-278.749) (-280.554) * (-281.377) (-278.924) (-282.604) [-277.755] -- 0:00:35
394000 -- (-277.995) [-276.730] (-282.617) (-279.092) * (-279.806) (-277.435) (-278.841) [-276.967] -- 0:00:35
394500 -- (-278.870) [-277.832] (-278.213) (-279.347) * [-278.045] (-278.842) (-277.555) (-278.410) -- 0:00:35
395000 -- (-276.569) [-278.341] (-278.299) (-278.097) * (-278.937) (-278.135) (-278.765) [-281.521] -- 0:00:35
Average standard deviation of split frequencies: 0.011904
395500 -- (-281.386) (-277.091) [-280.034] (-278.331) * (-279.974) (-279.086) (-279.406) [-279.250] -- 0:00:35
396000 -- (-284.254) [-282.031] (-278.432) (-277.522) * (-277.562) (-279.792) [-280.447] (-279.424) -- 0:00:35
396500 -- (-281.975) [-279.232] (-279.158) (-282.552) * (-279.504) [-280.835] (-277.424) (-284.297) -- 0:00:35
397000 -- [-282.831] (-279.613) (-280.132) (-279.598) * (-277.686) (-282.585) (-279.721) [-280.605] -- 0:00:34
397500 -- (-278.118) [-276.422] (-278.278) (-278.463) * [-278.348] (-282.125) (-279.876) (-279.761) -- 0:00:34
398000 -- (-279.329) [-277.841] (-278.803) (-285.682) * (-277.461) (-280.326) (-285.686) [-280.833] -- 0:00:34
398500 -- [-279.737] (-279.069) (-279.395) (-277.602) * (-277.760) [-279.125] (-278.152) (-278.730) -- 0:00:34
399000 -- (-277.885) (-277.050) (-281.884) [-276.727] * [-278.913] (-278.630) (-277.231) (-278.316) -- 0:00:36
399500 -- (-277.782) [-276.569] (-277.346) (-278.908) * (-277.450) [-278.068] (-281.180) (-278.052) -- 0:00:36
400000 -- (-277.070) [-276.962] (-280.620) (-277.708) * (-276.693) (-277.532) (-277.065) [-277.691] -- 0:00:36
Average standard deviation of split frequencies: 0.012042
400500 -- (-278.244) (-278.305) [-280.026] (-279.224) * [-276.464] (-278.505) (-280.069) (-277.771) -- 0:00:35
401000 -- [-279.007] (-277.423) (-280.408) (-276.866) * [-281.378] (-278.453) (-279.938) (-277.763) -- 0:00:35
401500 -- (-281.359) [-276.583] (-278.045) (-281.164) * (-277.099) (-279.225) (-280.374) [-278.497] -- 0:00:35
402000 -- [-278.868] (-281.695) (-276.501) (-279.420) * (-282.122) [-277.017] (-277.841) (-277.247) -- 0:00:35
402500 -- (-278.461) [-278.652] (-277.422) (-277.893) * (-279.690) (-277.076) (-281.775) [-279.968] -- 0:00:35
403000 -- (-278.987) (-276.742) [-278.234] (-276.514) * (-278.533) (-276.578) [-280.690] (-276.897) -- 0:00:35
403500 -- (-277.312) (-279.700) [-282.061] (-281.452) * (-278.585) (-277.724) (-278.919) [-279.145] -- 0:00:35
404000 -- (-278.537) (-278.921) (-279.848) [-280.111] * (-279.856) (-276.584) [-278.051] (-279.644) -- 0:00:35
404500 -- (-276.838) (-278.560) (-282.015) [-280.597] * (-283.323) (-278.882) (-277.678) [-277.210] -- 0:00:35
405000 -- [-278.150] (-279.137) (-278.100) (-278.180) * [-277.995] (-279.018) (-276.336) (-277.762) -- 0:00:35
Average standard deviation of split frequencies: 0.011952
405500 -- (-278.957) (-281.538) (-280.002) [-278.960] * (-282.259) (-278.646) [-277.541] (-284.155) -- 0:00:35
406000 -- (-279.351) (-278.298) [-277.108] (-281.702) * (-280.479) [-276.996] (-280.469) (-277.351) -- 0:00:35
406500 -- (-279.661) (-279.222) (-282.083) [-277.926] * [-278.143] (-276.909) (-285.526) (-280.748) -- 0:00:35
407000 -- (-281.062) [-277.478] (-279.557) (-279.789) * (-282.028) (-279.282) [-276.647] (-277.127) -- 0:00:34
407500 -- (-280.532) (-277.873) (-282.199) [-280.371] * [-279.066] (-276.850) (-276.750) (-277.119) -- 0:00:34
408000 -- [-279.247] (-280.159) (-278.197) (-279.698) * (-278.141) [-278.726] (-280.156) (-278.396) -- 0:00:34
408500 -- (-277.627) (-282.880) (-279.847) [-282.250] * [-277.829] (-277.298) (-276.360) (-276.636) -- 0:00:34
409000 -- [-280.372] (-276.981) (-280.118) (-279.372) * [-278.189] (-279.149) (-280.119) (-276.418) -- 0:00:34
409500 -- (-279.315) (-281.151) [-278.814] (-276.852) * (-282.139) [-278.310] (-281.653) (-277.463) -- 0:00:34
410000 -- (-280.960) [-279.298] (-279.033) (-281.502) * [-282.166] (-279.867) (-278.790) (-279.553) -- 0:00:34
Average standard deviation of split frequencies: 0.013137
410500 -- [-281.088] (-281.939) (-277.454) (-279.416) * (-281.563) (-283.917) [-282.486] (-280.625) -- 0:00:34
411000 -- [-278.469] (-277.164) (-280.362) (-278.177) * [-279.215] (-277.807) (-279.543) (-279.554) -- 0:00:34
411500 -- (-276.836) (-278.295) (-278.682) [-279.837] * (-280.818) [-277.367] (-281.750) (-284.213) -- 0:00:34
412000 -- (-281.308) (-278.640) (-277.939) [-280.291] * [-277.418] (-276.865) (-276.866) (-284.053) -- 0:00:34
412500 -- (-277.707) (-279.282) [-279.201] (-282.219) * (-278.173) [-281.264] (-280.773) (-278.975) -- 0:00:34
413000 -- (-277.900) [-278.714] (-279.521) (-280.063) * (-280.650) (-277.190) (-279.192) [-279.662] -- 0:00:34
413500 -- [-282.616] (-280.095) (-279.830) (-279.000) * (-283.405) (-281.180) (-279.807) [-280.227] -- 0:00:34
414000 -- (-280.022) [-277.838] (-281.270) (-277.185) * [-277.901] (-278.313) (-277.872) (-283.209) -- 0:00:33
414500 -- (-278.286) [-279.319] (-279.762) (-278.667) * [-277.158] (-280.746) (-277.610) (-281.737) -- 0:00:33
415000 -- (-277.149) (-282.301) [-278.403] (-280.183) * (-281.110) (-282.527) (-278.948) [-276.717] -- 0:00:33
Average standard deviation of split frequencies: 0.012398
415500 -- [-276.471] (-279.149) (-278.138) (-278.380) * [-282.650] (-280.630) (-277.874) (-278.394) -- 0:00:33
416000 -- (-278.433) (-277.120) [-279.208] (-284.542) * [-281.333] (-279.838) (-280.296) (-280.607) -- 0:00:35
416500 -- (-279.575) [-279.956] (-278.796) (-281.225) * [-278.504] (-278.570) (-280.974) (-278.862) -- 0:00:35
417000 -- (-279.118) [-279.015] (-277.153) (-276.572) * [-280.265] (-278.441) (-279.309) (-277.274) -- 0:00:34
417500 -- (-284.882) (-279.449) [-277.855] (-277.727) * (-279.108) [-278.596] (-280.472) (-279.339) -- 0:00:34
418000 -- [-282.154] (-278.580) (-279.034) (-278.212) * (-282.196) (-278.039) [-278.112] (-279.380) -- 0:00:34
418500 -- (-276.880) [-276.270] (-279.252) (-279.542) * (-283.178) (-276.893) (-279.283) [-277.429] -- 0:00:34
419000 -- (-276.691) [-276.870] (-276.896) (-279.638) * (-278.117) (-281.123) [-280.883] (-278.832) -- 0:00:34
419500 -- (-283.352) (-279.742) [-279.481] (-281.820) * (-280.674) (-278.926) (-278.413) [-281.657] -- 0:00:34
420000 -- (-283.261) (-278.795) [-279.213] (-286.067) * (-283.386) (-279.107) [-279.497] (-278.755) -- 0:00:34
Average standard deviation of split frequencies: 0.013250
420500 -- (-281.343) (-279.201) [-276.741] (-277.159) * (-280.913) (-280.396) (-281.053) [-278.727] -- 0:00:34
421000 -- (-276.916) (-278.469) (-278.085) [-278.554] * (-279.421) [-280.615] (-276.918) (-282.120) -- 0:00:34
421500 -- [-277.628] (-277.059) (-277.959) (-277.958) * (-279.633) (-283.079) (-278.192) [-278.702] -- 0:00:34
422000 -- (-278.245) (-278.974) (-280.517) [-279.499] * (-286.491) (-278.330) [-281.594] (-278.311) -- 0:00:34
422500 -- (-278.687) [-280.423] (-279.819) (-287.080) * [-278.839] (-278.598) (-277.946) (-277.222) -- 0:00:34
423000 -- [-278.629] (-280.904) (-276.891) (-277.591) * [-278.251] (-279.641) (-276.675) (-279.987) -- 0:00:34
423500 -- (-277.713) [-278.234] (-279.332) (-279.442) * (-277.640) (-276.889) (-276.852) [-277.029] -- 0:00:34
424000 -- (-280.028) [-278.972] (-278.293) (-278.966) * [-279.908] (-279.979) (-278.787) (-277.859) -- 0:00:33
424500 -- (-276.654) (-276.468) (-277.299) [-280.127] * [-278.058] (-277.057) (-278.121) (-279.585) -- 0:00:33
425000 -- (-279.174) (-282.197) (-277.002) [-278.983] * (-278.502) (-278.859) (-277.874) [-278.464] -- 0:00:33
Average standard deviation of split frequencies: 0.012823
425500 -- [-279.008] (-276.914) (-279.456) (-278.828) * (-281.727) [-277.450] (-279.785) (-278.599) -- 0:00:33
426000 -- (-277.104) (-277.470) [-276.659] (-279.905) * (-279.100) (-280.841) (-281.085) [-277.784] -- 0:00:33
426500 -- [-277.095] (-280.677) (-278.127) (-277.940) * (-277.488) (-280.192) (-276.856) [-282.442] -- 0:00:33
427000 -- [-277.647] (-277.062) (-279.873) (-278.920) * (-282.376) [-276.495] (-279.466) (-278.065) -- 0:00:33
427500 -- (-279.786) (-278.862) (-277.589) [-279.945] * (-277.017) [-278.004] (-281.024) (-278.342) -- 0:00:33
428000 -- (-277.081) (-279.315) [-278.623] (-279.246) * (-278.256) (-276.877) (-277.901) [-277.098] -- 0:00:33
428500 -- [-276.957] (-278.225) (-277.987) (-278.453) * (-276.809) (-276.808) [-278.159] (-277.003) -- 0:00:33
429000 -- (-280.012) (-280.339) (-277.220) [-277.412] * [-280.105] (-277.830) (-277.448) (-280.562) -- 0:00:33
429500 -- [-276.983] (-280.654) (-278.405) (-278.457) * [-282.225] (-279.457) (-277.047) (-281.329) -- 0:00:33
430000 -- (-278.403) (-278.813) (-277.176) [-277.792] * (-279.876) (-278.223) [-278.404] (-278.941) -- 0:00:33
Average standard deviation of split frequencies: 0.012620
430500 -- (-277.504) [-279.229] (-278.649) (-279.980) * [-277.874] (-278.101) (-279.454) (-280.389) -- 0:00:33
431000 -- (-277.424) (-280.110) (-280.824) [-279.886] * [-278.187] (-283.256) (-278.820) (-277.678) -- 0:00:33
431500 -- (-277.249) (-276.940) [-279.282] (-278.891) * (-278.133) (-281.606) (-277.082) [-281.409] -- 0:00:32
432000 -- [-276.679] (-277.788) (-279.293) (-278.499) * (-278.576) (-278.061) (-277.635) [-279.389] -- 0:00:32
432500 -- [-278.448] (-280.460) (-277.403) (-277.486) * (-277.756) (-280.006) (-277.700) [-278.705] -- 0:00:32
433000 -- [-278.173] (-279.656) (-278.797) (-277.567) * [-276.965] (-277.933) (-277.360) (-277.657) -- 0:00:32
433500 -- [-277.906] (-281.583) (-278.797) (-278.145) * [-281.270] (-277.403) (-277.744) (-277.504) -- 0:00:33
434000 -- (-282.343) (-281.704) (-279.254) [-278.807] * (-278.053) (-278.195) [-278.153] (-277.856) -- 0:00:33
434500 -- (-278.273) (-282.083) (-280.290) [-277.792] * (-277.771) (-277.411) (-278.920) [-277.253] -- 0:00:33
435000 -- [-277.745] (-277.759) (-277.970) (-276.576) * [-279.060] (-277.557) (-281.403) (-277.619) -- 0:00:33
Average standard deviation of split frequencies: 0.012338
435500 -- (-284.165) (-279.418) (-276.716) [-276.661] * [-277.318] (-277.103) (-279.542) (-282.865) -- 0:00:33
436000 -- (-280.492) (-279.567) [-277.477] (-276.486) * (-278.416) (-276.662) [-282.057] (-279.267) -- 0:00:33
436500 -- (-278.362) [-284.914] (-276.615) (-276.732) * (-281.086) [-280.399] (-280.354) (-279.921) -- 0:00:33
437000 -- [-282.391] (-278.897) (-280.055) (-277.802) * (-281.544) (-281.609) [-277.798] (-278.276) -- 0:00:33
437500 -- (-280.794) [-278.897] (-282.895) (-282.338) * (-283.749) (-280.434) [-277.419] (-278.298) -- 0:00:33
438000 -- (-282.013) [-277.890] (-276.634) (-279.661) * (-277.636) (-280.149) (-276.896) [-278.061] -- 0:00:33
438500 -- [-280.559] (-278.945) (-277.486) (-280.411) * (-279.914) (-277.636) (-276.979) [-278.560] -- 0:00:33
439000 -- (-278.956) (-281.610) [-278.628] (-281.593) * (-281.180) (-281.752) [-279.268] (-277.919) -- 0:00:33
439500 -- (-277.964) (-280.146) (-278.123) [-282.395] * (-278.170) (-279.421) [-278.989] (-279.259) -- 0:00:33
440000 -- (-282.210) (-277.425) [-278.402] (-279.905) * (-276.971) (-278.739) [-278.516] (-284.265) -- 0:00:33
Average standard deviation of split frequencies: 0.012102
440500 -- (-280.105) (-277.614) [-277.770] (-280.755) * (-276.924) [-277.886] (-277.044) (-277.660) -- 0:00:33
441000 -- (-277.322) [-281.603] (-276.796) (-278.923) * (-277.930) (-278.845) [-279.137] (-280.404) -- 0:00:32
441500 -- [-277.696] (-282.231) (-282.021) (-281.449) * (-278.400) (-280.206) [-277.589] (-281.730) -- 0:00:32
442000 -- (-278.440) (-280.204) (-283.976) [-277.044] * (-277.365) [-278.304] (-282.280) (-278.943) -- 0:00:32
442500 -- (-277.049) (-282.172) [-278.114] (-278.500) * (-278.448) (-279.373) (-280.206) [-279.039] -- 0:00:32
443000 -- [-277.170] (-282.072) (-282.577) (-278.225) * (-277.420) (-277.768) [-279.238] (-278.272) -- 0:00:32
443500 -- [-276.986] (-277.692) (-277.832) (-277.770) * [-277.523] (-277.412) (-277.114) (-277.721) -- 0:00:32
444000 -- (-279.103) (-279.312) [-279.457] (-277.291) * (-278.263) [-276.970] (-277.037) (-276.842) -- 0:00:32
444500 -- (-276.386) (-277.274) (-281.938) [-277.778] * (-277.824) (-276.993) [-280.085] (-278.383) -- 0:00:32
445000 -- (-278.865) (-281.225) (-284.135) [-277.908] * [-278.324] (-280.307) (-278.386) (-277.876) -- 0:00:32
Average standard deviation of split frequencies: 0.011378
445500 -- (-277.328) (-277.734) [-278.408] (-278.960) * (-278.684) [-278.528] (-277.358) (-280.003) -- 0:00:32
446000 -- (-279.592) [-276.826] (-278.182) (-277.713) * (-277.612) (-278.162) [-277.637] (-285.541) -- 0:00:32
446500 -- (-279.279) (-278.849) (-279.595) [-276.861] * (-277.737) (-278.037) [-279.333] (-283.707) -- 0:00:32
447000 -- (-279.861) (-285.301) [-277.445] (-277.198) * (-276.705) (-282.885) (-278.820) [-279.345] -- 0:00:32
447500 -- [-279.790] (-280.546) (-279.098) (-278.223) * [-281.211] (-280.627) (-281.612) (-276.954) -- 0:00:32
448000 -- (-278.069) (-279.133) (-277.841) [-276.654] * [-282.674] (-280.627) (-280.990) (-277.547) -- 0:00:32
448500 -- [-279.347] (-278.882) (-281.303) (-280.540) * [-283.723] (-277.065) (-279.268) (-280.106) -- 0:00:31
449000 -- (-279.448) (-277.756) [-278.837] (-281.559) * [-278.860] (-281.621) (-277.550) (-284.044) -- 0:00:31
449500 -- [-277.369] (-283.961) (-280.222) (-278.910) * (-279.440) [-277.466] (-279.389) (-279.011) -- 0:00:31
450000 -- [-278.677] (-279.145) (-278.694) (-279.796) * [-277.619] (-279.213) (-281.163) (-280.529) -- 0:00:31
Average standard deviation of split frequencies: 0.011383
450500 -- (-281.937) (-277.903) (-281.610) [-278.911] * [-280.519] (-280.209) (-279.799) (-281.043) -- 0:00:32
451000 -- (-282.382) [-279.524] (-281.602) (-276.872) * (-281.729) (-279.747) (-284.208) [-276.637] -- 0:00:32
451500 -- (-281.593) (-277.314) [-279.002] (-278.550) * (-279.836) [-278.748] (-279.445) (-277.015) -- 0:00:32
452000 -- (-278.399) (-280.149) (-276.884) [-276.491] * (-277.770) [-277.104] (-278.697) (-277.359) -- 0:00:32
452500 -- (-277.389) (-279.842) [-277.333] (-277.271) * (-278.099) (-277.872) (-280.215) [-276.781] -- 0:00:32
453000 -- [-276.937] (-278.023) (-276.867) (-277.861) * [-276.991] (-279.847) (-278.103) (-278.969) -- 0:00:32
453500 -- (-278.602) [-276.337] (-276.919) (-281.056) * (-281.183) (-276.547) [-278.710] (-283.887) -- 0:00:32
454000 -- [-280.083] (-277.229) (-279.127) (-280.195) * (-277.276) (-280.888) (-279.667) [-282.302] -- 0:00:32
454500 -- (-279.894) [-281.450] (-279.203) (-277.609) * [-278.207] (-279.672) (-282.224) (-279.596) -- 0:00:32
455000 -- [-276.839] (-278.320) (-279.453) (-279.128) * (-277.247) (-278.717) (-278.408) [-278.482] -- 0:00:32
Average standard deviation of split frequencies: 0.011980
455500 -- (-279.128) (-278.086) [-280.270] (-280.742) * (-277.801) [-278.392] (-279.704) (-278.121) -- 0:00:32
456000 -- (-277.383) (-280.586) [-282.418] (-278.515) * (-278.546) [-279.718] (-277.328) (-277.953) -- 0:00:32
456500 -- (-279.534) (-278.560) (-282.648) [-282.699] * (-277.674) (-278.448) [-278.363] (-277.428) -- 0:00:32
457000 -- (-279.597) (-277.124) [-280.312] (-277.051) * (-281.185) [-277.365] (-280.930) (-278.910) -- 0:00:32
457500 -- (-279.858) [-279.308] (-279.702) (-277.568) * (-281.427) [-279.292] (-278.734) (-277.864) -- 0:00:32
458000 -- (-280.156) [-277.831] (-277.711) (-277.670) * (-280.111) (-279.393) [-277.638] (-278.413) -- 0:00:31
458500 -- (-280.268) (-278.692) (-277.064) [-278.616] * (-279.799) (-280.377) (-278.574) [-277.202] -- 0:00:31
459000 -- (-279.360) (-282.325) [-277.137] (-282.733) * (-277.970) (-279.481) [-280.978] (-279.325) -- 0:00:31
459500 -- (-278.871) (-279.494) (-280.958) [-282.883] * [-280.084] (-279.698) (-280.646) (-277.200) -- 0:00:31
460000 -- (-278.794) (-280.355) (-282.889) [-282.815] * (-278.347) (-280.834) [-277.073] (-281.987) -- 0:00:31
Average standard deviation of split frequencies: 0.012340
460500 -- (-277.661) [-280.072] (-278.351) (-277.752) * (-278.655) (-281.352) [-277.260] (-278.010) -- 0:00:31
461000 -- (-279.091) (-278.470) (-278.895) [-281.644] * [-280.237] (-280.548) (-277.488) (-277.932) -- 0:00:31
461500 -- (-277.303) (-279.739) (-277.653) [-279.365] * (-278.214) [-277.594] (-278.898) (-277.645) -- 0:00:31
462000 -- (-278.154) (-278.112) [-279.726] (-276.942) * [-278.871] (-278.145) (-278.330) (-280.418) -- 0:00:31
462500 -- (-280.723) [-276.947] (-280.768) (-277.286) * (-279.391) (-277.130) (-279.191) [-278.227] -- 0:00:31
463000 -- (-280.604) (-278.182) [-276.722] (-278.042) * (-277.314) (-277.977) [-279.723] (-281.568) -- 0:00:31
463500 -- (-279.732) (-282.930) [-278.268] (-279.442) * [-278.398] (-277.431) (-278.730) (-281.191) -- 0:00:31
464000 -- [-278.132] (-277.148) (-279.431) (-278.301) * (-277.675) (-277.119) (-279.852) [-277.111] -- 0:00:31
464500 -- [-276.821] (-279.151) (-276.957) (-280.567) * [-277.768] (-277.093) (-280.524) (-279.357) -- 0:00:31
465000 -- (-276.564) [-277.257] (-277.330) (-285.130) * (-277.881) [-277.867] (-278.302) (-280.080) -- 0:00:31
Average standard deviation of split frequencies: 0.011782
465500 -- (-279.621) (-277.290) (-280.049) [-278.353] * (-278.028) [-280.378] (-280.757) (-277.706) -- 0:00:31
466000 -- [-280.858] (-278.310) (-279.182) (-277.506) * (-277.226) (-278.879) [-277.459] (-279.545) -- 0:00:30
466500 -- (-279.056) [-279.063] (-278.421) (-281.493) * [-277.033] (-279.943) (-277.230) (-276.683) -- 0:00:30
467000 -- (-280.851) [-277.239] (-279.620) (-278.794) * (-276.902) [-277.636] (-278.424) (-277.092) -- 0:00:30
467500 -- (-277.954) (-279.086) (-279.601) [-278.423] * [-280.899] (-282.413) (-283.144) (-276.509) -- 0:00:31
468000 -- (-278.195) [-277.927] (-277.648) (-277.190) * (-284.862) (-277.906) (-278.983) [-278.031] -- 0:00:31
468500 -- [-277.794] (-278.232) (-278.158) (-277.316) * [-281.313] (-278.814) (-278.800) (-276.526) -- 0:00:31
469000 -- (-278.216) (-280.124) [-282.574] (-280.177) * (-278.559) (-278.841) [-279.814] (-278.467) -- 0:00:31
469500 -- [-279.794] (-279.522) (-277.700) (-279.030) * (-282.019) (-276.915) [-278.716] (-278.724) -- 0:00:31
470000 -- (-277.896) (-279.707) (-277.239) [-279.080] * (-281.319) (-276.784) [-276.686] (-279.160) -- 0:00:31
Average standard deviation of split frequencies: 0.011489
470500 -- (-279.068) [-278.529] (-276.599) (-278.593) * (-279.631) (-278.566) [-278.000] (-282.341) -- 0:00:31
471000 -- (-277.261) [-279.077] (-280.187) (-281.542) * (-281.196) (-282.428) [-277.317] (-278.760) -- 0:00:31
471500 -- (-280.277) (-281.276) (-281.041) [-277.516] * (-280.984) (-277.739) [-278.030] (-277.281) -- 0:00:31
472000 -- (-282.869) (-277.561) (-277.373) [-278.024] * [-280.281] (-278.003) (-278.726) (-277.678) -- 0:00:31
472500 -- (-279.343) (-280.497) (-280.924) [-277.825] * (-279.795) [-278.788] (-280.016) (-277.224) -- 0:00:31
473000 -- (-283.327) [-278.421] (-280.592) (-277.959) * (-281.145) [-276.743] (-277.324) (-281.325) -- 0:00:31
473500 -- (-277.247) (-277.973) [-280.094] (-281.225) * (-279.884) [-276.686] (-278.203) (-278.033) -- 0:00:31
474000 -- (-277.136) [-276.656] (-280.437) (-278.613) * (-277.604) [-277.911] (-276.576) (-277.501) -- 0:00:31
474500 -- (-278.457) (-280.623) (-280.018) [-280.830] * (-277.530) (-279.301) [-278.484] (-277.010) -- 0:00:31
475000 -- (-278.680) (-280.277) (-280.815) [-277.370] * [-278.161] (-277.813) (-280.212) (-278.815) -- 0:00:30
Average standard deviation of split frequencies: 0.011127
475500 -- (-277.477) (-279.681) [-278.782] (-278.616) * (-278.970) [-280.872] (-279.074) (-278.947) -- 0:00:30
476000 -- (-284.304) [-277.470] (-277.442) (-281.077) * [-278.613] (-278.485) (-277.647) (-276.706) -- 0:00:30
476500 -- [-281.218] (-278.944) (-277.892) (-282.076) * (-278.305) [-276.658] (-277.676) (-279.453) -- 0:00:30
477000 -- (-281.247) (-280.268) (-279.085) [-278.857] * [-277.542] (-278.606) (-278.279) (-278.594) -- 0:00:30
477500 -- (-278.244) (-279.209) (-280.999) [-278.989] * (-284.875) (-279.829) (-277.749) [-278.140] -- 0:00:30
478000 -- (-277.865) [-277.619] (-277.278) (-278.870) * (-278.590) [-279.677] (-282.759) (-281.217) -- 0:00:30
478500 -- (-280.058) (-278.156) (-279.297) [-277.207] * [-278.997] (-279.752) (-280.586) (-279.479) -- 0:00:30
479000 -- [-278.727] (-278.269) (-279.251) (-277.715) * (-284.253) (-277.478) [-277.886] (-279.503) -- 0:00:30
479500 -- (-280.197) (-277.416) [-280.077] (-277.496) * (-281.340) [-277.237] (-281.633) (-279.827) -- 0:00:30
480000 -- (-280.170) (-282.340) (-283.582) [-276.965] * [-278.252] (-279.438) (-280.020) (-278.713) -- 0:00:30
Average standard deviation of split frequencies: 0.011340
480500 -- (-282.094) [-281.097] (-279.623) (-278.991) * (-279.565) (-278.345) [-277.915] (-279.739) -- 0:00:30
481000 -- (-279.818) (-276.475) (-278.094) [-277.353] * (-280.712) (-277.395) (-278.383) [-279.097] -- 0:00:30
481500 -- (-277.419) [-277.155] (-277.355) (-277.530) * [-279.725] (-277.868) (-279.926) (-279.651) -- 0:00:30
482000 -- [-277.835] (-277.834) (-278.291) (-278.862) * (-282.357) (-277.539) (-278.969) [-279.496] -- 0:00:30
482500 -- (-276.633) [-278.236] (-282.108) (-278.417) * [-279.184] (-278.804) (-276.772) (-279.796) -- 0:00:30
483000 -- [-276.524] (-276.612) (-278.454) (-277.628) * (-278.866) (-276.970) (-277.394) [-283.323] -- 0:00:29
483500 -- (-280.860) [-276.585] (-280.045) (-277.125) * (-279.906) (-280.020) [-279.821] (-281.469) -- 0:00:29
484000 -- (-278.870) [-277.029] (-278.174) (-277.381) * (-282.112) (-278.648) [-280.516] (-277.577) -- 0:00:29
484500 -- [-278.499] (-281.201) (-278.078) (-278.774) * [-276.748] (-277.864) (-278.977) (-281.435) -- 0:00:30
485000 -- (-278.839) [-279.084] (-279.979) (-277.135) * (-278.581) [-278.215] (-277.070) (-282.277) -- 0:00:30
Average standard deviation of split frequencies: 0.010185
485500 -- (-277.529) [-276.841] (-277.514) (-277.634) * (-277.701) [-277.754] (-278.783) (-280.953) -- 0:00:30
486000 -- [-276.674] (-277.590) (-281.659) (-278.506) * (-279.348) (-277.810) [-278.366] (-278.700) -- 0:00:30
486500 -- [-278.796] (-281.016) (-278.633) (-277.561) * [-277.366] (-282.814) (-282.174) (-277.957) -- 0:00:30
487000 -- (-278.111) [-278.951] (-279.288) (-279.951) * (-281.843) (-277.692) [-278.459] (-281.862) -- 0:00:30
487500 -- [-276.851] (-276.626) (-278.706) (-280.872) * (-277.035) [-277.348] (-276.598) (-278.210) -- 0:00:30
488000 -- [-277.244] (-277.760) (-277.499) (-277.614) * [-276.718] (-277.506) (-277.634) (-276.656) -- 0:00:30
488500 -- (-278.838) (-278.206) [-277.741] (-277.651) * (-278.215) (-278.381) (-279.583) [-278.912] -- 0:00:30
489000 -- [-277.975] (-278.981) (-280.945) (-279.346) * (-278.405) [-278.837] (-277.084) (-279.292) -- 0:00:30
489500 -- (-277.565) (-279.500) [-280.932] (-278.298) * (-278.173) (-278.232) [-278.813] (-279.858) -- 0:00:30
490000 -- (-277.889) (-277.036) [-278.264] (-281.741) * (-278.923) [-277.920] (-278.357) (-279.455) -- 0:00:30
Average standard deviation of split frequencies: 0.009367
490500 -- (-279.244) [-278.687] (-278.602) (-280.032) * [-277.677] (-284.539) (-279.418) (-279.868) -- 0:00:30
491000 -- (-279.138) (-278.526) (-277.030) [-278.480] * (-277.013) (-281.128) (-278.532) [-279.052] -- 0:00:30
491500 -- (-278.781) (-281.041) [-278.770] (-279.479) * (-277.386) [-277.546] (-278.111) (-276.878) -- 0:00:30
492000 -- [-278.591] (-277.555) (-281.540) (-277.353) * (-277.383) [-279.419] (-279.171) (-276.977) -- 0:00:29
492500 -- (-277.548) (-280.108) [-277.733] (-278.333) * (-282.816) (-276.651) (-280.115) [-279.760] -- 0:00:29
493000 -- (-278.413) (-276.408) (-279.701) [-278.488] * (-277.528) (-277.925) [-277.876] (-277.172) -- 0:00:29
493500 -- (-284.278) (-287.999) [-277.506] (-276.993) * (-276.883) (-277.253) (-280.798) [-277.139] -- 0:00:29
494000 -- (-280.549) (-280.330) (-277.967) [-279.143] * (-277.840) [-278.914] (-277.515) (-278.523) -- 0:00:29
494500 -- (-278.068) (-278.038) (-281.845) [-277.371] * (-279.898) (-278.313) [-276.781] (-279.817) -- 0:00:29
495000 -- [-278.415] (-279.268) (-284.036) (-278.383) * (-280.705) [-280.351] (-278.134) (-279.184) -- 0:00:29
Average standard deviation of split frequencies: 0.010573
495500 -- (-278.263) (-278.810) [-278.588] (-283.178) * (-278.754) (-282.345) (-282.574) [-277.101] -- 0:00:29
496000 -- [-280.280] (-279.312) (-276.992) (-278.193) * (-279.404) (-279.122) [-279.180] (-280.015) -- 0:00:29
496500 -- (-276.677) (-280.853) (-280.467) [-278.314] * (-278.523) (-280.867) (-277.649) [-281.013] -- 0:00:29
497000 -- (-279.156) (-280.431) (-278.659) [-278.394] * (-278.266) [-280.092] (-277.912) (-276.660) -- 0:00:29
497500 -- [-278.577] (-277.784) (-277.283) (-277.807) * (-278.261) [-276.979] (-278.335) (-277.185) -- 0:00:29
498000 -- [-279.298] (-280.044) (-278.276) (-279.427) * (-279.498) (-278.521) (-278.754) [-278.415] -- 0:00:29
498500 -- (-279.789) [-279.158] (-278.017) (-277.231) * (-280.581) (-279.493) (-279.149) [-276.846] -- 0:00:29
499000 -- [-278.788] (-279.542) (-277.765) (-280.558) * (-278.693) (-279.136) [-279.292] (-277.689) -- 0:00:29
499500 -- (-276.381) [-283.944] (-280.932) (-276.925) * (-285.051) (-277.037) [-282.406] (-277.642) -- 0:00:29
500000 -- (-277.990) (-285.609) [-279.997] (-279.692) * [-279.098] (-278.250) (-286.049) (-277.444) -- 0:00:29
Average standard deviation of split frequencies: 0.010745
500500 -- (-277.197) (-281.508) (-279.536) [-278.279] * [-277.220] (-276.588) (-278.110) (-281.794) -- 0:00:28
501000 -- (-278.092) [-279.391] (-277.052) (-282.600) * (-276.672) (-277.947) [-280.360] (-280.155) -- 0:00:28
501500 -- (-278.101) (-277.557) (-279.177) [-279.170] * [-280.302] (-278.644) (-278.213) (-279.572) -- 0:00:29
502000 -- (-284.618) (-278.284) (-279.446) [-277.546] * (-279.959) [-279.003] (-277.261) (-278.590) -- 0:00:29
502500 -- [-280.331] (-280.607) (-280.431) (-280.734) * (-278.360) [-278.654] (-278.233) (-278.193) -- 0:00:29
503000 -- [-278.865] (-278.099) (-280.240) (-277.363) * (-278.309) (-278.150) (-279.867) [-278.494] -- 0:00:29
503500 -- (-278.255) (-278.667) [-280.982] (-280.094) * (-277.696) (-288.063) (-278.996) [-278.592] -- 0:00:29
504000 -- [-279.661] (-276.429) (-279.350) (-277.085) * (-278.312) (-281.472) (-279.217) [-276.925] -- 0:00:29
504500 -- [-279.470] (-279.667) (-277.188) (-277.542) * (-276.644) (-282.276) (-280.157) [-277.548] -- 0:00:29
505000 -- (-278.063) (-277.742) [-276.632] (-276.862) * [-280.165] (-278.797) (-280.329) (-279.712) -- 0:00:29
Average standard deviation of split frequencies: 0.010662
505500 -- (-281.049) (-278.469) [-279.060] (-278.168) * (-279.593) [-276.920] (-279.862) (-281.979) -- 0:00:29
506000 -- (-279.951) [-280.695] (-278.574) (-277.343) * (-278.192) [-279.227] (-280.111) (-279.556) -- 0:00:29
506500 -- (-280.565) (-278.528) (-279.476) [-277.112] * (-278.307) (-278.241) (-280.407) [-279.810] -- 0:00:29
507000 -- (-279.628) (-276.812) [-279.447] (-279.786) * (-279.249) (-281.502) [-280.657] (-281.124) -- 0:00:29
507500 -- (-278.736) [-277.782] (-277.899) (-281.815) * [-278.834] (-278.928) (-277.414) (-279.508) -- 0:00:29
508000 -- (-280.676) [-278.509] (-283.130) (-277.649) * (-278.982) (-284.879) (-279.414) [-276.722] -- 0:00:29
508500 -- [-282.479] (-277.287) (-290.784) (-279.806) * [-279.362] (-277.682) (-279.731) (-278.921) -- 0:00:28
509000 -- (-281.714) (-277.339) [-276.439] (-279.144) * (-277.512) (-278.937) [-276.782] (-277.234) -- 0:00:28
509500 -- [-282.697] (-279.989) (-280.058) (-277.790) * (-277.953) (-276.789) [-277.590] (-278.099) -- 0:00:28
510000 -- [-277.078] (-277.658) (-284.810) (-277.425) * (-277.984) (-280.679) [-276.827] (-277.211) -- 0:00:28
Average standard deviation of split frequencies: 0.010962
510500 -- (-280.017) (-281.133) [-278.942] (-278.094) * [-278.255] (-277.347) (-276.421) (-276.713) -- 0:00:28
511000 -- (-279.126) (-280.100) (-277.254) [-278.296] * (-277.402) [-278.406] (-279.809) (-278.813) -- 0:00:28
511500 -- (-278.352) [-277.794] (-277.971) (-283.196) * (-279.724) (-279.827) [-280.409] (-278.787) -- 0:00:28
512000 -- (-278.186) (-278.289) [-280.225] (-278.652) * (-278.762) [-276.846] (-278.300) (-278.733) -- 0:00:28
512500 -- (-280.097) (-278.199) (-281.009) [-278.829] * [-278.718] (-277.790) (-277.144) (-281.015) -- 0:00:28
513000 -- [-281.225] (-277.567) (-281.739) (-280.678) * (-277.576) (-276.727) [-283.052] (-279.527) -- 0:00:28
513500 -- (-279.850) (-276.699) (-278.873) [-281.229] * (-277.638) (-276.837) [-280.806] (-279.532) -- 0:00:28
514000 -- (-277.274) [-277.562] (-278.647) (-279.937) * (-277.153) (-281.195) [-280.927] (-276.987) -- 0:00:28
514500 -- [-277.006] (-280.128) (-277.113) (-278.701) * (-278.878) (-277.891) [-278.087] (-281.855) -- 0:00:28
515000 -- (-278.049) (-279.891) (-277.763) [-280.343] * (-280.618) (-281.203) [-277.234] (-278.526) -- 0:00:28
Average standard deviation of split frequencies: 0.010811
515500 -- (-278.626) (-277.037) [-277.180] (-278.691) * (-280.123) (-277.339) (-277.500) [-278.705] -- 0:00:28
516000 -- (-277.300) (-282.110) (-277.489) [-278.057] * [-279.327] (-278.272) (-277.324) (-278.335) -- 0:00:28
516500 -- (-277.817) [-278.634] (-277.461) (-278.545) * [-279.421] (-278.944) (-279.057) (-281.525) -- 0:00:28
517000 -- (-278.262) [-278.064] (-277.361) (-279.714) * [-281.580] (-280.474) (-277.399) (-277.078) -- 0:00:28
517500 -- (-278.912) (-281.334) [-281.385] (-280.254) * (-280.091) [-277.977] (-277.595) (-280.832) -- 0:00:27
518000 -- (-279.769) (-282.410) [-280.443] (-278.690) * (-280.237) (-277.882) [-279.909] (-277.040) -- 0:00:27
518500 -- (-279.492) (-280.556) (-278.705) [-278.892] * [-278.580] (-277.680) (-280.567) (-278.034) -- 0:00:27
519000 -- [-278.016] (-279.120) (-278.674) (-281.840) * (-278.405) (-279.682) [-282.482] (-280.506) -- 0:00:28
519500 -- (-284.402) (-278.773) (-279.377) [-278.632] * [-277.696] (-281.397) (-279.193) (-277.443) -- 0:00:28
520000 -- (-281.400) (-282.680) [-283.809] (-278.708) * (-276.831) (-282.057) [-277.035] (-278.570) -- 0:00:28
Average standard deviation of split frequencies: 0.011066
520500 -- [-276.873] (-278.904) (-280.741) (-278.491) * (-280.860) (-281.001) (-278.472) [-277.354] -- 0:00:28
521000 -- (-279.625) (-283.316) (-277.981) [-276.340] * (-279.677) (-277.126) (-286.111) [-278.463] -- 0:00:28
521500 -- [-278.797] (-278.405) (-280.438) (-278.105) * (-279.331) [-282.817] (-278.292) (-277.323) -- 0:00:28
522000 -- (-279.382) (-277.248) (-277.536) [-277.039] * (-281.816) (-278.617) (-280.424) [-279.012] -- 0:00:28
522500 -- (-279.860) (-277.730) (-277.797) [-277.978] * (-282.965) (-276.896) (-276.896) [-279.099] -- 0:00:28
523000 -- (-280.318) [-276.927] (-276.901) (-278.370) * (-278.287) [-277.339] (-277.217) (-278.673) -- 0:00:28
523500 -- (-278.266) [-276.304] (-276.911) (-278.972) * [-279.092] (-276.835) (-277.176) (-282.653) -- 0:00:28
524000 -- (-277.657) (-279.593) [-278.418] (-284.776) * (-276.782) (-277.600) [-279.769] (-280.088) -- 0:00:28
524500 -- (-277.271) (-278.918) (-277.625) [-276.887] * [-277.574] (-282.924) (-279.142) (-278.154) -- 0:00:28
525000 -- (-277.381) (-280.108) (-277.938) [-277.209] * [-277.056] (-278.840) (-279.527) (-277.968) -- 0:00:28
Average standard deviation of split frequencies: 0.011252
525500 -- (-276.705) (-278.159) [-277.904] (-277.785) * (-276.878) (-279.521) [-278.091] (-277.959) -- 0:00:27
526000 -- [-277.415] (-277.289) (-278.465) (-279.505) * (-277.596) [-278.295] (-277.265) (-279.375) -- 0:00:27
526500 -- (-277.678) (-283.045) [-277.739] (-277.562) * (-278.250) (-278.641) (-277.529) [-277.310] -- 0:00:27
527000 -- (-278.489) (-281.357) (-280.916) [-277.460] * (-277.114) [-279.359] (-278.739) (-278.858) -- 0:00:27
527500 -- [-277.163] (-278.844) (-278.172) (-276.517) * [-282.179] (-277.067) (-277.695) (-278.259) -- 0:00:27
528000 -- (-280.426) (-281.885) [-277.363] (-280.618) * (-278.478) (-277.560) (-279.389) [-277.508] -- 0:00:27
528500 -- (-280.842) (-278.961) [-277.938] (-281.344) * [-277.271] (-277.746) (-277.901) (-278.131) -- 0:00:27
529000 -- (-279.249) (-278.046) [-278.933] (-278.183) * (-278.516) [-276.528] (-279.054) (-278.126) -- 0:00:27
529500 -- (-278.772) (-278.968) (-278.686) [-277.966] * (-277.256) (-277.053) [-277.708] (-282.536) -- 0:00:27
530000 -- [-279.196] (-280.721) (-276.787) (-277.934) * (-279.550) (-277.636) [-280.210] (-279.365) -- 0:00:27
Average standard deviation of split frequencies: 0.011339
530500 -- [-277.950] (-280.257) (-279.703) (-277.712) * [-278.613] (-278.056) (-282.520) (-282.203) -- 0:00:27
531000 -- (-279.672) [-276.865] (-279.502) (-279.345) * (-279.893) (-277.962) (-280.987) [-280.529] -- 0:00:27
531500 -- [-280.803] (-276.637) (-276.529) (-283.914) * [-279.207] (-278.383) (-278.147) (-281.474) -- 0:00:27
532000 -- (-277.714) (-279.163) (-279.689) [-278.134] * (-279.898) [-277.442] (-279.189) (-278.636) -- 0:00:27
532500 -- (-280.366) [-276.924] (-278.942) (-277.180) * (-280.202) [-277.450] (-278.464) (-279.229) -- 0:00:27
533000 -- (-282.501) (-280.210) [-278.070] (-278.151) * (-277.299) (-279.227) [-278.133] (-277.926) -- 0:00:27
533500 -- (-278.242) (-278.770) [-277.485] (-277.496) * (-277.339) [-281.259] (-279.025) (-277.049) -- 0:00:27
534000 -- (-280.330) (-279.522) (-279.155) [-279.207] * (-277.423) (-278.690) (-278.250) [-278.063] -- 0:00:27
534500 -- (-278.653) (-287.229) [-277.215] (-284.263) * (-276.894) (-281.463) [-278.760] (-282.537) -- 0:00:26
535000 -- (-276.890) (-279.422) [-280.121] (-278.221) * (-277.532) (-278.134) [-281.436] (-278.785) -- 0:00:26
Average standard deviation of split frequencies: 0.010612
535500 -- (-277.935) [-276.847] (-277.811) (-281.338) * (-276.383) [-276.690] (-280.892) (-281.522) -- 0:00:26
536000 -- [-278.647] (-280.987) (-278.647) (-282.940) * (-277.563) [-278.029] (-276.545) (-279.697) -- 0:00:27
536500 -- (-281.890) [-277.277] (-280.552) (-282.647) * (-279.818) (-276.831) [-277.193] (-280.911) -- 0:00:27
537000 -- (-278.425) (-277.080) (-278.241) [-278.298] * [-278.842] (-280.143) (-279.244) (-278.475) -- 0:00:27
537500 -- (-277.588) [-281.147] (-276.385) (-276.641) * (-278.040) (-278.170) [-280.840] (-279.626) -- 0:00:27
538000 -- (-279.330) [-277.594] (-278.012) (-278.513) * (-276.977) (-277.107) [-281.681] (-278.324) -- 0:00:27
538500 -- (-279.208) [-277.911] (-278.874) (-282.892) * (-276.899) [-278.901] (-282.879) (-279.853) -- 0:00:27
539000 -- [-276.798] (-281.524) (-281.084) (-280.349) * (-276.960) (-277.157) [-281.023] (-277.852) -- 0:00:27
539500 -- (-277.783) (-278.195) [-277.936] (-280.509) * [-278.173] (-280.670) (-278.738) (-279.026) -- 0:00:27
540000 -- [-277.092] (-276.419) (-276.942) (-280.163) * [-277.722] (-278.601) (-281.640) (-277.923) -- 0:00:27
Average standard deviation of split frequencies: 0.011008
540500 -- [-276.929] (-277.296) (-279.126) (-279.807) * [-277.580] (-280.767) (-277.978) (-279.259) -- 0:00:27
541000 -- (-279.840) [-277.459] (-276.987) (-277.817) * (-278.169) [-279.850] (-279.701) (-279.935) -- 0:00:27
541500 -- (-281.844) (-280.631) (-279.482) [-278.694] * (-277.678) (-279.968) (-278.702) [-277.718] -- 0:00:27
542000 -- (-278.337) [-277.641] (-278.591) (-277.918) * (-278.157) (-277.016) [-277.690] (-281.078) -- 0:00:27
542500 -- (-285.086) (-278.291) [-280.208] (-278.496) * (-277.366) (-279.578) (-276.696) [-282.065] -- 0:00:26
543000 -- (-279.978) (-277.840) [-278.179] (-279.279) * (-279.401) (-277.028) [-280.118] (-280.446) -- 0:00:26
543500 -- (-277.715) (-279.621) [-277.959] (-278.834) * (-278.235) (-276.886) [-278.632] (-277.314) -- 0:00:26
544000 -- (-284.765) (-278.282) [-279.972] (-277.063) * (-280.096) (-278.575) [-277.169] (-282.570) -- 0:00:26
544500 -- (-279.401) [-279.907] (-280.568) (-277.969) * (-279.935) [-276.704] (-282.814) (-278.321) -- 0:00:26
545000 -- (-277.264) (-280.112) (-279.483) [-278.424] * (-278.222) (-277.608) (-277.257) [-278.578] -- 0:00:26
Average standard deviation of split frequencies: 0.010840
545500 -- (-277.940) (-279.633) [-278.340] (-279.402) * [-280.227] (-278.805) (-283.457) (-277.112) -- 0:00:26
546000 -- [-281.389] (-277.707) (-276.636) (-276.443) * (-280.354) (-278.566) (-282.350) [-277.526] -- 0:00:26
546500 -- (-284.994) (-285.536) [-279.625] (-281.109) * (-279.355) (-277.043) [-278.966] (-281.091) -- 0:00:26
547000 -- (-279.283) (-277.546) [-278.140] (-286.496) * (-279.246) (-277.665) [-279.268] (-283.185) -- 0:00:26
547500 -- (-276.636) (-280.660) (-278.939) [-280.645] * [-277.943] (-278.541) (-277.107) (-281.975) -- 0:00:26
548000 -- [-279.238] (-278.738) (-277.846) (-280.667) * (-277.797) (-276.706) [-278.104] (-277.002) -- 0:00:26
548500 -- [-277.605] (-280.663) (-279.835) (-276.752) * (-278.074) (-277.819) (-277.547) [-279.199] -- 0:00:26
549000 -- (-278.351) (-278.150) (-278.508) [-279.570] * (-279.868) (-278.061) (-277.694) [-277.693] -- 0:00:26
549500 -- (-278.068) (-278.091) (-278.342) [-279.085] * (-280.398) [-279.322] (-285.001) (-279.542) -- 0:00:26
550000 -- (-281.745) (-276.808) [-280.031] (-277.660) * (-279.472) (-280.728) [-276.493] (-277.702) -- 0:00:26
Average standard deviation of split frequencies: 0.010726
550500 -- (-277.421) (-277.149) [-277.046] (-278.008) * (-278.912) (-277.744) (-277.083) [-278.092] -- 0:00:26
551000 -- (-279.481) (-281.608) [-279.502] (-284.390) * (-284.082) (-277.052) (-278.349) [-277.813] -- 0:00:26
551500 -- (-282.241) (-277.494) (-277.023) [-282.891] * (-278.568) (-277.571) (-279.813) [-277.034] -- 0:00:26
552000 -- (-278.567) (-281.108) (-277.425) [-280.840] * (-279.064) (-277.338) [-278.757] (-276.779) -- 0:00:25
552500 -- [-276.869] (-279.573) (-278.348) (-282.979) * (-281.891) (-277.476) [-277.895] (-278.995) -- 0:00:25
553000 -- (-280.267) (-277.727) (-282.744) [-277.181] * (-278.674) [-276.860] (-277.134) (-277.546) -- 0:00:26
553500 -- (-278.007) [-279.099] (-281.845) (-279.799) * (-278.583) (-280.393) (-287.424) [-276.981] -- 0:00:26
554000 -- (-281.483) (-279.485) [-278.394] (-281.013) * (-278.120) [-276.656] (-278.825) (-286.336) -- 0:00:26
554500 -- (-281.987) [-279.932] (-277.763) (-279.177) * (-277.725) (-279.840) [-278.600] (-279.120) -- 0:00:26
555000 -- (-276.800) (-279.089) [-278.147] (-277.527) * (-280.303) (-278.307) (-278.638) [-280.285] -- 0:00:26
Average standard deviation of split frequencies: 0.011172
555500 -- (-278.599) (-277.691) (-279.689) [-279.761] * [-278.629] (-281.143) (-280.330) (-277.218) -- 0:00:26
556000 -- (-279.312) (-283.051) [-279.942] (-279.204) * (-280.849) [-278.532] (-278.772) (-278.164) -- 0:00:26
556500 -- (-278.807) [-278.528] (-282.925) (-278.411) * [-277.550] (-282.670) (-277.222) (-286.847) -- 0:00:26
557000 -- (-278.036) (-276.646) [-278.925] (-279.771) * (-277.835) (-278.615) (-282.716) [-278.655] -- 0:00:26
557500 -- (-278.213) [-278.845] (-279.969) (-278.820) * [-279.414] (-278.928) (-278.580) (-276.927) -- 0:00:26
558000 -- (-276.715) [-279.508] (-277.659) (-279.026) * (-279.711) (-280.305) (-279.316) [-277.656] -- 0:00:26
558500 -- [-278.684] (-279.047) (-278.373) (-281.895) * (-278.777) [-278.955] (-278.494) (-277.216) -- 0:00:26
559000 -- (-276.944) [-277.834] (-279.669) (-286.222) * (-278.031) (-278.955) [-278.250] (-278.718) -- 0:00:26
559500 -- (-280.453) (-282.898) (-280.378) [-279.623] * (-286.235) (-277.632) (-277.050) [-282.926] -- 0:00:25
560000 -- (-276.702) (-279.684) (-280.448) [-276.363] * (-280.399) (-277.329) [-282.743] (-280.608) -- 0:00:25
Average standard deviation of split frequencies: 0.011079
560500 -- (-277.266) [-277.876] (-279.024) (-278.163) * (-279.193) [-281.787] (-277.791) (-278.938) -- 0:00:25
561000 -- [-279.549] (-277.909) (-279.624) (-284.510) * [-278.848] (-277.962) (-280.430) (-278.152) -- 0:00:25
561500 -- (-280.708) (-281.953) (-276.593) [-279.159] * (-279.110) (-280.779) (-278.527) [-277.962] -- 0:00:25
562000 -- [-277.424] (-281.839) (-279.342) (-279.454) * (-277.276) [-277.914] (-283.068) (-278.425) -- 0:00:25
562500 -- (-279.373) (-280.226) (-279.486) [-280.431] * (-280.234) (-279.398) [-277.336] (-277.756) -- 0:00:25
563000 -- [-281.577] (-279.421) (-277.946) (-280.672) * (-281.228) (-283.505) (-280.622) [-280.390] -- 0:00:25
563500 -- (-280.858) [-278.425] (-279.006) (-278.225) * (-277.941) (-279.506) (-282.234) [-277.910] -- 0:00:25
564000 -- [-277.305] (-279.652) (-278.733) (-278.413) * (-279.556) [-278.284] (-281.226) (-278.092) -- 0:00:25
564500 -- (-277.786) [-277.101] (-276.939) (-279.367) * (-278.010) (-281.718) (-278.387) [-277.765] -- 0:00:25
565000 -- (-281.932) (-280.785) [-277.127] (-279.822) * (-276.446) (-278.352) (-278.474) [-277.762] -- 0:00:25
Average standard deviation of split frequencies: 0.010876
565500 -- [-277.732] (-277.954) (-277.991) (-288.852) * (-278.769) (-281.064) (-280.203) [-279.216] -- 0:00:25
566000 -- (-277.479) (-277.129) [-278.756] (-278.985) * [-279.243] (-280.194) (-279.306) (-278.837) -- 0:00:25
566500 -- (-278.789) [-276.776] (-278.771) (-278.972) * [-280.166] (-281.546) (-278.627) (-277.337) -- 0:00:25
567000 -- [-276.900] (-277.057) (-277.334) (-276.797) * (-279.580) (-278.553) [-276.740] (-279.872) -- 0:00:25
567500 -- [-278.374] (-282.859) (-278.532) (-280.174) * (-280.711) [-281.189] (-277.504) (-281.298) -- 0:00:25
568000 -- (-277.687) [-284.101] (-276.948) (-276.779) * (-277.969) (-277.131) (-277.839) [-278.613] -- 0:00:25
568500 -- (-280.002) (-287.085) [-278.901] (-279.656) * (-277.622) [-279.386] (-278.471) (-278.559) -- 0:00:25
569000 -- [-279.521] (-283.128) (-278.929) (-276.855) * [-278.035] (-278.846) (-279.665) (-278.256) -- 0:00:24
569500 -- [-277.516] (-284.879) (-279.721) (-277.547) * (-278.991) [-277.645] (-278.357) (-276.590) -- 0:00:24
570000 -- (-277.664) (-278.535) [-278.937] (-285.113) * (-277.335) [-281.762] (-280.932) (-277.029) -- 0:00:25
Average standard deviation of split frequencies: 0.010555
570500 -- (-280.361) (-277.995) (-280.642) [-278.774] * (-277.691) (-287.877) (-276.933) [-276.755] -- 0:00:25
571000 -- [-276.961] (-277.583) (-278.507) (-277.159) * (-278.521) (-282.142) [-278.591] (-278.672) -- 0:00:25
571500 -- (-277.946) (-277.626) (-283.291) [-278.246] * (-277.894) (-280.207) (-277.043) [-277.883] -- 0:00:25
572000 -- (-278.305) (-279.987) (-284.341) [-277.162] * (-276.727) (-280.183) (-280.021) [-282.659] -- 0:00:25
572500 -- [-279.423] (-277.609) (-288.559) (-280.250) * (-277.787) [-277.322] (-283.051) (-276.968) -- 0:00:25
573000 -- (-277.074) [-280.214] (-285.569) (-277.411) * (-278.482) (-278.017) [-279.229] (-277.188) -- 0:00:25
573500 -- [-277.458] (-282.455) (-283.902) (-277.508) * (-281.149) [-278.956] (-280.348) (-277.272) -- 0:00:25
574000 -- (-278.666) [-279.615] (-281.229) (-277.051) * (-282.275) (-277.704) [-278.241] (-278.137) -- 0:00:25
574500 -- (-282.992) (-283.134) (-279.543) [-278.478] * (-278.836) (-281.279) (-279.232) [-276.998] -- 0:00:25
575000 -- [-280.073] (-281.319) (-277.818) (-279.148) * (-280.154) (-278.440) [-282.760] (-277.111) -- 0:00:25
Average standard deviation of split frequencies: 0.010503
575500 -- (-281.578) (-280.841) [-276.654] (-277.620) * (-278.214) (-280.217) [-278.234] (-278.701) -- 0:00:25
576000 -- (-280.635) (-279.288) (-279.286) [-278.629] * (-280.455) (-278.597) (-277.605) [-280.505] -- 0:00:25
576500 -- (-277.599) (-278.704) (-279.232) [-277.543] * (-278.174) (-280.717) [-277.717] (-279.609) -- 0:00:24
577000 -- (-280.076) (-279.471) [-277.549] (-281.556) * (-278.084) (-278.346) (-279.832) [-277.831] -- 0:00:24
577500 -- [-278.466] (-279.893) (-280.352) (-278.725) * [-278.084] (-279.080) (-279.017) (-279.879) -- 0:00:24
578000 -- [-281.709] (-278.482) (-281.312) (-277.773) * (-277.891) (-277.909) (-278.099) [-279.460] -- 0:00:24
578500 -- (-279.896) (-284.671) (-281.262) [-279.426] * (-278.531) [-277.113] (-280.366) (-281.850) -- 0:00:24
579000 -- (-279.833) (-279.258) [-278.380] (-280.063) * [-287.245] (-276.691) (-282.047) (-282.088) -- 0:00:24
579500 -- [-278.714] (-282.113) (-281.991) (-279.184) * (-282.601) [-276.853] (-280.326) (-278.090) -- 0:00:24
580000 -- (-277.312) (-280.813) [-281.614] (-280.061) * [-280.331] (-277.211) (-278.418) (-278.992) -- 0:00:24
Average standard deviation of split frequencies: 0.010644
580500 -- [-280.230] (-278.047) (-278.835) (-281.308) * (-284.501) (-277.353) [-281.597] (-278.779) -- 0:00:24
581000 -- [-278.443] (-278.003) (-280.002) (-278.510) * (-276.941) [-280.595] (-277.958) (-277.953) -- 0:00:24
581500 -- (-278.684) [-281.140] (-279.505) (-276.428) * (-280.813) (-277.254) [-278.174] (-278.539) -- 0:00:24
582000 -- [-278.281] (-278.060) (-277.437) (-281.129) * [-279.591] (-278.222) (-283.599) (-276.862) -- 0:00:24
582500 -- (-278.071) (-283.126) [-277.628] (-278.060) * (-279.264) (-279.001) (-281.542) [-276.597] -- 0:00:24
583000 -- (-276.973) [-278.752] (-278.610) (-279.519) * (-278.348) (-277.065) [-279.501] (-281.175) -- 0:00:24
583500 -- [-277.691] (-278.940) (-279.406) (-279.004) * (-278.978) [-278.062] (-280.879) (-281.281) -- 0:00:24
584000 -- [-278.576] (-281.219) (-279.608) (-276.636) * [-278.280] (-277.685) (-277.643) (-282.040) -- 0:00:24
584500 -- (-280.592) (-279.542) (-277.859) [-278.181] * (-278.680) (-276.389) [-278.669] (-277.875) -- 0:00:24
585000 -- [-280.449] (-279.605) (-278.508) (-277.346) * (-278.246) (-278.191) [-278.841] (-277.963) -- 0:00:24
Average standard deviation of split frequencies: 0.010637
585500 -- (-279.415) [-277.655] (-279.983) (-277.088) * (-279.367) (-279.243) [-279.253] (-282.317) -- 0:00:24
586000 -- [-277.048] (-280.695) (-277.726) (-276.935) * (-278.544) (-276.905) [-284.039] (-280.190) -- 0:00:24
586500 -- (-276.398) [-280.953] (-276.937) (-280.718) * [-282.338] (-277.501) (-277.724) (-280.033) -- 0:00:23
587000 -- [-281.805] (-278.477) (-281.251) (-283.731) * (-277.364) (-279.084) (-278.506) [-277.986] -- 0:00:24
587500 -- (-280.784) (-277.686) (-278.426) [-278.832] * (-276.739) (-279.825) (-278.066) [-281.499] -- 0:00:24
588000 -- (-279.015) (-279.019) (-278.179) [-278.918] * (-277.110) (-283.584) (-280.088) [-279.056] -- 0:00:24
588500 -- (-277.405) (-278.532) [-276.949] (-283.193) * [-280.214] (-281.114) (-282.517) (-279.755) -- 0:00:24
589000 -- [-277.547] (-278.416) (-279.415) (-281.770) * (-277.282) [-280.564] (-277.024) (-282.475) -- 0:00:24
589500 -- (-280.058) [-277.403] (-278.247) (-279.874) * [-278.595] (-278.695) (-277.777) (-277.786) -- 0:00:24
590000 -- (-278.982) [-280.249] (-277.721) (-276.854) * (-279.062) [-278.014] (-280.517) (-279.062) -- 0:00:24
Average standard deviation of split frequencies: 0.010375
590500 -- (-279.972) (-282.766) [-278.337] (-277.492) * (-278.810) [-277.613] (-281.003) (-277.090) -- 0:00:24
591000 -- (-277.247) [-278.114] (-279.259) (-280.767) * (-279.951) [-278.559] (-279.154) (-277.829) -- 0:00:24
591500 -- (-278.686) (-280.658) [-287.004] (-276.940) * (-276.849) (-277.248) [-280.330] (-278.585) -- 0:00:24
592000 -- (-278.008) (-279.319) [-276.683] (-278.850) * (-283.800) (-278.996) (-277.327) [-279.113] -- 0:00:24
592500 -- (-278.363) [-277.567] (-277.259) (-281.253) * (-278.204) [-277.983] (-278.175) (-278.436) -- 0:00:24
593000 -- (-279.005) [-277.008] (-277.854) (-279.685) * (-278.454) [-278.739] (-280.899) (-278.295) -- 0:00:24
593500 -- (-286.077) (-278.860) [-276.371] (-282.024) * [-279.688] (-278.711) (-280.036) (-277.279) -- 0:00:23
594000 -- (-279.252) (-277.710) [-278.645] (-279.604) * (-277.414) (-278.755) (-280.490) [-278.200] -- 0:00:23
594500 -- (-279.221) [-279.966] (-277.005) (-277.778) * (-282.113) (-279.795) [-279.515] (-278.162) -- 0:00:23
595000 -- (-280.842) (-277.400) [-276.978] (-278.485) * (-278.177) (-281.240) [-278.817] (-278.115) -- 0:00:23
Average standard deviation of split frequencies: 0.010326
595500 -- (-277.918) [-280.076] (-278.292) (-277.230) * (-280.557) (-277.974) [-280.367] (-281.174) -- 0:00:23
596000 -- (-276.538) [-276.870] (-278.661) (-281.455) * (-277.844) (-283.084) [-278.706] (-277.129) -- 0:00:23
596500 -- (-277.824) [-278.444] (-280.332) (-277.036) * (-277.746) (-277.769) [-279.239] (-279.354) -- 0:00:23
597000 -- (-277.700) (-281.312) [-281.246] (-277.577) * (-278.808) (-285.495) [-277.749] (-281.026) -- 0:00:23
597500 -- [-276.671] (-277.381) (-278.449) (-276.912) * [-278.227] (-279.003) (-276.612) (-281.668) -- 0:00:23
598000 -- (-277.844) (-277.450) [-279.212] (-281.528) * (-278.095) (-277.790) [-279.779] (-279.699) -- 0:00:23
598500 -- (-278.007) [-278.602] (-280.931) (-278.275) * (-278.445) (-277.072) (-278.821) [-277.804] -- 0:00:23
599000 -- (-279.644) (-280.354) (-278.567) [-280.067] * (-278.887) (-277.031) [-276.421] (-277.964) -- 0:00:23
599500 -- (-281.460) (-279.901) (-277.432) [-279.342] * (-278.271) [-278.622] (-277.463) (-281.987) -- 0:00:23
600000 -- (-276.786) (-276.274) (-279.965) [-276.676] * (-279.717) [-278.705] (-284.329) (-279.758) -- 0:00:23
Average standard deviation of split frequencies: 0.009695
600500 -- (-276.899) (-276.230) [-279.054] (-278.705) * (-276.968) (-280.983) (-284.144) [-277.206] -- 0:00:23
601000 -- (-279.034) (-277.158) [-277.039] (-276.820) * [-276.689] (-279.563) (-280.448) (-278.142) -- 0:00:23
601500 -- (-278.500) (-276.741) [-281.550] (-279.797) * (-277.704) (-277.709) [-277.577] (-281.648) -- 0:00:23
602000 -- [-278.658] (-276.538) (-280.661) (-277.918) * [-279.420] (-281.504) (-277.588) (-281.933) -- 0:00:23
602500 -- (-280.186) (-276.773) [-277.798] (-278.594) * (-279.923) [-278.903] (-277.312) (-280.144) -- 0:00:23
603000 -- (-278.985) (-277.698) (-278.607) [-278.041] * (-277.570) (-278.777) (-279.813) [-280.213] -- 0:00:23
603500 -- (-289.600) (-277.301) [-281.421] (-277.105) * (-277.837) (-277.839) (-282.019) [-279.286] -- 0:00:22
604000 -- (-281.798) [-277.626] (-279.250) (-277.806) * (-277.879) (-277.375) (-281.882) [-281.510] -- 0:00:23
604500 -- (-279.415) [-278.993] (-277.652) (-276.517) * [-277.440] (-278.812) (-282.375) (-284.245) -- 0:00:23
605000 -- [-278.197] (-279.723) (-277.641) (-276.648) * (-278.252) (-282.179) [-277.012] (-277.479) -- 0:00:23
Average standard deviation of split frequencies: 0.009701
605500 -- (-279.677) (-277.148) (-285.118) [-277.793] * (-277.952) (-278.134) [-276.806] (-276.328) -- 0:00:23
606000 -- [-277.526] (-276.958) (-277.216) (-279.667) * (-276.724) (-277.112) (-277.861) [-277.372] -- 0:00:23
606500 -- [-278.162] (-278.287) (-279.234) (-279.907) * (-277.139) (-279.708) (-280.506) [-279.234] -- 0:00:23
607000 -- [-278.635] (-278.922) (-278.080) (-281.133) * (-277.147) (-281.258) (-278.722) [-281.022] -- 0:00:23
607500 -- [-277.399] (-280.802) (-278.322) (-282.360) * (-278.112) [-280.655] (-278.101) (-282.987) -- 0:00:23
608000 -- [-277.346] (-280.180) (-279.502) (-280.462) * (-277.045) (-277.860) [-276.930] (-280.947) -- 0:00:23
608500 -- (-277.406) (-283.294) [-278.607] (-278.304) * (-277.848) (-280.347) (-277.244) [-278.577] -- 0:00:23
609000 -- (-277.438) (-279.533) [-279.302] (-277.869) * (-279.198) [-277.917] (-277.225) (-279.543) -- 0:00:23
609500 -- (-278.130) (-278.303) [-277.606] (-278.055) * (-279.063) [-277.443] (-277.829) (-280.512) -- 0:00:23
610000 -- (-279.046) [-278.377] (-278.234) (-282.047) * (-278.316) (-278.915) [-277.552] (-280.403) -- 0:00:23
Average standard deviation of split frequencies: 0.009794
610500 -- (-278.293) [-277.394] (-280.241) (-280.250) * [-276.950] (-278.449) (-277.946) (-283.454) -- 0:00:22
611000 -- (-278.929) (-277.143) (-277.515) [-278.499] * (-281.746) (-281.696) [-278.718] (-281.008) -- 0:00:22
611500 -- (-277.708) [-280.813] (-278.077) (-276.599) * (-280.358) (-277.479) [-278.726] (-280.006) -- 0:00:22
612000 -- [-277.414] (-280.487) (-278.780) (-277.191) * (-281.319) (-280.342) [-278.228] (-278.830) -- 0:00:22
612500 -- (-279.624) (-278.194) (-277.436) [-277.698] * (-277.969) (-282.350) (-278.052) [-277.042] -- 0:00:22
613000 -- [-279.192] (-277.782) (-280.336) (-281.205) * (-278.371) (-277.552) [-277.837] (-280.538) -- 0:00:22
613500 -- [-277.862] (-277.760) (-279.196) (-285.390) * [-277.095] (-277.981) (-279.874) (-279.608) -- 0:00:22
614000 -- (-277.694) [-278.521] (-279.695) (-286.979) * [-280.897] (-280.269) (-277.360) (-276.449) -- 0:00:22
614500 -- (-278.524) [-280.048] (-277.161) (-282.133) * (-277.884) [-279.721] (-276.848) (-277.554) -- 0:00:22
615000 -- (-278.343) [-278.398] (-277.704) (-277.383) * [-277.881] (-278.491) (-280.458) (-280.130) -- 0:00:22
Average standard deviation of split frequencies: 0.008944
615500 -- (-278.280) [-277.110] (-283.131) (-277.794) * (-278.602) (-280.660) [-276.885] (-278.511) -- 0:00:22
616000 -- (-279.075) (-278.266) [-276.590] (-279.003) * [-276.523] (-280.333) (-278.018) (-276.805) -- 0:00:22
616500 -- (-281.338) (-277.345) [-278.367] (-278.501) * (-278.875) (-282.754) (-279.815) [-278.587] -- 0:00:22
617000 -- (-276.614) (-279.493) (-280.588) [-278.604] * (-278.446) [-279.205] (-278.876) (-280.506) -- 0:00:22
617500 -- (-277.108) (-283.304) (-282.967) [-277.415] * (-278.298) [-283.002] (-278.822) (-279.937) -- 0:00:22
618000 -- [-276.648] (-280.530) (-280.118) (-277.953) * (-278.689) (-284.022) (-278.475) [-276.468] -- 0:00:22
618500 -- [-280.831] (-278.430) (-276.794) (-279.391) * (-279.061) (-280.222) (-277.473) [-277.290] -- 0:00:22
619000 -- (-280.214) (-281.148) [-278.276] (-281.680) * [-277.694] (-278.914) (-279.662) (-277.531) -- 0:00:22
619500 -- [-276.586] (-278.596) (-276.728) (-281.215) * (-279.819) (-278.487) [-277.110] (-280.883) -- 0:00:22
620000 -- [-277.251] (-277.558) (-276.851) (-278.124) * (-278.137) (-278.325) [-276.992] (-279.077) -- 0:00:22
Average standard deviation of split frequencies: 0.008304
620500 -- (-287.976) (-278.119) [-281.059] (-281.437) * (-279.933) [-276.468] (-280.119) (-278.167) -- 0:00:22
621000 -- [-280.991] (-276.904) (-278.642) (-276.617) * [-279.104] (-280.836) (-278.752) (-276.996) -- 0:00:22
621500 -- (-278.679) (-281.280) (-278.158) [-277.445] * (-277.749) (-283.715) (-278.746) [-277.566] -- 0:00:22
622000 -- (-277.922) (-279.058) [-281.057] (-278.736) * (-277.465) (-278.380) [-282.258] (-279.362) -- 0:00:22
622500 -- [-279.622] (-278.626) (-278.978) (-281.481) * (-278.778) [-277.681] (-282.404) (-280.212) -- 0:00:22
623000 -- (-277.172) (-279.143) [-279.498] (-279.062) * (-277.933) [-277.614] (-281.194) (-278.684) -- 0:00:22
623500 -- (-279.044) (-280.532) [-281.153] (-277.820) * (-279.931) [-279.643] (-281.607) (-279.311) -- 0:00:22
624000 -- (-279.747) (-280.225) (-277.045) [-279.159] * (-278.763) [-279.747] (-276.754) (-281.258) -- 0:00:22
624500 -- (-284.610) (-280.543) (-277.190) [-277.347] * (-277.386) (-278.882) (-281.557) [-279.321] -- 0:00:22
625000 -- [-277.171] (-278.774) (-280.743) (-281.850) * [-276.954] (-276.687) (-279.657) (-278.024) -- 0:00:22
Average standard deviation of split frequencies: 0.008635
625500 -- [-278.476] (-277.855) (-277.782) (-279.757) * (-277.104) [-277.237] (-278.616) (-276.806) -- 0:00:22
626000 -- (-277.068) [-276.873] (-277.925) (-277.671) * (-278.779) (-279.316) (-278.323) [-277.029] -- 0:00:22
626500 -- (-277.738) [-280.859] (-281.487) (-283.302) * (-277.667) (-278.119) (-276.688) [-281.677] -- 0:00:22
627000 -- (-276.909) [-283.654] (-278.647) (-279.030) * (-279.393) (-277.224) (-278.927) [-277.809] -- 0:00:22
627500 -- (-277.917) (-280.829) (-279.096) [-276.598] * (-281.129) (-277.342) (-279.870) [-278.458] -- 0:00:21
628000 -- [-277.378] (-279.447) (-278.238) (-280.464) * (-277.321) (-279.975) [-278.118] (-277.218) -- 0:00:21
628500 -- [-277.432] (-276.526) (-278.474) (-277.593) * (-278.678) (-280.256) (-282.530) [-276.702] -- 0:00:21
629000 -- (-277.811) (-277.665) [-277.460] (-281.492) * (-277.939) (-276.669) [-279.644] (-278.512) -- 0:00:21
629500 -- [-279.230] (-277.064) (-279.010) (-280.575) * (-280.164) (-277.098) [-276.616] (-278.422) -- 0:00:21
630000 -- (-277.782) (-280.828) (-281.179) [-279.888] * (-280.949) (-277.364) (-279.135) [-280.487] -- 0:00:21
Average standard deviation of split frequencies: 0.008322
630500 -- (-281.018) (-278.302) [-277.268] (-281.501) * (-277.113) (-281.831) (-277.640) [-276.495] -- 0:00:21
631000 -- (-279.794) (-280.066) [-279.119] (-277.615) * (-281.776) [-278.099] (-278.659) (-279.447) -- 0:00:21
631500 -- [-281.957] (-279.957) (-279.379) (-279.817) * (-280.798) (-279.671) [-278.337] (-282.755) -- 0:00:21
632000 -- (-280.390) [-277.214] (-280.066) (-280.872) * (-279.232) (-278.486) [-277.652] (-279.426) -- 0:00:21
632500 -- (-282.333) (-276.955) (-276.567) [-278.695] * (-282.275) [-279.845] (-277.944) (-279.567) -- 0:00:21
633000 -- (-280.118) (-278.027) (-279.171) [-279.067] * (-279.076) [-279.810] (-279.654) (-278.614) -- 0:00:21
633500 -- (-280.259) (-278.118) [-276.651] (-278.017) * [-277.079] (-278.118) (-278.988) (-280.313) -- 0:00:21
634000 -- (-277.955) (-277.871) (-277.914) [-278.977] * (-279.692) [-278.332] (-277.551) (-280.385) -- 0:00:21
634500 -- (-277.395) [-276.867] (-283.630) (-276.996) * (-285.127) (-280.863) [-280.259] (-278.083) -- 0:00:21
635000 -- (-276.864) (-279.788) (-281.971) [-279.101] * (-282.330) [-279.069] (-278.297) (-277.294) -- 0:00:21
Average standard deviation of split frequencies: 0.008598
635500 -- [-278.085] (-278.384) (-280.401) (-281.292) * (-278.928) (-276.977) [-277.470] (-278.453) -- 0:00:21
636000 -- (-282.965) (-284.230) (-280.133) [-282.394] * (-278.528) (-284.238) (-280.916) [-277.503] -- 0:00:21
636500 -- (-281.537) [-283.449] (-276.638) (-278.711) * (-278.957) (-278.401) (-279.950) [-278.505] -- 0:00:21
637000 -- (-278.519) (-279.175) (-276.261) [-280.116] * (-278.516) (-277.763) [-279.570] (-277.063) -- 0:00:21
637500 -- [-277.610] (-280.071) (-282.834) (-279.475) * (-277.695) (-278.975) (-281.222) [-279.991] -- 0:00:21
638000 -- (-276.807) [-280.302] (-277.005) (-281.328) * [-281.210] (-276.548) (-281.308) (-277.052) -- 0:00:21
638500 -- (-277.325) (-282.633) (-280.397) [-278.302] * (-278.953) (-276.564) [-277.637] (-281.556) -- 0:00:21
639000 -- (-280.059) [-279.413] (-280.861) (-277.969) * (-276.852) (-277.852) [-278.930] (-278.575) -- 0:00:21
639500 -- [-278.481] (-279.584) (-280.823) (-277.087) * (-278.878) (-277.008) [-278.309] (-280.697) -- 0:00:21
640000 -- (-280.380) (-280.498) (-278.351) [-279.370] * (-277.590) (-278.257) [-278.020] (-279.716) -- 0:00:21
Average standard deviation of split frequencies: 0.007849
640500 -- (-277.323) (-277.775) [-277.993] (-279.904) * (-278.116) (-277.507) (-277.561) [-278.895] -- 0:00:21
641000 -- (-278.293) (-285.418) [-278.292] (-276.674) * (-280.769) [-277.093] (-280.407) (-283.030) -- 0:00:21
641500 -- (-277.895) [-283.927] (-278.176) (-276.952) * [-282.050] (-279.674) (-277.076) (-284.773) -- 0:00:21
642000 -- (-278.688) [-278.087] (-277.889) (-280.955) * (-277.391) [-277.082] (-277.073) (-280.739) -- 0:00:21
642500 -- (-280.198) (-285.327) (-278.543) [-277.020] * [-279.063] (-282.222) (-280.955) (-280.354) -- 0:00:21
643000 -- [-280.013] (-287.638) (-277.488) (-279.403) * [-277.612] (-279.828) (-281.500) (-277.804) -- 0:00:21
643500 -- (-280.164) (-279.195) (-279.030) [-278.137] * [-278.515] (-278.414) (-277.302) (-276.335) -- 0:00:21
644000 -- [-277.904] (-280.713) (-279.921) (-278.131) * (-276.666) (-278.224) (-279.303) [-276.451] -- 0:00:21
644500 -- [-281.102] (-278.863) (-279.899) (-280.091) * (-277.837) (-278.180) [-277.322] (-278.714) -- 0:00:20
645000 -- (-278.588) (-276.904) [-278.956] (-279.285) * (-278.207) [-278.303] (-277.756) (-280.129) -- 0:00:20
Average standard deviation of split frequencies: 0.008124
645500 -- (-278.277) (-280.827) [-280.486] (-278.871) * (-288.170) (-276.630) [-277.504] (-281.494) -- 0:00:20
646000 -- (-277.955) [-277.320] (-282.283) (-279.271) * (-281.511) (-279.029) (-277.300) [-277.769] -- 0:00:20
646500 -- (-280.246) (-278.433) (-279.464) [-278.454] * (-283.064) (-277.304) [-278.842] (-277.521) -- 0:00:20
647000 -- (-276.964) (-281.083) (-281.674) [-280.312] * (-281.131) (-278.753) [-278.980] (-278.686) -- 0:00:20
647500 -- (-279.244) [-279.486] (-279.193) (-277.842) * [-278.929] (-279.062) (-279.400) (-280.567) -- 0:00:20
648000 -- (-277.866) [-280.020] (-278.528) (-279.158) * (-281.214) (-278.290) [-280.826] (-282.017) -- 0:00:20
648500 -- [-277.231] (-281.987) (-280.040) (-277.529) * (-279.742) (-279.061) (-280.108) [-277.025] -- 0:00:20
649000 -- (-279.410) (-279.692) (-278.948) [-277.125] * (-277.422) [-278.938] (-280.051) (-278.866) -- 0:00:20
649500 -- (-284.403) (-278.473) (-277.564) [-276.867] * (-279.313) (-280.882) [-277.565] (-277.583) -- 0:00:20
650000 -- (-277.613) [-277.095] (-277.929) (-277.251) * [-279.928] (-278.145) (-280.903) (-280.066) -- 0:00:20
Average standard deviation of split frequencies: 0.007969
650500 -- (-277.222) (-278.485) [-279.283] (-279.015) * (-280.333) [-278.670] (-277.082) (-279.749) -- 0:00:20
651000 -- (-280.171) [-278.191] (-279.899) (-280.788) * [-279.986] (-281.067) (-279.041) (-282.740) -- 0:00:20
651500 -- (-279.797) (-279.868) [-279.901] (-278.337) * [-282.988] (-281.864) (-276.515) (-282.785) -- 0:00:20
652000 -- (-278.785) (-280.322) (-278.631) [-278.160] * (-279.132) (-279.256) [-277.031] (-276.851) -- 0:00:20
652500 -- (-279.625) (-278.059) (-278.313) [-277.628] * (-278.507) (-278.889) (-277.324) [-281.508] -- 0:00:20
653000 -- (-279.009) (-278.193) (-278.314) [-276.915] * (-278.792) (-288.929) (-278.185) [-279.001] -- 0:00:20
653500 -- [-277.068] (-278.679) (-280.720) (-277.020) * (-281.795) [-281.375] (-277.676) (-278.362) -- 0:00:20
654000 -- (-277.748) (-283.629) (-276.969) [-278.631] * (-278.852) (-278.096) (-276.926) [-277.872] -- 0:00:20
654500 -- (-277.933) (-279.849) [-277.475] (-278.165) * [-282.870] (-278.832) (-277.961) (-279.950) -- 0:00:20
655000 -- [-278.136] (-280.052) (-278.484) (-277.036) * (-280.150) [-281.571] (-283.275) (-282.880) -- 0:00:20
Average standard deviation of split frequencies: 0.008240
655500 -- (-277.329) [-279.944] (-280.015) (-282.091) * (-278.090) (-278.923) (-279.505) [-282.045] -- 0:00:20
656000 -- (-276.792) (-278.737) (-281.987) [-277.138] * (-277.147) (-278.426) (-277.137) [-280.257] -- 0:00:20
656500 -- [-279.571] (-280.200) (-279.955) (-278.127) * [-278.772] (-277.597) (-281.067) (-278.560) -- 0:00:20
657000 -- (-277.487) (-279.356) (-279.033) [-277.525] * (-277.106) [-280.086] (-283.348) (-286.932) -- 0:00:20
657500 -- (-278.686) (-280.280) (-279.768) [-276.529] * (-278.111) (-281.600) [-276.677] (-279.312) -- 0:00:20
658000 -- (-281.170) (-280.670) (-280.259) [-277.408] * (-278.513) [-278.227] (-277.612) (-277.387) -- 0:00:20
658500 -- (-278.451) (-279.790) [-276.608] (-279.234) * (-278.858) [-279.221] (-284.742) (-279.217) -- 0:00:20
659000 -- (-279.050) (-279.652) (-276.654) [-277.701] * (-278.108) (-278.407) [-280.702] (-278.015) -- 0:00:20
659500 -- [-280.683] (-281.545) (-276.486) (-280.839) * [-278.337] (-279.692) (-278.873) (-278.051) -- 0:00:20
660000 -- [-283.058] (-278.180) (-280.606) (-277.707) * (-279.754) (-278.908) (-278.858) [-286.360] -- 0:00:20
Average standard deviation of split frequencies: 0.008610
660500 -- (-279.579) (-278.094) [-280.591] (-277.218) * (-278.766) (-280.965) [-278.032] (-278.467) -- 0:00:20
661000 -- [-277.500] (-277.890) (-283.153) (-279.598) * (-281.045) [-278.782] (-276.647) (-277.729) -- 0:00:20
661500 -- [-277.154] (-277.166) (-277.973) (-277.062) * (-280.993) (-278.728) [-276.306] (-279.273) -- 0:00:19
662000 -- (-279.422) [-280.780] (-278.568) (-281.410) * (-279.894) (-279.177) [-276.790] (-279.984) -- 0:00:19
662500 -- (-283.236) [-277.066] (-279.399) (-280.237) * (-276.710) (-279.456) [-277.802] (-277.628) -- 0:00:19
663000 -- (-277.623) [-278.668] (-287.107) (-277.971) * (-278.151) [-278.061] (-278.738) (-279.400) -- 0:00:19
663500 -- (-277.541) (-277.992) (-278.727) [-280.750] * (-279.422) (-280.462) (-279.744) [-278.703] -- 0:00:19
664000 -- (-279.580) (-281.422) [-279.260] (-278.387) * (-276.976) (-278.072) [-280.055] (-277.776) -- 0:00:19
664500 -- (-276.773) (-278.557) [-277.186] (-277.952) * (-277.678) (-277.513) [-280.037] (-278.459) -- 0:00:19
665000 -- (-278.634) (-277.538) [-277.020] (-279.567) * (-277.641) (-277.322) (-279.232) [-278.261] -- 0:00:19
Average standard deviation of split frequencies: 0.008352
665500 -- (-279.068) [-277.125] (-277.628) (-279.844) * (-282.916) [-277.052] (-279.065) (-281.261) -- 0:00:19
666000 -- (-280.390) [-276.668] (-280.984) (-280.737) * (-277.852) (-280.396) [-279.185] (-278.152) -- 0:00:19
666500 -- [-276.750] (-281.877) (-282.225) (-281.811) * (-276.477) (-279.373) [-283.469] (-283.196) -- 0:00:19
667000 -- (-277.586) (-279.838) [-276.769] (-279.659) * (-279.564) (-278.535) [-281.304] (-279.644) -- 0:00:19
667500 -- [-277.235] (-278.417) (-278.529) (-277.807) * [-276.998] (-279.387) (-279.984) (-279.968) -- 0:00:19
668000 -- [-276.510] (-278.900) (-281.059) (-282.448) * (-280.215) (-278.248) (-281.918) [-277.239] -- 0:00:19
668500 -- (-278.252) [-278.123] (-277.783) (-278.620) * (-279.161) (-279.652) [-279.131] (-282.019) -- 0:00:19
669000 -- [-277.369] (-279.188) (-277.963) (-277.654) * (-278.261) (-277.453) (-277.612) [-276.894] -- 0:00:19
669500 -- [-279.349] (-276.524) (-277.286) (-278.163) * (-278.812) (-279.774) (-276.909) [-278.704] -- 0:00:19
670000 -- (-279.607) (-277.082) (-277.792) [-280.559] * (-278.134) (-279.139) (-284.340) [-279.901] -- 0:00:19
Average standard deviation of split frequencies: 0.008341
670500 -- [-279.792] (-278.161) (-278.410) (-279.125) * [-278.674] (-277.951) (-279.472) (-278.461) -- 0:00:19
671000 -- (-278.633) (-276.422) (-279.787) [-280.563] * (-279.011) (-276.565) [-280.328] (-279.721) -- 0:00:19
671500 -- (-280.816) (-276.438) [-279.312] (-280.749) * (-280.307) (-276.880) [-277.292] (-279.461) -- 0:00:19
672000 -- (-276.461) [-276.678] (-278.118) (-280.303) * [-277.880] (-279.934) (-282.063) (-278.101) -- 0:00:19
672500 -- (-277.948) [-277.036] (-278.165) (-277.683) * (-277.530) (-279.521) (-284.019) [-282.178] -- 0:00:19
673000 -- [-277.035] (-280.365) (-282.484) (-277.541) * (-278.597) (-283.040) [-278.041] (-280.657) -- 0:00:19
673500 -- (-276.933) (-279.194) (-279.081) [-278.705] * [-277.868] (-278.331) (-279.037) (-280.851) -- 0:00:19
674000 -- [-276.842] (-277.412) (-280.995) (-277.388) * [-279.007] (-278.347) (-277.100) (-278.352) -- 0:00:19
674500 -- (-276.884) (-278.419) [-281.856] (-276.773) * [-277.990] (-277.093) (-279.885) (-278.168) -- 0:00:19
675000 -- [-278.963] (-281.905) (-280.552) (-276.927) * (-280.393) [-276.950] (-278.363) (-278.649) -- 0:00:19
Average standard deviation of split frequencies: 0.008740
675500 -- (-278.285) (-277.230) (-279.869) [-277.269] * (-277.945) (-278.591) (-280.786) [-277.527] -- 0:00:19
676000 -- (-280.386) (-278.230) (-277.369) [-277.503] * (-279.351) (-282.469) [-278.525] (-279.284) -- 0:00:19
676500 -- (-280.844) (-277.894) (-279.128) [-280.656] * [-276.689] (-280.402) (-284.295) (-277.638) -- 0:00:19
677000 -- (-281.290) [-277.615] (-278.978) (-278.818) * (-276.951) [-277.855] (-278.459) (-279.004) -- 0:00:19
677500 -- (-278.343) (-278.663) [-278.423] (-279.754) * (-277.642) [-279.560] (-279.115) (-278.996) -- 0:00:19
678000 -- (-282.622) (-277.973) [-279.963] (-281.424) * [-278.025] (-278.000) (-279.838) (-281.310) -- 0:00:18
678500 -- (-278.335) [-278.706] (-280.256) (-276.992) * (-278.803) [-280.036] (-278.773) (-279.133) -- 0:00:18
679000 -- (-278.788) (-279.122) (-280.836) [-277.010] * (-280.138) (-279.740) (-278.319) [-280.336] -- 0:00:18
679500 -- [-277.902] (-277.666) (-277.141) (-279.491) * (-277.322) (-278.912) (-277.174) [-279.637] -- 0:00:18
680000 -- (-284.619) [-279.122] (-283.639) (-284.656) * (-279.158) [-279.373] (-278.398) (-278.645) -- 0:00:18
Average standard deviation of split frequencies: 0.008634
680500 -- (-279.441) (-279.435) [-278.131] (-280.204) * (-280.400) (-280.675) (-279.059) [-278.584] -- 0:00:18
681000 -- (-278.306) [-278.163] (-281.508) (-277.599) * [-276.743] (-276.426) (-278.491) (-277.225) -- 0:00:18
681500 -- (-278.667) (-278.721) [-278.683] (-281.805) * (-281.444) (-280.010) [-278.202] (-277.980) -- 0:00:18
682000 -- (-278.372) [-277.332] (-280.488) (-277.667) * (-279.104) (-278.566) (-278.544) [-278.057] -- 0:00:18
682500 -- (-278.410) [-279.001] (-281.660) (-277.243) * (-277.957) [-280.270] (-276.732) (-280.272) -- 0:00:18
683000 -- (-280.673) (-278.308) [-279.489] (-277.005) * (-278.225) (-276.972) (-276.929) [-276.461] -- 0:00:18
683500 -- (-280.879) [-277.982] (-281.240) (-278.024) * (-277.080) (-279.130) (-277.228) [-279.195] -- 0:00:18
684000 -- (-278.755) (-277.316) [-281.355] (-277.983) * (-279.683) [-280.964] (-276.929) (-279.777) -- 0:00:18
684500 -- [-277.693] (-277.603) (-279.731) (-277.615) * (-277.927) (-279.491) (-280.064) [-281.410] -- 0:00:18
685000 -- (-278.724) (-279.604) (-279.814) [-276.964] * [-277.859] (-277.477) (-279.220) (-282.514) -- 0:00:18
Average standard deviation of split frequencies: 0.009191
685500 -- [-279.184] (-282.922) (-281.273) (-277.863) * [-277.387] (-277.289) (-277.725) (-280.068) -- 0:00:18
686000 -- (-279.802) (-280.115) [-276.867] (-280.100) * (-278.131) (-279.246) [-277.810] (-282.413) -- 0:00:18
686500 -- (-278.811) [-277.096] (-276.947) (-277.310) * (-285.021) (-279.103) [-279.379] (-279.482) -- 0:00:18
687000 -- (-279.264) (-276.970) [-277.470] (-277.937) * [-279.002] (-278.008) (-279.646) (-277.856) -- 0:00:18
687500 -- [-280.518] (-277.749) (-279.110) (-277.084) * [-279.404] (-277.573) (-281.223) (-280.649) -- 0:00:18
688000 -- [-278.871] (-279.707) (-278.197) (-279.594) * (-279.688) [-280.680] (-281.039) (-278.031) -- 0:00:18
688500 -- (-280.357) (-277.998) [-277.248] (-277.949) * [-281.808] (-279.718) (-281.651) (-279.273) -- 0:00:18
689000 -- [-277.736] (-278.344) (-278.515) (-278.937) * (-281.168) [-279.704] (-283.573) (-276.694) -- 0:00:18
689500 -- (-280.595) (-280.079) [-278.435] (-277.642) * (-278.925) [-277.838] (-278.581) (-276.912) -- 0:00:18
690000 -- (-279.199) (-279.046) [-278.382] (-278.381) * (-278.372) [-278.699] (-283.212) (-277.533) -- 0:00:18
Average standard deviation of split frequencies: 0.009086
690500 -- (-284.505) (-279.682) [-279.815] (-277.790) * (-277.595) (-279.534) (-279.457) [-277.099] -- 0:00:18
691000 -- (-278.159) (-278.861) [-278.684] (-281.068) * (-279.959) [-278.316] (-279.010) (-277.508) -- 0:00:18
691500 -- (-278.482) (-277.874) [-277.757] (-280.754) * [-278.056] (-278.203) (-276.529) (-280.195) -- 0:00:18
692000 -- [-278.447] (-277.671) (-278.670) (-277.323) * (-277.721) (-276.536) [-277.505] (-277.903) -- 0:00:18
692500 -- (-279.757) (-278.166) [-281.865] (-276.628) * (-281.146) [-281.023] (-278.847) (-279.949) -- 0:00:18
693000 -- (-283.799) [-278.131] (-280.853) (-276.787) * (-279.968) [-279.253] (-279.933) (-280.413) -- 0:00:18
693500 -- (-278.767) (-276.859) [-279.182] (-277.780) * (-277.199) (-276.774) (-279.363) [-277.778] -- 0:00:18
694000 -- [-279.609] (-278.076) (-278.453) (-277.710) * (-277.096) [-278.647] (-277.102) (-280.506) -- 0:00:18
694500 -- (-277.639) (-279.078) (-284.724) [-277.844] * [-277.909] (-278.470) (-279.313) (-279.817) -- 0:00:18
695000 -- [-279.421] (-282.097) (-281.306) (-279.091) * (-278.659) (-279.252) (-279.191) [-278.879] -- 0:00:17
Average standard deviation of split frequencies: 0.009355
695500 -- [-279.502] (-283.769) (-279.561) (-279.429) * (-277.662) (-282.111) (-278.502) [-276.936] -- 0:00:17
696000 -- [-280.510] (-280.169) (-280.717) (-280.659) * [-277.774] (-280.976) (-284.424) (-277.472) -- 0:00:17
696500 -- (-284.276) (-278.732) (-277.500) [-279.351] * (-277.548) (-279.566) (-285.714) [-277.263] -- 0:00:17
697000 -- (-279.182) (-278.073) (-277.031) [-282.699] * [-277.808] (-281.315) (-277.906) (-277.265) -- 0:00:17
697500 -- (-279.383) [-277.877] (-279.897) (-279.214) * (-279.108) [-278.907] (-277.905) (-278.652) -- 0:00:17
698000 -- (-277.495) (-280.497) (-278.989) [-279.872] * (-277.611) (-279.922) (-278.269) [-278.344] -- 0:00:17
698500 -- (-277.379) [-277.160] (-282.358) (-278.969) * [-277.158] (-279.881) (-277.119) (-282.075) -- 0:00:17
699000 -- (-286.455) (-277.515) [-277.236] (-281.953) * (-278.504) (-278.696) (-281.254) [-277.448] -- 0:00:17
699500 -- (-285.558) (-277.465) [-276.619] (-279.940) * (-278.074) [-278.684] (-279.809) (-278.260) -- 0:00:17
700000 -- (-280.733) (-276.976) [-276.394] (-282.939) * [-278.348] (-280.372) (-278.301) (-279.059) -- 0:00:17
Average standard deviation of split frequencies: 0.010013
700500 -- (-278.920) [-276.909] (-279.209) (-280.213) * (-277.774) (-279.068) [-282.436] (-286.133) -- 0:00:17
701000 -- (-276.289) [-277.769] (-285.104) (-280.194) * [-278.660] (-277.376) (-278.376) (-277.072) -- 0:00:17
701500 -- (-279.432) (-282.847) (-276.872) [-277.902] * (-278.435) (-282.781) (-279.685) [-277.303] -- 0:00:17
702000 -- (-280.897) (-276.432) (-276.883) [-276.898] * [-278.316] (-282.716) (-280.225) (-278.299) -- 0:00:17
702500 -- (-285.002) (-279.756) [-277.473] (-277.029) * (-280.227) (-277.615) (-277.613) [-277.839] -- 0:00:17
703000 -- [-279.721] (-281.036) (-276.774) (-276.653) * [-279.094] (-276.693) (-282.009) (-277.515) -- 0:00:17
703500 -- [-278.159] (-277.428) (-277.768) (-277.407) * (-279.433) (-276.997) [-278.985] (-277.103) -- 0:00:17
704000 -- (-277.093) (-276.894) (-279.110) [-279.831] * (-279.206) (-276.512) [-279.459] (-277.474) -- 0:00:17
704500 -- (-282.037) [-280.273] (-277.876) (-282.982) * (-279.925) (-277.830) (-277.116) [-277.581] -- 0:00:17
705000 -- [-281.499] (-281.779) (-279.900) (-276.991) * [-277.806] (-276.686) (-279.930) (-278.535) -- 0:00:17
Average standard deviation of split frequencies: 0.010094
705500 -- (-280.759) (-280.413) [-278.118] (-277.998) * (-278.816) (-276.844) [-279.799] (-276.782) -- 0:00:17
706000 -- (-281.137) (-279.803) [-277.804] (-278.547) * [-278.224] (-276.660) (-280.625) (-277.435) -- 0:00:17
706500 -- (-279.122) [-277.215] (-279.161) (-280.002) * (-278.201) (-276.775) (-278.231) [-278.405] -- 0:00:17
707000 -- (-282.204) (-280.182) [-277.910] (-281.352) * (-277.639) [-279.285] (-280.054) (-280.655) -- 0:00:17
707500 -- (-276.891) (-278.722) (-279.465) [-278.530] * [-283.224] (-277.349) (-277.296) (-279.309) -- 0:00:17
708000 -- (-277.110) (-278.305) [-278.139] (-278.025) * (-278.888) [-281.570] (-278.529) (-280.377) -- 0:00:17
708500 -- [-276.978] (-276.476) (-276.517) (-279.907) * (-279.057) (-279.184) [-277.637] (-278.657) -- 0:00:17
709000 -- (-279.640) (-281.645) [-276.836] (-277.206) * (-279.976) [-278.277] (-282.000) (-280.489) -- 0:00:17
709500 -- [-277.525] (-278.593) (-276.523) (-278.272) * (-277.220) (-280.171) (-278.661) [-279.859] -- 0:00:17
710000 -- (-279.831) [-279.374] (-279.321) (-279.406) * [-276.436] (-279.912) (-277.295) (-277.142) -- 0:00:17
Average standard deviation of split frequencies: 0.010240
710500 -- (-278.773) (-276.986) [-280.922] (-280.153) * [-277.348] (-277.736) (-279.578) (-281.024) -- 0:00:17
711000 -- (-277.292) (-277.091) [-277.850] (-281.159) * (-277.271) [-279.042] (-278.695) (-276.921) -- 0:00:17
711500 -- [-279.611] (-278.454) (-283.135) (-282.160) * (-278.532) [-277.053] (-277.232) (-278.757) -- 0:00:17
712000 -- (-278.440) (-280.057) [-279.083] (-283.245) * (-280.317) [-278.631] (-284.443) (-277.416) -- 0:00:16
712500 -- (-283.823) [-279.390] (-278.148) (-281.011) * (-278.857) (-277.950) (-279.139) [-278.307] -- 0:00:16
713000 -- (-278.377) [-277.522] (-278.272) (-281.890) * (-277.914) (-282.521) [-278.417] (-281.267) -- 0:00:16
713500 -- (-277.509) (-280.348) [-278.577] (-282.991) * (-277.693) [-279.019] (-279.565) (-278.727) -- 0:00:16
714000 -- (-280.047) (-277.963) (-277.500) [-279.411] * (-279.212) (-283.891) (-278.149) [-278.268] -- 0:00:16
714500 -- [-279.095] (-278.090) (-278.874) (-277.525) * (-279.974) (-277.161) [-277.350] (-280.940) -- 0:00:16
715000 -- [-277.582] (-277.481) (-278.193) (-278.392) * (-278.480) [-277.514] (-277.875) (-279.011) -- 0:00:16
Average standard deviation of split frequencies: 0.010164
715500 -- (-278.431) [-278.046] (-279.675) (-280.704) * [-282.074] (-280.158) (-277.774) (-278.668) -- 0:00:16
716000 -- (-278.604) [-277.232] (-279.022) (-279.014) * (-278.642) (-277.686) [-276.929] (-279.216) -- 0:00:16
716500 -- [-279.106] (-279.239) (-277.759) (-278.443) * (-281.107) (-280.579) [-276.951] (-278.377) -- 0:00:16
717000 -- (-282.845) [-277.023] (-278.855) (-278.494) * (-281.226) (-277.687) [-278.846] (-279.566) -- 0:00:16
717500 -- (-280.059) (-276.879) [-279.159] (-277.549) * (-278.755) (-280.574) (-278.190) [-279.358] -- 0:00:16
718000 -- (-279.384) (-276.847) [-277.839] (-277.429) * [-279.185] (-280.788) (-282.508) (-278.675) -- 0:00:16
718500 -- (-283.742) (-283.395) (-281.662) [-281.310] * (-281.147) (-279.464) (-276.989) [-278.985] -- 0:00:16
719000 -- (-280.704) [-281.085] (-278.177) (-281.658) * (-280.489) (-277.416) [-277.342] (-279.403) -- 0:00:16
719500 -- (-277.256) [-278.479] (-277.523) (-285.047) * (-279.789) (-276.741) (-278.947) [-278.230] -- 0:00:16
720000 -- (-276.571) (-279.957) [-279.652] (-280.586) * [-278.098] (-278.106) (-279.608) (-277.020) -- 0:00:16
Average standard deviation of split frequencies: 0.010302
720500 -- (-283.459) [-280.885] (-281.338) (-285.276) * (-276.750) [-277.831] (-276.852) (-277.880) -- 0:00:16
721000 -- [-279.419] (-279.355) (-279.404) (-277.074) * (-278.865) [-280.537] (-277.895) (-279.033) -- 0:00:16
721500 -- [-277.980] (-282.864) (-277.524) (-277.968) * [-279.039] (-277.409) (-277.421) (-279.352) -- 0:00:16
722000 -- (-277.614) [-278.244] (-280.679) (-277.396) * (-277.696) (-283.776) [-277.596] (-285.525) -- 0:00:16
722500 -- (-276.803) (-277.598) [-277.846] (-280.007) * (-276.665) (-281.539) [-276.756] (-279.655) -- 0:00:16
723000 -- (-277.404) (-278.033) [-278.223] (-278.789) * [-277.998] (-280.194) (-278.810) (-284.096) -- 0:00:16
723500 -- (-280.220) (-277.520) (-278.825) [-278.214] * (-278.123) (-280.210) [-279.595] (-287.216) -- 0:00:16
724000 -- (-281.025) [-278.084] (-280.155) (-279.043) * [-277.922] (-279.279) (-277.907) (-279.443) -- 0:00:16
724500 -- (-280.679) (-277.812) (-278.018) [-279.223] * (-277.374) (-278.307) (-277.580) [-277.231] -- 0:00:16
725000 -- (-277.946) (-277.418) [-278.222] (-283.030) * (-277.354) (-278.844) (-281.784) [-278.289] -- 0:00:16
Average standard deviation of split frequencies: 0.009969
725500 -- (-279.565) (-280.486) (-282.162) [-277.272] * (-280.125) (-279.753) (-279.052) [-278.840] -- 0:00:16
726000 -- (-278.801) (-277.036) (-277.014) [-276.782] * (-281.830) (-280.387) (-277.684) [-281.660] -- 0:00:16
726500 -- [-276.910] (-278.397) (-278.273) (-277.111) * (-280.187) [-277.478] (-278.311) (-277.826) -- 0:00:16
727000 -- (-278.092) [-278.918] (-277.492) (-278.398) * (-279.949) (-278.080) [-277.247] (-278.139) -- 0:00:16
727500 -- (-277.275) (-281.446) (-278.352) [-281.886] * (-283.179) (-280.334) [-277.392] (-278.131) -- 0:00:16
728000 -- [-279.123] (-279.561) (-277.508) (-278.080) * (-276.865) (-280.572) (-277.134) [-278.023] -- 0:00:16
728500 -- (-278.244) [-277.365] (-281.732) (-277.506) * (-276.715) (-278.201) [-277.503] (-278.028) -- 0:00:16
729000 -- (-277.835) (-277.210) [-279.805] (-277.147) * (-281.283) (-276.872) (-282.612) [-279.058] -- 0:00:15
729500 -- (-276.487) (-277.518) (-276.449) [-279.989] * (-283.284) (-278.370) (-279.539) [-276.771] -- 0:00:15
730000 -- (-276.509) [-277.167] (-281.812) (-281.340) * (-277.972) (-280.586) (-278.077) [-278.880] -- 0:00:15
Average standard deviation of split frequencies: 0.009919
730500 -- [-278.511] (-277.235) (-280.880) (-279.110) * (-279.108) [-276.874] (-280.506) (-278.260) -- 0:00:15
731000 -- (-279.638) (-283.579) [-277.863] (-281.317) * (-288.427) [-278.737] (-278.841) (-278.278) -- 0:00:15
731500 -- (-279.621) (-280.933) [-279.336] (-281.209) * [-278.655] (-279.512) (-277.471) (-276.982) -- 0:00:15
732000 -- (-277.072) (-279.326) (-280.488) [-281.638] * [-277.157] (-280.256) (-278.708) (-276.595) -- 0:00:15
732500 -- [-279.734] (-277.762) (-282.238) (-282.529) * (-278.279) [-279.762] (-279.480) (-277.661) -- 0:00:15
733000 -- [-277.728] (-277.270) (-280.120) (-279.158) * (-276.627) (-281.320) (-283.110) [-276.827] -- 0:00:15
733500 -- (-280.112) (-278.743) [-277.860] (-278.727) * (-277.894) (-281.993) [-280.309] (-278.453) -- 0:00:15
734000 -- (-281.253) [-278.082] (-278.839) (-276.769) * [-276.699] (-281.966) (-278.990) (-277.895) -- 0:00:15
734500 -- [-277.387] (-278.635) (-280.416) (-277.262) * [-276.885] (-282.266) (-279.319) (-280.559) -- 0:00:15
735000 -- (-277.256) (-278.992) [-278.771] (-279.144) * (-278.572) (-276.358) [-279.468] (-279.808) -- 0:00:15
Average standard deviation of split frequencies: 0.009768
735500 -- (-284.116) (-282.631) (-278.691) [-277.299] * (-277.568) (-276.665) [-277.864] (-281.708) -- 0:00:15
736000 -- (-279.870) (-278.753) (-279.317) [-276.985] * (-277.416) (-277.404) (-279.679) [-281.084] -- 0:00:15
736500 -- (-279.601) [-281.848] (-282.159) (-279.306) * (-276.646) (-277.508) (-280.478) [-278.730] -- 0:00:15
737000 -- (-278.661) (-277.662) [-276.789] (-276.728) * (-278.125) [-276.695] (-277.227) (-277.827) -- 0:00:15
737500 -- (-280.403) [-278.299] (-280.932) (-277.221) * (-277.178) [-277.513] (-278.446) (-279.267) -- 0:00:15
738000 -- (-280.594) (-276.972) (-280.329) [-278.493] * [-279.579] (-280.012) (-277.080) (-279.326) -- 0:00:15
738500 -- (-277.401) [-277.742] (-277.152) (-277.543) * (-278.868) (-279.727) [-278.752] (-282.505) -- 0:00:15
739000 -- [-278.963] (-279.888) (-277.775) (-279.700) * (-278.042) [-279.034] (-281.322) (-281.091) -- 0:00:15
739500 -- (-278.914) (-277.145) (-277.961) [-278.984] * (-277.063) (-280.061) (-279.019) [-280.233] -- 0:00:15
740000 -- (-278.380) (-278.990) [-283.671] (-280.393) * [-278.874] (-279.825) (-277.843) (-281.670) -- 0:00:15
Average standard deviation of split frequencies: 0.009666
740500 -- (-280.771) (-282.092) [-277.554] (-277.689) * (-279.047) (-283.968) [-277.448] (-279.017) -- 0:00:15
741000 -- (-280.004) (-279.305) (-277.727) [-279.127] * (-277.046) [-279.461] (-277.326) (-279.075) -- 0:00:15
741500 -- (-281.076) [-279.498] (-281.196) (-277.096) * (-277.427) (-278.966) [-282.334] (-277.171) -- 0:00:15
742000 -- [-278.513] (-280.199) (-277.130) (-278.781) * (-279.410) (-280.004) [-279.508] (-278.485) -- 0:00:15
742500 -- [-277.938] (-277.390) (-279.443) (-279.408) * (-279.731) [-279.753] (-280.399) (-278.833) -- 0:00:15
743000 -- [-279.314] (-278.648) (-279.933) (-278.673) * (-279.117) [-278.364] (-285.026) (-284.048) -- 0:00:15
743500 -- (-276.940) (-277.600) (-280.216) [-279.442] * (-276.823) (-279.981) [-276.957] (-281.983) -- 0:00:15
744000 -- (-278.498) (-278.279) (-280.598) [-280.634] * (-276.682) (-278.491) (-278.734) [-279.421] -- 0:00:15
744500 -- (-280.338) (-278.974) (-279.920) [-278.734] * (-279.582) (-277.572) (-281.706) [-276.688] -- 0:00:15
745000 -- (-279.165) (-278.840) (-282.314) [-276.900] * (-281.466) (-278.603) (-277.260) [-280.158] -- 0:00:15
Average standard deviation of split frequencies: 0.010427
745500 -- [-278.445] (-278.233) (-278.930) (-278.030) * (-279.198) (-277.015) [-278.518] (-282.252) -- 0:00:15
746000 -- (-278.406) (-279.071) (-277.855) [-280.391] * (-279.059) (-281.611) [-276.958] (-280.298) -- 0:00:14
746500 -- (-279.334) [-277.586] (-278.446) (-277.307) * (-278.386) (-279.461) [-278.473] (-277.724) -- 0:00:14
747000 -- (-279.564) [-278.414] (-281.177) (-277.877) * (-278.513) (-280.428) (-277.200) [-278.731] -- 0:00:14
747500 -- (-276.590) [-278.394] (-277.794) (-278.712) * (-278.110) (-279.808) (-277.440) [-280.057] -- 0:00:14
748000 -- (-279.392) (-278.056) [-277.989] (-277.030) * (-281.212) (-278.351) (-277.412) [-277.428] -- 0:00:14
748500 -- [-276.849] (-279.899) (-280.037) (-283.176) * (-277.038) (-278.056) [-277.352] (-277.747) -- 0:00:14
749000 -- (-278.922) (-278.797) (-280.235) [-279.426] * (-276.873) (-277.372) [-278.916] (-279.182) -- 0:00:14
749500 -- (-279.069) (-278.611) (-278.601) [-279.311] * (-277.291) [-277.615] (-278.769) (-279.290) -- 0:00:14
750000 -- (-278.938) (-283.825) (-279.287) [-277.761] * (-277.543) (-278.936) (-279.099) [-277.518] -- 0:00:14
Average standard deviation of split frequencies: 0.010833
750500 -- (-280.119) (-276.772) [-279.539] (-278.006) * [-277.823] (-283.988) (-277.034) (-280.922) -- 0:00:14
751000 -- (-278.732) (-277.057) (-280.244) [-276.843] * (-281.159) (-279.372) (-277.284) [-279.216] -- 0:00:14
751500 -- (-277.763) (-285.017) [-278.578] (-279.384) * (-277.550) [-280.622] (-278.995) (-277.168) -- 0:00:14
752000 -- (-280.618) (-280.981) [-278.355] (-283.622) * (-281.495) [-277.977] (-277.940) (-279.232) -- 0:00:14
752500 -- (-279.080) (-279.289) [-278.500] (-278.086) * (-281.521) (-279.547) (-277.726) [-276.802] -- 0:00:14
753000 -- (-280.320) [-280.730] (-277.954) (-278.604) * (-279.663) (-278.184) (-283.987) [-276.638] -- 0:00:14
753500 -- (-279.193) (-277.790) [-278.277] (-277.389) * (-279.663) [-278.166] (-284.673) (-279.931) -- 0:00:14
754000 -- (-282.658) (-278.788) (-277.990) [-279.602] * (-276.597) (-277.968) [-278.026] (-279.207) -- 0:00:14
754500 -- (-279.596) (-277.818) [-276.262] (-282.268) * [-278.636] (-280.740) (-278.105) (-279.904) -- 0:00:14
755000 -- [-278.335] (-277.842) (-278.383) (-279.502) * (-281.067) (-279.265) (-277.144) [-277.687] -- 0:00:14
Average standard deviation of split frequencies: 0.010678
755500 -- [-280.012] (-276.778) (-277.056) (-281.137) * [-276.954] (-281.793) (-277.011) (-277.798) -- 0:00:14
756000 -- (-277.843) (-279.373) (-278.884) [-280.087] * (-284.316) (-279.038) (-278.823) [-278.008] -- 0:00:14
756500 -- (-277.357) (-279.727) [-280.258] (-277.592) * [-279.529] (-281.831) (-278.126) (-278.383) -- 0:00:14
757000 -- (-279.528) (-280.558) [-277.476] (-279.589) * (-278.624) (-279.786) [-279.008] (-276.979) -- 0:00:14
757500 -- [-278.865] (-278.480) (-277.142) (-277.408) * [-279.937] (-277.950) (-279.751) (-279.295) -- 0:00:14
758000 -- (-277.045) [-279.102] (-276.955) (-282.158) * [-277.035] (-278.419) (-278.452) (-280.169) -- 0:00:14
758500 -- (-278.375) [-278.652] (-276.526) (-280.107) * [-277.102] (-278.493) (-281.235) (-279.246) -- 0:00:14
759000 -- (-278.092) (-279.865) [-277.643] (-278.826) * (-276.859) (-278.499) [-278.031] (-278.112) -- 0:00:14
759500 -- (-279.757) (-277.410) [-277.992] (-280.379) * (-280.160) (-277.728) [-277.171] (-278.238) -- 0:00:14
760000 -- (-278.107) [-276.962] (-278.294) (-278.249) * (-279.177) [-278.982] (-280.873) (-276.684) -- 0:00:14
Average standard deviation of split frequencies: 0.010264
760500 -- [-277.386] (-290.415) (-277.800) (-279.434) * (-279.818) (-280.869) [-277.119] (-277.252) -- 0:00:14
761000 -- (-276.561) [-278.609] (-281.527) (-278.354) * (-278.586) (-285.020) [-281.459] (-278.820) -- 0:00:14
761500 -- (-279.323) (-277.307) [-277.734] (-280.814) * (-277.690) (-281.791) [-278.904] (-276.976) -- 0:00:14
762000 -- (-277.192) (-278.999) [-276.823] (-276.443) * (-279.806) [-282.703] (-277.883) (-282.753) -- 0:00:14
762500 -- (-282.972) [-280.590] (-279.134) (-277.134) * (-282.223) [-281.353] (-277.106) (-280.690) -- 0:00:14
763000 -- (-279.330) (-282.028) (-278.952) [-279.232] * (-280.776) (-280.914) [-278.568] (-279.009) -- 0:00:13
763500 -- (-280.173) (-282.600) (-280.278) [-276.755] * (-281.030) [-278.787] (-277.757) (-280.242) -- 0:00:13
764000 -- [-277.754] (-283.979) (-277.793) (-280.492) * (-277.985) (-279.910) [-278.702] (-277.539) -- 0:00:13
764500 -- (-281.407) (-280.290) [-277.794] (-279.419) * (-278.312) (-278.163) (-281.347) [-277.579] -- 0:00:13
765000 -- [-278.694] (-283.643) (-277.004) (-278.234) * (-277.403) [-277.724] (-281.489) (-278.633) -- 0:00:13
Average standard deviation of split frequencies: 0.010626
765500 -- (-277.811) (-278.602) (-276.842) [-277.217] * (-280.686) (-277.453) (-277.834) [-277.304] -- 0:00:13
766000 -- [-278.229] (-280.414) (-279.626) (-278.916) * (-278.725) [-277.905] (-283.036) (-279.343) -- 0:00:13
766500 -- (-278.506) (-278.448) [-276.930] (-278.240) * (-277.261) [-278.530] (-281.177) (-280.476) -- 0:00:13
767000 -- [-277.736] (-277.706) (-280.959) (-277.431) * (-278.823) [-276.236] (-281.585) (-277.875) -- 0:00:13
767500 -- (-279.255) (-278.367) (-281.182) [-277.790] * (-279.030) [-277.107] (-279.670) (-276.678) -- 0:00:13
768000 -- (-281.056) (-278.175) [-277.471] (-279.417) * [-281.472] (-277.752) (-281.322) (-278.591) -- 0:00:13
768500 -- (-282.839) (-280.845) [-277.943] (-279.417) * (-279.011) (-277.763) [-277.390] (-277.105) -- 0:00:13
769000 -- (-278.412) [-277.866] (-278.216) (-278.318) * (-277.159) (-279.026) (-278.918) [-277.504] -- 0:00:13
769500 -- (-280.285) (-278.251) (-279.625) [-277.053] * (-277.848) (-277.998) [-281.630] (-279.832) -- 0:00:13
770000 -- (-280.215) (-278.852) (-279.657) [-277.656] * (-279.748) [-278.299] (-276.748) (-280.540) -- 0:00:13
Average standard deviation of split frequencies: 0.010236
770500 -- (-278.816) [-279.264] (-281.084) (-277.456) * (-279.025) (-277.640) (-277.421) [-278.188] -- 0:00:13
771000 -- (-278.730) (-278.595) [-277.283] (-278.042) * (-276.801) (-278.715) [-279.215] (-280.681) -- 0:00:13
771500 -- (-280.777) (-277.438) [-279.333] (-280.286) * (-278.333) (-278.496) [-278.768] (-280.302) -- 0:00:13
772000 -- (-282.434) (-278.249) [-279.662] (-281.157) * (-281.080) [-281.249] (-279.396) (-279.082) -- 0:00:13
772500 -- (-280.422) (-278.733) [-279.217] (-288.153) * (-279.203) (-283.683) (-277.679) [-278.163] -- 0:00:13
773000 -- [-278.826] (-279.180) (-279.579) (-279.434) * [-276.617] (-280.755) (-278.000) (-279.312) -- 0:00:13
773500 -- [-278.354] (-280.713) (-280.459) (-278.666) * (-278.275) (-280.240) [-280.054] (-278.970) -- 0:00:13
774000 -- (-280.597) (-279.012) [-277.615] (-277.791) * [-279.094] (-281.120) (-279.507) (-279.175) -- 0:00:13
774500 -- (-278.493) (-281.095) (-277.464) [-279.564] * [-281.085] (-277.435) (-279.694) (-278.890) -- 0:00:13
775000 -- (-282.762) [-277.378] (-280.280) (-278.996) * [-280.586] (-277.245) (-277.432) (-278.746) -- 0:00:13
Average standard deviation of split frequencies: 0.010287
775500 -- [-276.967] (-277.910) (-278.689) (-279.484) * (-278.340) (-278.961) (-277.995) [-277.641] -- 0:00:13
776000 -- (-277.168) (-280.732) [-280.395] (-278.552) * (-280.385) (-276.560) (-281.547) [-277.799] -- 0:00:13
776500 -- [-277.270] (-278.692) (-279.471) (-277.688) * (-281.371) (-278.554) (-279.297) [-277.512] -- 0:00:13
777000 -- [-276.507] (-278.437) (-277.509) (-277.916) * [-279.581] (-278.337) (-280.437) (-276.878) -- 0:00:13
777500 -- (-278.809) (-281.692) (-277.506) [-278.291] * (-278.037) (-279.397) (-281.369) [-282.662] -- 0:00:13
778000 -- (-279.040) (-282.084) [-279.036] (-279.777) * (-278.592) [-277.569] (-279.153) (-279.389) -- 0:00:13
778500 -- [-276.997] (-278.099) (-278.984) (-278.549) * [-276.460] (-280.495) (-277.547) (-276.720) -- 0:00:13
779000 -- (-280.829) (-279.710) (-279.177) [-281.945] * [-277.900] (-277.776) (-278.245) (-280.524) -- 0:00:13
779500 -- (-277.905) (-277.234) (-278.608) [-278.076] * (-283.416) (-277.282) [-276.703] (-277.301) -- 0:00:13
780000 -- (-281.816) [-279.903] (-276.851) (-278.240) * (-277.832) [-279.305] (-278.900) (-278.379) -- 0:00:12
Average standard deviation of split frequencies: 0.010190
780500 -- [-276.696] (-278.860) (-277.692) (-277.156) * (-279.724) [-277.639] (-278.413) (-278.284) -- 0:00:12
781000 -- [-278.768] (-278.262) (-278.429) (-276.945) * (-279.656) (-278.302) (-280.291) [-278.868] -- 0:00:12
781500 -- [-280.348] (-280.631) (-280.644) (-277.488) * (-280.101) (-278.773) [-280.947] (-279.171) -- 0:00:12
782000 -- (-281.662) (-282.349) [-277.477] (-278.672) * (-277.537) (-277.050) (-280.910) [-277.741] -- 0:00:12
782500 -- [-278.521] (-276.930) (-279.387) (-277.970) * (-278.515) (-276.493) (-279.572) [-281.474] -- 0:00:12
783000 -- (-277.347) (-278.812) [-278.806] (-277.808) * (-278.823) (-276.276) [-278.363] (-278.977) -- 0:00:12
783500 -- (-281.160) (-279.149) [-278.510] (-279.633) * (-279.675) (-279.616) (-279.381) [-283.031] -- 0:00:12
784000 -- (-277.377) (-279.253) (-277.424) [-278.866] * (-279.163) [-279.264] (-278.245) (-279.604) -- 0:00:12
784500 -- (-280.801) [-280.442] (-278.535) (-278.751) * (-277.569) [-277.485] (-279.180) (-280.388) -- 0:00:12
785000 -- [-277.645] (-277.180) (-277.530) (-278.429) * (-277.838) [-279.728] (-278.544) (-281.820) -- 0:00:12
Average standard deviation of split frequencies: 0.010046
785500 -- (-279.867) [-277.778] (-279.919) (-277.755) * (-277.097) [-277.293] (-277.869) (-279.865) -- 0:00:12
786000 -- (-280.545) (-282.799) [-277.140] (-277.988) * [-277.011] (-277.389) (-277.417) (-279.682) -- 0:00:12
786500 -- (-277.729) [-278.860] (-277.864) (-279.423) * (-282.357) (-278.360) (-279.365) [-278.246] -- 0:00:12
787000 -- [-277.929] (-278.808) (-277.901) (-280.396) * [-280.106] (-280.257) (-278.263) (-283.181) -- 0:00:12
787500 -- (-277.151) (-281.835) (-279.697) [-280.456] * (-277.925) (-281.463) (-277.837) [-277.329] -- 0:00:12
788000 -- (-280.288) (-278.959) (-283.044) [-279.100] * (-282.601) (-279.217) (-278.827) [-276.555] -- 0:00:12
788500 -- (-279.798) (-281.723) (-282.278) [-280.709] * (-277.802) (-283.047) (-277.043) [-277.391] -- 0:00:12
789000 -- [-279.633] (-281.085) (-284.481) (-279.064) * (-277.411) (-282.613) (-278.810) [-279.938] -- 0:00:12
789500 -- [-279.982] (-281.619) (-283.265) (-280.224) * [-279.188] (-279.787) (-279.929) (-278.859) -- 0:00:12
790000 -- [-276.929] (-277.818) (-277.590) (-277.993) * [-285.270] (-280.407) (-277.453) (-278.786) -- 0:00:12
Average standard deviation of split frequencies: 0.010295
790500 -- (-276.883) (-276.979) [-276.647] (-277.429) * (-281.986) [-278.078] (-278.541) (-278.224) -- 0:00:12
791000 -- (-278.974) (-279.264) [-277.114] (-280.247) * (-279.981) (-281.495) (-278.010) [-281.464] -- 0:00:12
791500 -- (-281.776) (-279.662) [-276.695] (-281.355) * (-279.237) (-278.050) [-277.268] (-278.627) -- 0:00:12
792000 -- (-279.968) [-278.415] (-278.051) (-278.919) * (-282.748) (-277.333) (-282.977) [-278.203] -- 0:00:12
792500 -- (-284.112) [-278.302] (-278.963) (-279.198) * [-278.131] (-277.617) (-280.532) (-278.233) -- 0:00:12
793000 -- (-278.420) [-277.944] (-276.598) (-279.357) * (-282.243) (-277.513) [-280.032] (-280.905) -- 0:00:12
793500 -- (-282.438) [-280.251] (-276.629) (-280.539) * (-277.953) (-284.778) [-280.891] (-277.654) -- 0:00:12
794000 -- (-278.929) [-278.321] (-277.913) (-280.669) * (-279.123) (-283.558) (-282.346) [-279.203] -- 0:00:12
794500 -- (-279.046) (-277.585) [-276.533] (-281.108) * [-279.571] (-277.534) (-279.487) (-279.572) -- 0:00:12
795000 -- (-276.538) [-278.778] (-278.518) (-281.977) * (-279.367) (-277.430) (-284.302) [-278.259] -- 0:00:12
Average standard deviation of split frequencies: 0.010344
795500 -- (-277.557) (-279.275) [-280.361] (-278.679) * (-277.476) (-281.798) [-278.240] (-278.333) -- 0:00:12
796000 -- [-277.801] (-279.155) (-279.911) (-285.512) * (-277.787) (-279.561) [-277.185] (-280.567) -- 0:00:12
796500 -- (-281.299) [-277.438] (-279.740) (-281.266) * [-277.335] (-281.370) (-278.780) (-278.636) -- 0:00:12
797000 -- (-281.453) (-278.692) [-277.682] (-279.676) * (-279.494) (-277.436) (-280.658) [-278.381] -- 0:00:11
797500 -- [-277.447] (-279.457) (-280.617) (-278.872) * (-279.497) [-277.098] (-280.876) (-279.670) -- 0:00:11
798000 -- [-276.922] (-281.738) (-281.545) (-277.921) * [-278.990] (-276.723) (-277.275) (-277.947) -- 0:00:11
798500 -- (-277.657) (-281.058) [-278.268] (-277.548) * [-276.664] (-277.767) (-276.536) (-279.904) -- 0:00:11
799000 -- [-277.574] (-279.686) (-278.982) (-278.002) * (-277.581) (-278.319) (-277.979) [-278.491] -- 0:00:11
799500 -- (-277.938) [-277.335] (-278.871) (-279.370) * (-279.896) [-277.926] (-279.769) (-277.333) -- 0:00:11
800000 -- (-278.192) (-279.888) [-278.926] (-278.338) * [-281.294] (-278.990) (-276.854) (-280.460) -- 0:00:11
Average standard deviation of split frequencies: 0.009773
800500 -- (-276.847) (-280.005) [-280.937] (-278.366) * [-277.601] (-278.455) (-277.786) (-278.651) -- 0:00:11
801000 -- [-278.763] (-278.288) (-277.529) (-278.260) * [-277.395] (-280.719) (-277.164) (-278.484) -- 0:00:11
801500 -- [-280.914] (-278.155) (-278.414) (-277.248) * [-281.606] (-278.824) (-276.905) (-279.478) -- 0:00:11
802000 -- (-279.435) (-279.644) (-277.581) [-277.830] * (-279.457) (-278.505) [-279.664] (-279.105) -- 0:00:11
802500 -- (-281.901) [-279.857] (-277.971) (-280.120) * (-285.185) (-281.733) [-278.557] (-278.923) -- 0:00:11
803000 -- (-282.391) [-279.295] (-280.103) (-277.686) * (-283.693) (-279.643) (-280.686) [-278.090] -- 0:00:11
803500 -- [-280.934] (-279.468) (-279.840) (-276.691) * (-278.899) (-278.032) (-281.260) [-276.572] -- 0:00:11
804000 -- (-278.487) (-278.252) (-278.241) [-277.935] * (-279.214) [-277.417] (-278.542) (-279.615) -- 0:00:11
804500 -- (-277.242) [-280.706] (-277.739) (-283.353) * (-277.459) (-276.845) [-278.030] (-280.878) -- 0:00:11
805000 -- (-277.202) (-280.549) [-278.492] (-277.317) * (-276.877) (-278.168) [-278.896] (-284.333) -- 0:00:11
Average standard deviation of split frequencies: 0.009358
805500 -- (-280.850) (-280.429) [-279.119] (-280.708) * (-277.617) (-278.543) [-277.003] (-277.276) -- 0:00:11
806000 -- [-279.320] (-279.381) (-279.623) (-277.800) * [-278.183] (-276.950) (-277.732) (-276.778) -- 0:00:11
806500 -- (-279.196) [-277.788] (-279.304) (-276.831) * (-277.775) (-276.758) [-279.332] (-277.617) -- 0:00:11
807000 -- [-277.541] (-280.997) (-277.280) (-277.245) * (-278.538) (-280.981) (-278.800) [-276.880] -- 0:00:11
807500 -- (-279.991) [-277.432] (-279.231) (-278.557) * (-278.467) (-276.633) [-277.696] (-277.177) -- 0:00:11
808000 -- (-278.701) (-278.318) [-281.056] (-279.115) * (-278.339) (-277.988) (-278.117) [-277.290] -- 0:00:11
808500 -- (-278.024) (-276.684) [-277.496] (-278.056) * (-279.364) [-279.220] (-279.880) (-277.210) -- 0:00:11
809000 -- (-276.797) (-277.997) [-278.593] (-281.444) * (-277.813) (-278.014) [-278.476] (-277.934) -- 0:00:11
809500 -- [-278.091] (-280.474) (-281.431) (-277.804) * (-277.946) (-276.438) (-283.641) [-279.143] -- 0:00:11
810000 -- (-277.780) (-279.967) [-280.521] (-278.386) * [-277.204] (-278.766) (-284.385) (-281.959) -- 0:00:11
Average standard deviation of split frequencies: 0.010002
810500 -- (-281.315) (-278.045) (-277.805) [-277.281] * (-276.341) (-278.262) (-283.682) [-277.845] -- 0:00:11
811000 -- [-279.299] (-277.718) (-277.091) (-279.556) * (-276.468) (-278.529) [-279.396] (-278.868) -- 0:00:11
811500 -- (-278.998) (-278.715) [-277.902] (-279.773) * (-277.801) [-279.184] (-278.409) (-279.917) -- 0:00:11
812000 -- (-281.940) (-281.369) [-279.757] (-284.042) * [-282.245] (-278.995) (-276.586) (-278.327) -- 0:00:11
812500 -- (-283.091) [-280.798] (-280.755) (-279.313) * (-277.163) (-278.421) (-277.387) [-277.233] -- 0:00:11
813000 -- [-279.449] (-278.793) (-279.599) (-278.631) * (-281.327) [-280.791] (-278.981) (-279.475) -- 0:00:11
813500 -- [-278.532] (-278.665) (-279.056) (-279.042) * (-276.899) [-279.519] (-279.160) (-280.699) -- 0:00:11
814000 -- (-287.400) (-279.930) (-279.440) [-278.002] * (-277.011) [-281.902] (-277.872) (-279.154) -- 0:00:10
814500 -- (-278.634) (-277.166) (-280.646) [-278.021] * (-280.151) (-281.593) (-279.403) [-280.478] -- 0:00:10
815000 -- (-279.997) (-277.248) [-279.195] (-278.212) * (-282.019) [-278.149] (-279.363) (-281.003) -- 0:00:10
Average standard deviation of split frequencies: 0.010399
815500 -- (-278.879) [-280.397] (-276.939) (-280.260) * (-283.079) [-280.285] (-277.483) (-280.083) -- 0:00:10
816000 -- (-277.168) (-278.567) (-280.063) [-279.675] * [-280.434] (-281.282) (-279.647) (-281.977) -- 0:00:10
816500 -- (-278.908) [-277.849] (-278.169) (-283.546) * [-278.300] (-278.174) (-281.127) (-280.976) -- 0:00:10
817000 -- (-277.276) (-280.110) (-281.144) [-278.074] * (-280.690) (-280.048) (-278.394) [-281.152] -- 0:00:10
817500 -- (-277.331) [-276.921] (-277.511) (-278.256) * (-282.325) (-276.736) [-280.585] (-278.228) -- 0:00:10
818000 -- (-279.751) (-281.117) (-280.263) [-276.834] * (-279.965) [-277.123] (-278.148) (-277.709) -- 0:00:10
818500 -- (-280.007) [-280.858] (-278.786) (-277.260) * (-277.639) [-276.333] (-280.397) (-279.178) -- 0:00:10
819000 -- (-278.159) (-280.682) [-279.693] (-278.863) * (-279.446) (-277.903) [-278.298] (-277.828) -- 0:00:10
819500 -- (-279.971) (-279.447) (-279.800) [-280.099] * (-278.045) [-276.848] (-279.009) (-278.615) -- 0:00:10
820000 -- [-279.038] (-280.371) (-278.227) (-281.904) * (-276.690) (-280.249) (-277.881) [-279.541] -- 0:00:10
Average standard deviation of split frequencies: 0.010416
820500 -- (-277.588) (-280.672) [-277.208] (-282.739) * (-281.515) (-278.781) [-276.641] (-280.715) -- 0:00:10
821000 -- (-281.428) [-279.912] (-284.736) (-282.798) * (-276.550) (-280.359) (-276.623) [-277.355] -- 0:00:10
821500 -- [-280.062] (-277.712) (-278.523) (-279.351) * [-280.184] (-280.068) (-278.461) (-281.057) -- 0:00:10
822000 -- (-280.490) (-278.951) (-278.264) [-278.965] * [-279.018] (-280.445) (-278.359) (-277.442) -- 0:00:10
822500 -- (-283.467) (-280.865) [-279.817] (-276.675) * (-276.813) [-279.339] (-281.608) (-279.747) -- 0:00:10
823000 -- [-280.857] (-280.606) (-277.034) (-280.240) * [-279.376] (-278.302) (-283.706) (-277.032) -- 0:00:10
823500 -- (-277.614) [-279.175] (-279.698) (-278.696) * (-276.916) [-277.704] (-276.779) (-276.988) -- 0:00:10
824000 -- (-278.980) (-279.025) [-278.343] (-287.449) * (-277.042) (-279.670) [-276.640] (-277.568) -- 0:00:10
824500 -- (-281.033) (-278.979) [-276.580] (-277.298) * (-278.018) (-278.076) [-276.980] (-280.772) -- 0:00:10
825000 -- [-277.352] (-276.514) (-277.453) (-276.647) * (-279.381) [-276.871] (-282.484) (-277.245) -- 0:00:10
Average standard deviation of split frequencies: 0.010273
825500 -- (-277.990) (-283.525) (-281.677) [-277.739] * (-280.556) (-283.079) [-279.419] (-277.936) -- 0:00:10
826000 -- (-279.587) (-276.520) [-279.760] (-278.050) * (-281.786) (-279.760) (-278.001) [-277.352] -- 0:00:10
826500 -- (-276.927) (-277.723) (-277.934) [-278.194] * (-278.010) [-277.801] (-279.923) (-281.394) -- 0:00:10
827000 -- (-276.619) [-277.197] (-280.679) (-276.616) * (-278.828) (-276.877) [-280.652] (-277.862) -- 0:00:10
827500 -- (-277.812) [-279.170] (-279.686) (-279.152) * [-278.902] (-279.032) (-281.760) (-278.626) -- 0:00:10
828000 -- (-278.101) (-278.574) (-280.480) [-278.863] * [-278.395] (-277.510) (-276.802) (-279.376) -- 0:00:10
828500 -- (-278.748) (-277.141) (-277.252) [-278.250] * (-279.852) [-277.094] (-279.528) (-278.383) -- 0:00:10
829000 -- (-281.935) [-280.434] (-278.776) (-278.053) * (-282.070) (-276.634) [-281.553] (-278.342) -- 0:00:10
829500 -- (-279.827) [-279.328] (-280.598) (-277.146) * (-285.792) [-276.885] (-280.984) (-277.727) -- 0:00:10
830000 -- (-278.104) [-280.912] (-280.189) (-278.410) * [-277.548] (-277.553) (-280.268) (-278.912) -- 0:00:10
Average standard deviation of split frequencies: 0.009761
830500 -- (-277.785) [-285.186] (-277.805) (-278.218) * [-277.208] (-282.620) (-283.662) (-278.058) -- 0:00:10
831000 -- (-277.367) (-278.175) (-279.211) [-281.893] * (-278.343) (-280.098) [-280.314] (-277.648) -- 0:00:09
831500 -- (-278.800) [-281.136] (-277.824) (-278.921) * [-277.691] (-277.220) (-280.215) (-279.843) -- 0:00:09
832000 -- (-279.705) [-281.691] (-278.056) (-278.720) * (-281.683) [-278.653] (-281.661) (-283.735) -- 0:00:09
832500 -- (-278.137) [-278.282] (-279.070) (-281.959) * (-284.998) (-283.141) (-280.175) [-281.514] -- 0:00:09
833000 -- [-277.115] (-278.972) (-277.124) (-278.621) * [-278.017] (-279.021) (-279.876) (-279.682) -- 0:00:09
833500 -- [-277.986] (-280.737) (-277.737) (-279.214) * (-278.340) (-277.943) [-282.477] (-277.263) -- 0:00:09
834000 -- (-279.074) (-280.389) (-276.459) [-277.175] * (-278.699) [-279.156] (-282.961) (-277.360) -- 0:00:09
834500 -- [-277.479] (-278.967) (-279.297) (-276.595) * (-278.543) (-285.147) [-277.961] (-278.179) -- 0:00:09
835000 -- (-277.435) (-278.046) (-278.783) [-278.007] * [-277.474] (-279.788) (-279.052) (-279.029) -- 0:00:09
Average standard deviation of split frequencies: 0.009699
835500 -- [-276.947] (-279.332) (-278.720) (-278.449) * (-278.792) (-281.694) (-277.324) [-279.424] -- 0:00:09
836000 -- (-278.428) [-278.452] (-276.790) (-279.658) * (-278.542) (-278.536) (-277.132) [-278.135] -- 0:00:09
836500 -- (-278.412) [-281.235] (-278.548) (-277.390) * [-276.847] (-277.341) (-280.495) (-279.428) -- 0:00:09
837000 -- (-277.096) (-278.065) [-277.792] (-279.578) * (-279.687) [-277.228] (-279.540) (-277.650) -- 0:00:09
837500 -- (-282.608) (-279.042) [-277.209] (-277.935) * (-279.621) (-277.283) (-279.656) [-277.477] -- 0:00:09
838000 -- (-280.065) (-278.283) (-279.560) [-280.836] * [-278.020] (-277.840) (-279.896) (-277.629) -- 0:00:09
838500 -- [-277.841] (-277.745) (-277.839) (-277.190) * [-278.220] (-277.449) (-283.123) (-278.846) -- 0:00:09
839000 -- (-278.689) (-278.372) (-277.669) [-277.053] * [-279.045] (-277.112) (-278.409) (-279.072) -- 0:00:09
839500 -- (-277.747) (-277.108) (-278.698) [-279.554] * (-279.658) [-277.690] (-279.850) (-278.143) -- 0:00:09
840000 -- (-277.173) (-277.599) [-281.603] (-279.620) * [-277.960] (-278.546) (-278.826) (-282.322) -- 0:00:09
Average standard deviation of split frequencies: 0.009383
840500 -- (-279.999) [-277.950] (-279.743) (-280.378) * (-277.800) (-278.435) (-277.096) [-279.452] -- 0:00:09
841000 -- [-277.219] (-278.700) (-282.339) (-277.716) * (-282.868) (-280.305) (-278.209) [-280.364] -- 0:00:09
841500 -- (-277.640) (-282.651) [-281.608] (-277.947) * [-278.843] (-278.227) (-278.118) (-278.149) -- 0:00:09
842000 -- (-277.816) (-282.918) (-281.396) [-280.032] * (-280.587) [-276.484] (-287.791) (-280.848) -- 0:00:09
842500 -- (-277.449) (-279.881) (-287.850) [-279.976] * (-278.049) [-277.362] (-279.348) (-279.482) -- 0:00:09
843000 -- [-281.029] (-280.079) (-281.263) (-279.402) * (-278.797) [-279.226] (-279.039) (-284.184) -- 0:00:09
843500 -- (-281.125) (-279.292) (-280.977) [-277.550] * (-279.355) (-280.847) [-277.952] (-281.246) -- 0:00:09
844000 -- [-277.473] (-281.331) (-277.912) (-277.826) * (-279.310) [-276.987] (-276.534) (-278.813) -- 0:00:09
844500 -- (-278.179) [-283.388] (-278.286) (-276.661) * (-277.041) [-278.787] (-279.754) (-278.821) -- 0:00:09
845000 -- (-277.364) (-280.185) (-277.765) [-279.068] * (-282.008) [-278.670] (-277.818) (-279.584) -- 0:00:09
Average standard deviation of split frequencies: 0.009361
845500 -- [-277.294] (-280.275) (-277.896) (-277.361) * (-280.052) [-280.023] (-280.076) (-283.157) -- 0:00:09
846000 -- [-279.604] (-277.575) (-276.891) (-279.448) * [-280.871] (-277.632) (-277.277) (-278.551) -- 0:00:09
846500 -- (-277.950) (-277.200) [-279.825] (-278.105) * (-277.911) [-278.219] (-278.360) (-278.865) -- 0:00:09
847000 -- (-282.608) (-277.943) (-276.642) [-278.482] * (-278.510) [-278.752] (-277.562) (-278.377) -- 0:00:09
847500 -- (-282.727) [-277.401] (-278.074) (-279.577) * [-276.587] (-278.379) (-278.102) (-278.758) -- 0:00:08
848000 -- (-280.613) [-278.493] (-281.014) (-280.967) * (-277.395) (-278.119) [-277.461] (-281.848) -- 0:00:08
848500 -- (-280.125) (-277.937) (-276.896) [-281.041] * [-277.855] (-278.190) (-279.171) (-279.078) -- 0:00:08
849000 -- (-279.428) [-277.133] (-279.476) (-281.148) * (-278.265) [-282.003] (-276.474) (-279.790) -- 0:00:08
849500 -- (-279.767) (-278.831) [-278.021] (-278.767) * (-278.234) [-283.372] (-280.605) (-280.360) -- 0:00:08
850000 -- (-278.627) (-280.119) [-277.992] (-276.740) * (-277.767) (-281.928) (-277.035) [-277.154] -- 0:00:08
Average standard deviation of split frequencies: 0.009384
850500 -- [-276.864] (-278.391) (-279.932) (-278.926) * (-280.544) (-277.028) [-277.385] (-277.128) -- 0:00:08
851000 -- (-279.239) (-278.312) [-276.353] (-280.055) * (-281.596) (-277.434) (-283.481) [-277.594] -- 0:00:08
851500 -- [-278.653] (-279.079) (-285.981) (-278.512) * (-278.520) (-277.736) (-277.842) [-280.209] -- 0:00:08
852000 -- (-278.426) [-279.307] (-283.128) (-278.437) * (-281.570) [-278.050] (-278.432) (-279.503) -- 0:00:08
852500 -- [-282.601] (-277.975) (-277.351) (-281.627) * (-277.698) (-280.650) [-278.263] (-278.018) -- 0:00:08
853000 -- (-279.092) (-280.535) [-278.308] (-276.794) * (-277.758) (-280.224) (-281.238) [-277.694] -- 0:00:08
853500 -- (-277.407) [-278.163] (-280.033) (-281.613) * [-278.496] (-281.788) (-278.620) (-277.293) -- 0:00:08
854000 -- [-277.905] (-279.138) (-280.261) (-278.786) * [-280.262] (-278.152) (-278.274) (-279.709) -- 0:00:08
854500 -- (-280.161) [-279.368] (-277.172) (-279.539) * [-280.634] (-282.024) (-276.448) (-278.008) -- 0:00:08
855000 -- [-277.581] (-278.741) (-277.206) (-285.827) * (-280.570) (-282.098) (-277.074) [-278.173] -- 0:00:08
Average standard deviation of split frequencies: 0.009068
855500 -- [-282.378] (-278.157) (-279.586) (-276.587) * (-279.954) (-281.321) (-277.775) [-277.289] -- 0:00:08
856000 -- (-280.281) [-278.016] (-279.164) (-279.732) * (-277.251) [-280.608] (-279.777) (-277.758) -- 0:00:08
856500 -- (-277.701) [-277.719] (-277.358) (-278.906) * (-283.759) (-279.204) (-278.192) [-279.894] -- 0:00:08
857000 -- (-279.040) (-277.840) [-277.206] (-277.708) * (-279.891) (-278.189) (-279.690) [-277.072] -- 0:00:08
857500 -- (-278.614) (-277.530) [-277.694] (-278.162) * (-279.942) (-279.512) (-280.106) [-276.997] -- 0:00:08
858000 -- (-278.473) [-278.113] (-281.085) (-278.258) * (-276.728) (-280.280) [-279.343] (-277.991) -- 0:00:08
858500 -- [-277.567] (-277.032) (-279.718) (-279.642) * (-278.586) [-278.250] (-282.472) (-277.115) -- 0:00:08
859000 -- (-277.142) (-281.749) (-277.631) [-276.981] * [-280.610] (-279.333) (-282.520) (-277.480) -- 0:00:08
859500 -- (-277.982) (-278.819) [-276.927] (-279.718) * (-277.581) (-280.071) (-286.138) [-277.452] -- 0:00:08
860000 -- (-280.605) (-277.965) (-277.453) [-277.846] * (-277.085) (-282.133) (-280.352) [-278.438] -- 0:00:08
Average standard deviation of split frequencies: 0.008983
860500 -- [-277.096] (-277.463) (-277.098) (-280.434) * (-278.500) (-277.419) (-278.471) [-279.426] -- 0:00:08
861000 -- [-278.099] (-278.399) (-277.201) (-277.595) * (-278.490) [-281.850] (-276.895) (-284.167) -- 0:00:08
861500 -- (-279.745) (-279.100) [-277.836] (-279.953) * [-278.958] (-277.021) (-279.025) (-281.313) -- 0:00:08
862000 -- [-277.089] (-283.371) (-277.644) (-281.303) * (-277.955) (-276.996) [-277.761] (-280.224) -- 0:00:08
862500 -- (-282.328) (-278.836) (-280.311) [-278.085] * (-277.996) (-277.478) (-277.585) [-277.543] -- 0:00:08
863000 -- (-278.295) (-278.215) (-276.771) [-279.412] * [-277.897] (-276.853) (-277.925) (-279.051) -- 0:00:08
863500 -- (-280.445) (-276.930) [-277.763] (-278.370) * (-279.532) [-278.626] (-278.136) (-280.293) -- 0:00:08
864000 -- [-278.042] (-279.748) (-279.817) (-279.830) * (-282.039) (-279.100) (-278.041) [-278.367] -- 0:00:08
864500 -- [-276.475] (-280.955) (-280.857) (-279.852) * [-278.121] (-276.598) (-278.269) (-284.262) -- 0:00:07
865000 -- [-276.678] (-277.050) (-279.381) (-277.385) * [-276.814] (-277.838) (-278.435) (-279.202) -- 0:00:07
Average standard deviation of split frequencies: 0.008528
865500 -- (-278.346) (-277.666) (-278.705) [-277.687] * (-280.592) (-278.755) [-278.894] (-280.898) -- 0:00:07
866000 -- (-278.705) (-282.116) (-279.283) [-279.568] * (-277.034) (-283.730) (-277.384) [-277.150] -- 0:00:07
866500 -- (-277.460) (-280.676) [-282.266] (-278.689) * (-277.241) [-276.670] (-281.849) (-280.310) -- 0:00:07
867000 -- (-276.609) (-277.956) (-277.263) [-281.753] * (-277.432) (-277.858) [-278.091] (-279.254) -- 0:00:07
867500 -- (-277.729) (-277.255) (-278.411) [-277.900] * (-279.340) (-281.486) [-281.320] (-278.198) -- 0:00:07
868000 -- (-278.458) (-277.779) [-279.544] (-278.068) * (-278.026) (-281.826) (-280.502) [-280.263] -- 0:00:07
868500 -- [-278.964] (-277.137) (-280.631) (-277.819) * [-278.774] (-279.423) (-277.305) (-279.324) -- 0:00:07
869000 -- (-277.857) [-277.413] (-281.243) (-278.228) * (-280.979) (-280.509) (-277.482) [-279.111] -- 0:00:07
869500 -- [-278.471] (-279.961) (-279.464) (-276.943) * (-280.893) [-278.698] (-277.801) (-276.380) -- 0:00:07
870000 -- [-281.553] (-278.673) (-277.846) (-276.633) * (-277.702) (-281.134) [-278.484] (-279.488) -- 0:00:07
Average standard deviation of split frequencies: 0.008663
870500 -- [-279.398] (-276.682) (-279.497) (-278.492) * (-280.174) (-279.484) (-278.978) [-282.627] -- 0:00:07
871000 -- (-278.601) (-279.000) [-279.036] (-278.637) * [-277.194] (-278.121) (-279.336) (-276.983) -- 0:00:07
871500 -- (-278.620) (-278.705) [-279.482] (-279.477) * (-279.051) (-278.436) (-278.775) [-278.364] -- 0:00:07
872000 -- (-276.930) [-278.013] (-277.139) (-278.967) * (-276.870) (-276.401) [-280.924] (-283.418) -- 0:00:07
872500 -- (-276.896) (-278.400) (-278.447) [-279.879] * (-278.741) (-278.383) (-278.327) [-278.784] -- 0:00:07
873000 -- (-278.919) (-278.844) [-277.497] (-283.998) * (-279.888) (-278.720) [-283.353] (-278.479) -- 0:00:07
873500 -- (-279.888) [-277.602] (-278.687) (-281.727) * [-278.256] (-276.849) (-277.068) (-276.912) -- 0:00:07
874000 -- (-279.200) [-279.388] (-276.838) (-277.989) * (-277.788) [-277.452] (-278.239) (-279.437) -- 0:00:07
874500 -- (-278.902) (-278.081) [-278.122] (-277.988) * [-278.068] (-278.109) (-280.609) (-279.647) -- 0:00:07
875000 -- (-278.307) (-277.019) [-279.452] (-277.993) * (-277.603) (-280.189) [-279.577] (-284.528) -- 0:00:07
Average standard deviation of split frequencies: 0.009041
875500 -- (-276.848) (-281.834) (-281.254) [-281.096] * (-277.859) (-279.062) (-278.494) [-279.656] -- 0:00:07
876000 -- (-277.924) [-277.947] (-278.531) (-278.983) * (-279.725) (-278.013) [-279.796] (-278.894) -- 0:00:07
876500 -- (-282.498) (-278.100) (-278.753) [-277.496] * (-278.544) [-279.502] (-277.631) (-276.890) -- 0:00:07
877000 -- (-279.085) [-277.593] (-280.335) (-278.470) * [-276.541] (-279.429) (-278.795) (-277.806) -- 0:00:07
877500 -- (-278.831) [-278.188] (-278.102) (-280.099) * [-279.637] (-279.857) (-278.190) (-276.570) -- 0:00:07
878000 -- (-278.811) (-279.427) (-278.199) [-282.375] * (-279.714) [-279.132] (-278.439) (-278.140) -- 0:00:07
878500 -- [-278.087] (-277.559) (-277.993) (-278.474) * (-278.136) (-280.872) [-277.444] (-277.069) -- 0:00:07
879000 -- (-278.603) [-279.804] (-278.084) (-279.952) * (-278.134) (-281.762) [-280.881] (-277.565) -- 0:00:07
879500 -- [-277.905] (-277.141) (-278.205) (-280.433) * (-279.778) [-279.464] (-279.103) (-278.567) -- 0:00:07
880000 -- [-277.469] (-278.604) (-280.501) (-277.088) * [-279.490] (-277.998) (-280.458) (-277.641) -- 0:00:07
Average standard deviation of split frequencies: 0.008850
880500 -- (-279.930) (-279.903) [-278.116] (-278.192) * (-284.680) (-277.763) (-277.789) [-279.359] -- 0:00:07
881000 -- (-277.424) (-277.156) [-280.124] (-279.146) * (-279.993) (-276.786) (-281.861) [-277.231] -- 0:00:07
881500 -- (-279.074) (-277.508) [-281.463] (-277.200) * (-280.062) (-277.165) (-282.614) [-278.823] -- 0:00:06
882000 -- (-277.954) (-278.189) (-280.055) [-280.055] * (-277.425) [-276.816] (-276.435) (-283.249) -- 0:00:06
882500 -- (-277.751) (-278.824) (-277.686) [-276.895] * (-279.932) [-276.816] (-278.443) (-279.770) -- 0:00:06
883000 -- (-280.372) (-280.928) [-278.657] (-277.674) * (-280.768) (-277.638) (-277.913) [-277.025] -- 0:00:06
883500 -- (-280.512) (-281.415) [-280.294] (-278.221) * (-281.264) (-278.875) (-279.241) [-276.928] -- 0:00:06
884000 -- (-278.011) (-276.941) (-282.243) [-278.622] * (-279.334) [-280.830] (-279.746) (-277.526) -- 0:00:06
884500 -- (-278.082) [-277.277] (-280.526) (-281.746) * [-278.332] (-278.106) (-282.668) (-281.076) -- 0:00:06
885000 -- [-278.678] (-282.866) (-277.848) (-280.061) * [-281.506] (-279.369) (-279.421) (-280.043) -- 0:00:06
Average standard deviation of split frequencies: 0.008442
885500 -- (-277.721) (-281.541) (-279.171) [-277.431] * (-278.745) [-277.310] (-278.417) (-278.770) -- 0:00:06
886000 -- (-277.528) (-278.731) [-277.805] (-277.563) * (-278.344) (-278.425) (-278.790) [-283.518] -- 0:00:06
886500 -- [-277.805] (-277.266) (-277.832) (-278.150) * (-278.376) [-279.403] (-276.435) (-278.248) -- 0:00:06
887000 -- (-280.145) (-277.648) (-278.577) [-277.268] * [-278.985] (-279.761) (-277.882) (-280.785) -- 0:00:06
887500 -- [-280.425] (-277.675) (-277.903) (-278.684) * (-280.646) (-280.958) [-277.525] (-282.487) -- 0:00:06
888000 -- (-279.127) (-280.235) [-277.584] (-277.161) * (-277.564) [-279.904] (-279.019) (-276.915) -- 0:00:06
888500 -- (-278.787) [-276.418] (-277.540) (-278.717) * (-277.722) (-280.156) (-277.386) [-280.724] -- 0:00:06
889000 -- [-277.273] (-277.574) (-279.846) (-277.490) * (-278.335) [-278.708] (-279.484) (-277.930) -- 0:00:06
889500 -- (-278.227) (-278.004) (-277.231) [-278.486] * (-277.895) [-276.807] (-278.359) (-277.364) -- 0:00:06
890000 -- [-279.384] (-279.726) (-278.619) (-276.983) * (-280.531) (-278.778) (-277.515) [-279.111] -- 0:00:06
Average standard deviation of split frequencies: 0.008080
890500 -- (-280.344) [-277.266] (-279.065) (-280.314) * (-282.611) [-281.512] (-277.727) (-283.004) -- 0:00:06
891000 -- (-279.300) (-277.925) [-279.577] (-280.359) * (-277.145) [-280.810] (-278.809) (-282.108) -- 0:00:06
891500 -- (-278.744) (-278.782) [-276.866] (-278.987) * (-278.081) (-281.547) (-278.776) [-276.267] -- 0:00:06
892000 -- (-278.207) (-277.303) (-278.823) [-279.748] * (-278.550) (-281.511) [-277.907] (-278.381) -- 0:00:06
892500 -- (-280.270) (-281.004) [-278.300] (-277.591) * (-281.611) (-277.826) [-282.882] (-279.834) -- 0:00:06
893000 -- [-276.711] (-282.425) (-277.041) (-277.814) * (-282.202) (-277.115) (-278.566) [-278.923] -- 0:00:06
893500 -- (-276.942) (-278.095) [-277.624] (-284.388) * (-278.729) [-279.143] (-278.640) (-282.599) -- 0:00:06
894000 -- (-282.098) (-279.295) (-277.889) [-278.863] * (-283.203) [-281.693] (-276.883) (-279.750) -- 0:00:06
894500 -- (-279.210) [-279.124] (-277.520) (-279.596) * (-279.526) (-281.166) (-278.376) [-278.069] -- 0:00:06
895000 -- (-279.826) [-277.757] (-279.382) (-282.649) * (-277.854) [-280.273] (-279.802) (-276.916) -- 0:00:06
Average standard deviation of split frequencies: 0.008102
895500 -- (-279.529) [-277.704] (-283.169) (-278.961) * (-277.357) (-277.250) (-279.024) [-277.520] -- 0:00:06
896000 -- (-278.696) [-280.649] (-280.275) (-282.240) * (-280.029) (-277.768) [-276.800] (-277.882) -- 0:00:06
896500 -- (-277.359) (-279.897) (-276.852) [-279.879] * (-278.020) (-276.531) [-280.460] (-278.413) -- 0:00:06
897000 -- [-278.088] (-278.555) (-283.126) (-279.792) * (-286.257) (-277.894) [-278.502] (-277.955) -- 0:00:06
897500 -- (-278.353) (-282.914) (-279.501) [-278.021] * (-279.869) (-280.456) [-279.190] (-281.262) -- 0:00:06
898000 -- (-277.366) (-278.361) (-280.973) [-280.894] * (-279.427) (-279.610) (-277.646) [-279.244] -- 0:00:06
898500 -- [-278.027] (-277.781) (-279.738) (-277.235) * (-278.629) [-280.081] (-277.791) (-277.093) -- 0:00:05
899000 -- (-277.736) (-281.423) [-279.981] (-280.634) * (-282.562) (-279.023) [-277.931] (-278.744) -- 0:00:05
899500 -- (-277.528) (-280.082) [-278.454] (-281.699) * (-279.708) [-276.452] (-278.195) (-276.557) -- 0:00:05
900000 -- (-277.045) (-278.804) [-278.991] (-277.331) * (-279.725) (-278.729) (-277.739) [-276.528] -- 0:00:05
Average standard deviation of split frequencies: 0.007676
900500 -- [-276.513] (-281.132) (-279.642) (-276.940) * [-279.203] (-277.582) (-277.352) (-277.344) -- 0:00:05
901000 -- (-276.859) (-276.797) [-277.059] (-279.542) * (-279.067) (-280.992) [-277.319] (-281.836) -- 0:00:05
901500 -- [-277.322] (-281.744) (-278.001) (-280.353) * (-281.171) (-278.902) [-278.303] (-277.129) -- 0:00:05
902000 -- (-277.950) [-276.707] (-276.980) (-279.217) * (-278.158) [-278.037] (-279.815) (-279.966) -- 0:00:05
902500 -- (-284.679) [-277.731] (-280.757) (-276.705) * (-277.384) (-279.884) [-279.841] (-278.562) -- 0:00:05
903000 -- (-281.116) (-278.076) [-278.140] (-276.709) * (-279.226) [-279.716] (-281.177) (-277.547) -- 0:00:05
903500 -- (-276.634) (-279.656) [-277.233] (-276.899) * [-278.813] (-279.940) (-285.682) (-279.428) -- 0:00:05
904000 -- [-276.759] (-276.246) (-279.301) (-278.335) * (-279.520) [-281.098] (-277.913) (-281.853) -- 0:00:05
904500 -- (-282.348) [-276.636] (-277.372) (-281.834) * [-278.753] (-281.290) (-278.885) (-281.977) -- 0:00:05
905000 -- (-280.335) (-277.666) (-278.012) [-278.377] * (-282.062) [-279.617] (-278.243) (-280.608) -- 0:00:05
Average standard deviation of split frequencies: 0.007839
905500 -- [-279.445] (-281.165) (-277.873) (-281.708) * (-280.227) (-277.539) [-278.589] (-279.293) -- 0:00:05
906000 -- (-278.229) [-276.830] (-278.034) (-280.241) * (-277.773) (-277.836) [-277.389] (-280.271) -- 0:00:05
906500 -- (-278.899) (-278.746) (-278.864) [-280.185] * (-282.416) (-278.584) [-278.245] (-280.750) -- 0:00:05
907000 -- (-278.695) [-280.298] (-279.308) (-279.920) * (-277.751) (-280.096) (-279.453) [-282.152] -- 0:00:05
907500 -- [-280.615] (-279.893) (-280.648) (-280.571) * (-277.063) (-280.221) [-277.927] (-277.044) -- 0:00:05
908000 -- [-277.987] (-279.714) (-279.416) (-280.250) * (-277.185) (-278.380) [-276.984] (-276.216) -- 0:00:05
908500 -- [-276.949] (-279.324) (-278.534) (-277.664) * (-281.254) (-279.520) (-277.958) [-278.368] -- 0:00:05
909000 -- (-280.113) [-278.780] (-279.290) (-280.038) * (-278.092) (-281.521) [-278.637] (-279.034) -- 0:00:05
909500 -- (-279.639) (-281.320) [-276.747] (-282.045) * (-279.444) (-278.639) (-278.015) [-279.686] -- 0:00:05
910000 -- (-277.911) (-276.639) (-277.656) [-279.207] * (-280.947) [-278.602] (-278.501) (-279.205) -- 0:00:05
Average standard deviation of split frequencies: 0.007937
910500 -- (-276.564) (-276.749) (-278.589) [-277.491] * (-280.866) (-278.535) [-278.291] (-281.692) -- 0:00:05
911000 -- [-278.872] (-278.277) (-277.267) (-277.117) * [-285.212] (-277.824) (-280.328) (-282.480) -- 0:00:05
911500 -- (-281.035) (-278.456) (-279.445) [-277.397] * [-278.388] (-279.282) (-279.231) (-285.505) -- 0:00:05
912000 -- (-281.209) (-277.429) (-278.757) [-279.567] * (-276.672) (-284.554) [-276.939] (-282.395) -- 0:00:05
912500 -- (-280.874) (-280.082) [-277.691] (-276.949) * (-280.593) [-281.352] (-277.058) (-289.545) -- 0:00:05
913000 -- (-278.428) (-278.686) [-276.870] (-279.368) * (-279.225) [-281.655] (-276.815) (-280.548) -- 0:00:05
913500 -- [-279.670] (-279.853) (-277.719) (-278.594) * (-278.927) (-284.720) (-279.314) [-279.082] -- 0:00:05
914000 -- [-278.087] (-277.493) (-278.630) (-279.371) * (-278.293) (-282.133) [-278.810] (-277.584) -- 0:00:05
914500 -- (-282.951) (-277.755) (-278.800) [-278.984] * (-278.628) [-281.759] (-278.331) (-276.978) -- 0:00:05
915000 -- (-279.961) (-278.996) (-277.826) [-278.078] * (-277.499) [-277.589] (-279.104) (-277.408) -- 0:00:05
Average standard deviation of split frequencies: 0.007994
915500 -- (-278.058) (-276.785) [-278.137] (-279.719) * (-278.123) [-278.318] (-278.426) (-276.960) -- 0:00:04
916000 -- (-278.902) [-276.889] (-278.041) (-281.262) * (-277.236) [-277.370] (-276.653) (-276.775) -- 0:00:04
916500 -- (-278.493) (-277.579) (-279.614) [-278.113] * (-278.679) [-278.326] (-276.696) (-279.085) -- 0:00:04
917000 -- (-282.781) [-281.352] (-276.676) (-276.889) * (-277.585) [-277.768] (-279.606) (-279.030) -- 0:00:04
917500 -- [-277.495] (-279.867) (-277.327) (-278.959) * (-278.906) (-279.547) (-278.027) [-276.975] -- 0:00:04
918000 -- (-277.274) (-279.160) (-277.512) [-278.968] * [-277.555] (-276.869) (-278.236) (-278.816) -- 0:00:04
918500 -- (-277.274) (-277.221) [-277.476] (-280.155) * [-276.924] (-278.373) (-276.586) (-278.154) -- 0:00:04
919000 -- [-276.592] (-277.216) (-277.730) (-279.035) * (-278.677) (-278.937) [-277.657] (-277.458) -- 0:00:04
919500 -- [-281.013] (-277.452) (-276.906) (-279.033) * (-277.994) (-279.862) [-278.028] (-278.065) -- 0:00:04
920000 -- (-278.019) [-281.975] (-277.289) (-278.932) * (-280.839) (-277.898) (-276.989) [-277.121] -- 0:00:04
Average standard deviation of split frequencies: 0.007749
920500 -- [-277.927] (-279.731) (-279.258) (-280.184) * (-277.922) (-282.865) (-277.086) [-279.438] -- 0:00:04
921000 -- (-279.607) (-280.068) [-281.726] (-278.554) * [-276.648] (-280.238) (-278.267) (-277.210) -- 0:00:04
921500 -- (-282.276) (-285.029) (-281.015) [-278.176] * [-278.018] (-284.412) (-280.870) (-278.320) -- 0:00:04
922000 -- (-281.698) (-283.322) [-278.417] (-277.041) * (-277.300) [-280.543] (-277.092) (-279.178) -- 0:00:04
922500 -- [-279.244] (-278.002) (-285.693) (-278.334) * [-280.083] (-278.445) (-278.671) (-277.616) -- 0:00:04
923000 -- (-279.874) [-277.159] (-281.844) (-278.645) * [-278.105] (-280.858) (-278.680) (-277.274) -- 0:00:04
923500 -- [-278.040] (-277.390) (-280.319) (-277.324) * [-277.432] (-283.439) (-277.491) (-279.583) -- 0:00:04
924000 -- (-278.332) [-284.034] (-280.820) (-280.888) * (-279.085) (-279.242) [-278.152] (-277.632) -- 0:00:04
924500 -- [-277.022] (-283.318) (-278.977) (-277.881) * (-278.770) [-278.805] (-277.967) (-279.140) -- 0:00:04
925000 -- (-278.985) [-277.291] (-280.499) (-279.374) * (-277.705) (-279.023) (-280.195) [-278.380] -- 0:00:04
Average standard deviation of split frequencies: 0.007670
925500 -- (-277.558) (-280.340) (-280.559) [-281.177] * [-279.659] (-280.202) (-280.738) (-276.771) -- 0:00:04
926000 -- (-278.917) (-282.033) [-276.429] (-279.214) * (-278.061) (-278.182) [-279.303] (-277.280) -- 0:00:04
926500 -- (-279.234) [-277.311] (-278.089) (-277.246) * [-279.322] (-281.240) (-279.515) (-277.643) -- 0:00:04
927000 -- (-280.967) (-278.749) [-276.723] (-278.127) * (-279.687) (-277.871) (-277.314) [-281.209] -- 0:00:04
927500 -- (-278.384) (-278.326) [-277.632] (-280.611) * (-279.631) (-278.752) [-278.378] (-277.049) -- 0:00:04
928000 -- (-280.108) [-277.470] (-280.004) (-277.140) * (-278.039) [-280.109] (-278.958) (-277.907) -- 0:00:04
928500 -- (-277.185) (-276.735) [-277.813] (-277.731) * [-279.936] (-278.067) (-276.694) (-279.821) -- 0:00:04
929000 -- [-279.330] (-278.698) (-278.962) (-281.001) * (-278.276) (-277.909) [-279.214] (-279.486) -- 0:00:04
929500 -- (-279.801) (-278.814) [-278.677] (-278.179) * [-277.166] (-281.752) (-280.684) (-279.157) -- 0:00:04
930000 -- (-277.941) [-278.887] (-276.535) (-277.484) * (-282.083) [-278.114] (-280.851) (-279.558) -- 0:00:04
Average standard deviation of split frequencies: 0.007260
930500 -- [-277.837] (-279.111) (-276.826) (-278.179) * (-281.639) (-278.891) [-278.094] (-279.124) -- 0:00:04
931000 -- (-276.677) (-277.996) (-278.548) [-283.134] * [-278.367] (-277.279) (-277.377) (-277.548) -- 0:00:04
931500 -- (-281.672) (-283.421) (-284.694) [-279.771] * [-278.890] (-277.225) (-277.373) (-278.890) -- 0:00:04
932000 -- (-281.738) (-278.316) (-278.387) [-280.303] * (-279.599) [-278.413] (-278.288) (-279.084) -- 0:00:04
932500 -- (-283.453) (-282.089) [-280.543] (-279.590) * (-279.149) (-281.988) (-278.523) [-277.107] -- 0:00:03
933000 -- (-281.539) (-276.306) (-279.135) [-279.294] * (-284.476) [-279.053] (-278.378) (-278.590) -- 0:00:03
933500 -- (-279.335) [-277.620] (-282.526) (-280.239) * [-277.103] (-282.870) (-281.176) (-277.187) -- 0:00:03
934000 -- (-282.986) [-277.310] (-279.793) (-280.275) * (-281.453) (-279.845) (-277.989) [-279.201] -- 0:00:03
934500 -- (-280.473) (-279.107) (-279.276) [-279.137] * (-279.640) (-282.700) (-278.528) [-278.091] -- 0:00:03
935000 -- (-280.054) (-279.989) (-278.333) [-279.665] * (-279.346) (-278.086) [-276.421] (-279.289) -- 0:00:03
Average standard deviation of split frequencies: 0.007252
935500 -- (-279.096) [-282.292] (-277.517) (-278.585) * (-277.373) (-278.584) [-276.424] (-278.317) -- 0:00:03
936000 -- (-280.799) [-278.858] (-278.176) (-278.413) * (-277.964) (-278.996) [-280.476] (-280.092) -- 0:00:03
936500 -- [-276.709] (-281.100) (-280.469) (-277.572) * (-278.638) [-277.628] (-278.841) (-279.984) -- 0:00:03
937000 -- (-277.773) (-277.275) [-278.054] (-278.008) * [-278.259] (-277.061) (-280.639) (-277.895) -- 0:00:03
937500 -- (-281.549) [-277.003] (-278.225) (-278.969) * (-279.997) [-277.061] (-281.577) (-282.680) -- 0:00:03
938000 -- [-278.980] (-277.525) (-283.229) (-280.046) * (-277.216) (-276.708) (-281.377) [-277.398] -- 0:00:03
938500 -- (-283.232) [-277.970] (-278.924) (-278.251) * (-278.001) (-280.738) (-277.591) [-277.454] -- 0:00:03
939000 -- (-278.983) [-277.778] (-281.712) (-278.200) * [-277.515] (-278.470) (-279.503) (-279.656) -- 0:00:03
939500 -- (-279.538) [-277.868] (-286.256) (-279.093) * [-278.578] (-281.310) (-278.273) (-277.583) -- 0:00:03
940000 -- (-277.201) [-279.645] (-279.478) (-277.992) * (-277.469) (-279.283) (-279.178) [-276.617] -- 0:00:03
Average standard deviation of split frequencies: 0.007049
940500 -- [-280.281] (-279.734) (-278.128) (-280.441) * (-279.281) [-277.478] (-278.721) (-279.616) -- 0:00:03
941000 -- [-277.279] (-279.372) (-282.006) (-280.360) * [-278.706] (-277.408) (-279.372) (-278.563) -- 0:00:03
941500 -- (-279.243) (-277.842) [-278.933] (-277.845) * (-278.053) [-278.445] (-277.427) (-280.613) -- 0:00:03
942000 -- (-279.862) [-277.851] (-279.252) (-279.353) * [-278.720] (-279.870) (-276.752) (-279.313) -- 0:00:03
942500 -- (-278.274) (-281.009) [-278.566] (-277.767) * (-278.535) [-278.174] (-277.433) (-276.707) -- 0:00:03
943000 -- (-282.789) (-277.522) [-281.334] (-279.809) * [-282.927] (-279.196) (-278.774) (-282.623) -- 0:00:03
943500 -- (-279.135) (-277.072) [-279.021] (-277.073) * [-278.417] (-277.134) (-280.804) (-281.926) -- 0:00:03
944000 -- (-277.485) (-282.211) [-280.567] (-278.923) * (-278.262) [-277.184] (-276.936) (-280.603) -- 0:00:03
944500 -- (-278.027) [-280.487] (-277.710) (-279.494) * (-281.027) [-278.791] (-277.297) (-281.329) -- 0:00:03
945000 -- [-279.332] (-278.974) (-277.956) (-277.435) * (-282.346) (-276.933) (-279.511) [-278.507] -- 0:00:03
Average standard deviation of split frequencies: 0.007142
945500 -- [-277.924] (-278.775) (-277.476) (-276.833) * [-281.160] (-277.121) (-278.593) (-277.944) -- 0:00:03
946000 -- [-276.743] (-278.604) (-277.416) (-277.247) * (-277.106) (-278.997) [-279.516] (-281.932) -- 0:00:03
946500 -- (-281.542) (-277.951) (-277.124) [-279.146] * (-276.649) (-283.945) (-280.758) [-277.949] -- 0:00:03
947000 -- (-278.668) [-276.479] (-279.295) (-277.207) * (-277.089) [-278.999] (-277.560) (-279.240) -- 0:00:03
947500 -- (-282.663) [-278.438] (-277.679) (-278.025) * (-280.555) (-279.113) (-278.361) [-277.165] -- 0:00:03
948000 -- (-280.247) (-277.058) (-277.434) [-277.342] * (-282.053) (-277.003) [-278.578] (-279.062) -- 0:00:03
948500 -- [-282.174] (-280.335) (-278.295) (-277.413) * (-276.933) (-281.022) [-277.629] (-281.934) -- 0:00:03
949000 -- [-279.935] (-279.577) (-279.654) (-278.668) * (-277.687) (-278.098) (-282.236) [-278.001] -- 0:00:03
949500 -- (-281.394) (-278.461) (-280.050) [-277.223] * [-276.561] (-277.085) (-282.553) (-279.339) -- 0:00:02
950000 -- (-280.501) [-278.362] (-277.277) (-280.127) * [-280.158] (-279.255) (-279.272) (-276.954) -- 0:00:02
Average standard deviation of split frequencies: 0.007471
950500 -- (-280.097) (-277.026) (-277.878) [-278.319] * (-278.844) (-277.586) [-279.280] (-278.500) -- 0:00:02
951000 -- (-279.753) (-280.780) (-277.501) [-282.960] * (-280.678) (-278.255) (-277.568) [-277.175] -- 0:00:02
951500 -- (-277.850) (-278.542) [-278.142] (-282.428) * (-278.823) (-279.382) (-277.429) [-278.476] -- 0:00:02
952000 -- (-278.138) (-277.839) [-278.493] (-279.057) * (-279.156) (-278.546) [-278.408] (-277.296) -- 0:00:02
952500 -- (-279.663) (-279.277) (-279.213) [-278.547] * (-278.875) (-280.596) [-279.930] (-277.869) -- 0:00:02
953000 -- (-279.768) (-280.664) (-280.247) [-276.364] * [-278.211] (-280.779) (-282.019) (-276.552) -- 0:00:02
953500 -- (-277.468) [-277.838] (-278.494) (-276.721) * (-277.586) (-278.576) [-281.301] (-276.858) -- 0:00:02
954000 -- (-277.687) (-276.412) (-279.341) [-284.527] * [-277.667] (-280.471) (-278.454) (-279.232) -- 0:00:02
954500 -- (-277.967) (-280.161) (-279.922) [-278.811] * [-277.974] (-278.832) (-277.658) (-278.001) -- 0:00:02
955000 -- (-281.346) (-277.948) (-278.067) [-280.154] * (-276.564) (-278.659) [-278.272] (-282.024) -- 0:00:02
Average standard deviation of split frequencies: 0.007561
955500 -- (-281.463) (-293.099) (-277.783) [-281.892] * (-278.399) (-278.566) (-278.984) [-282.283] -- 0:00:02
956000 -- (-281.238) [-279.190] (-277.752) (-279.077) * (-279.070) [-277.260] (-277.646) (-281.474) -- 0:00:02
956500 -- (-278.712) [-278.134] (-278.778) (-277.916) * (-277.867) [-278.399] (-281.582) (-282.279) -- 0:00:02
957000 -- (-280.095) (-278.139) [-278.250] (-278.256) * [-277.749] (-279.689) (-277.948) (-278.147) -- 0:00:02
957500 -- (-283.531) (-278.654) (-279.178) [-276.597] * (-284.507) (-278.114) [-278.529] (-279.391) -- 0:00:02
958000 -- (-280.490) (-276.482) [-279.359] (-279.562) * (-279.843) (-277.893) [-279.313] (-278.798) -- 0:00:02
958500 -- (-278.004) [-277.771] (-276.848) (-279.093) * (-277.343) (-280.014) [-278.927] (-279.134) -- 0:00:02
959000 -- (-277.336) [-278.450] (-276.738) (-281.600) * (-279.181) (-277.820) (-279.134) [-278.020] -- 0:00:02
959500 -- (-280.429) (-278.961) [-276.645] (-278.497) * (-279.336) (-279.127) (-276.832) [-279.006] -- 0:00:02
960000 -- (-283.902) (-278.042) [-278.225] (-278.651) * [-277.820] (-278.608) (-278.501) (-277.644) -- 0:00:02
Average standard deviation of split frequencies: 0.007655
960500 -- (-281.666) (-276.846) [-280.004] (-279.723) * (-280.190) [-277.396] (-277.199) (-277.736) -- 0:00:02
961000 -- (-278.208) [-278.607] (-279.551) (-278.852) * (-278.001) (-276.878) [-278.806] (-279.646) -- 0:00:02
961500 -- (-280.493) (-278.685) [-277.525] (-277.573) * [-277.093] (-277.736) (-282.606) (-280.734) -- 0:00:02
962000 -- (-278.481) (-277.611) (-278.192) [-277.907] * (-277.103) [-277.225] (-282.038) (-279.464) -- 0:00:02
962500 -- (-277.930) (-277.247) (-277.412) [-278.650] * (-279.098) [-279.298] (-279.833) (-279.742) -- 0:00:02
963000 -- (-277.249) (-278.093) (-277.664) [-277.171] * (-276.698) (-279.138) [-279.521] (-277.842) -- 0:00:02
963500 -- [-278.284] (-283.860) (-278.800) (-279.414) * (-279.978) (-282.011) [-277.196] (-279.943) -- 0:00:02
964000 -- [-277.016] (-281.366) (-278.706) (-279.316) * (-278.388) (-279.574) (-278.279) [-277.181] -- 0:00:02
964500 -- (-280.268) (-279.147) (-277.794) [-278.502] * (-277.788) [-276.733] (-278.146) (-276.722) -- 0:00:02
965000 -- (-276.249) (-280.415) (-280.328) [-279.330] * [-277.278] (-276.612) (-278.311) (-276.398) -- 0:00:02
Average standard deviation of split frequencies: 0.007678
965500 -- (-277.764) (-279.985) (-277.390) [-277.897] * (-279.805) (-276.464) (-278.490) [-278.570] -- 0:00:02
966000 -- [-277.796] (-278.466) (-277.090) (-279.273) * (-278.447) (-276.808) [-279.970] (-278.790) -- 0:00:02
966500 -- (-277.739) [-279.985] (-281.487) (-278.766) * (-279.714) [-278.905] (-280.835) (-278.935) -- 0:00:01
967000 -- (-279.359) (-278.733) [-280.278] (-279.719) * [-279.897] (-278.789) (-278.769) (-276.647) -- 0:00:01
967500 -- (-279.734) [-278.760] (-277.303) (-280.339) * (-284.831) [-277.961] (-277.155) (-283.714) -- 0:00:01
968000 -- [-277.047] (-277.460) (-277.794) (-277.611) * (-281.782) [-279.367] (-277.446) (-279.198) -- 0:00:01
968500 -- (-277.914) [-277.620] (-279.766) (-280.321) * (-279.210) (-278.127) (-278.158) [-282.158] -- 0:00:01
969000 -- (-278.947) (-278.900) (-278.134) [-277.783] * (-280.179) (-279.049) [-279.153] (-278.519) -- 0:00:01
969500 -- (-276.986) (-277.380) [-277.257] (-280.399) * (-278.912) [-276.954] (-282.340) (-278.314) -- 0:00:01
970000 -- [-276.910] (-281.160) (-278.254) (-280.158) * (-280.287) (-277.823) (-278.292) [-280.338] -- 0:00:01
Average standard deviation of split frequencies: 0.007868
970500 -- (-276.995) (-282.418) [-279.193] (-280.603) * (-277.711) (-278.164) (-280.469) [-280.682] -- 0:00:01
971000 -- [-276.670] (-278.498) (-277.338) (-283.169) * (-281.384) (-278.143) (-277.821) [-278.363] -- 0:00:01
971500 -- (-278.350) (-279.186) (-283.256) [-280.424] * [-276.533] (-278.275) (-277.030) (-278.930) -- 0:00:01
972000 -- [-276.972] (-279.636) (-279.258) (-279.475) * (-278.813) (-279.099) [-277.932] (-277.075) -- 0:00:01
972500 -- [-277.323] (-278.551) (-277.623) (-279.301) * (-279.865) [-277.866] (-279.197) (-277.745) -- 0:00:01
973000 -- (-280.637) (-279.090) [-277.156] (-279.489) * [-278.766] (-279.065) (-277.434) (-279.135) -- 0:00:01
973500 -- (-278.027) (-278.105) [-279.045] (-279.448) * (-279.927) (-278.372) [-278.285] (-277.120) -- 0:00:01
974000 -- (-277.837) (-277.111) [-278.495] (-278.065) * [-280.469] (-282.331) (-277.135) (-280.625) -- 0:00:01
974500 -- [-277.561] (-277.420) (-277.971) (-277.732) * (-280.342) [-279.109] (-279.524) (-277.997) -- 0:00:01
975000 -- [-277.845] (-277.515) (-282.491) (-277.676) * [-278.212] (-278.286) (-279.867) (-276.593) -- 0:00:01
Average standard deviation of split frequencies: 0.007857
975500 -- (-276.445) [-282.685] (-280.346) (-276.668) * [-277.416] (-278.435) (-279.546) (-278.140) -- 0:00:01
976000 -- (-276.704) [-284.692] (-279.838) (-277.521) * [-280.041] (-278.368) (-281.966) (-277.198) -- 0:00:01
976500 -- [-276.977] (-279.847) (-280.302) (-277.731) * [-277.983] (-276.349) (-281.602) (-278.702) -- 0:00:01
977000 -- (-277.026) [-277.714] (-279.667) (-279.231) * (-285.337) (-278.715) [-281.191] (-278.925) -- 0:00:01
977500 -- (-277.816) (-278.137) [-276.856] (-279.028) * (-278.925) (-277.026) (-279.591) [-279.494] -- 0:00:01
978000 -- (-278.227) (-280.182) (-276.651) [-277.544] * (-276.737) (-281.360) (-277.501) [-284.486] -- 0:00:01
978500 -- (-279.220) (-280.300) (-277.355) [-279.082] * [-278.033] (-282.812) (-278.634) (-280.454) -- 0:00:01
979000 -- (-278.002) [-278.689] (-277.686) (-282.582) * (-277.676) [-278.460] (-281.380) (-277.519) -- 0:00:01
979500 -- (-276.977) [-279.053] (-280.174) (-278.181) * (-278.572) (-278.802) (-280.084) [-278.142] -- 0:00:01
980000 -- (-279.248) (-279.644) (-277.248) [-277.719] * (-277.164) (-283.789) [-278.195] (-280.109) -- 0:00:01
Average standard deviation of split frequencies: 0.007915
980500 -- (-280.127) (-278.578) [-277.830] (-278.954) * (-278.548) (-278.232) [-279.138] (-278.170) -- 0:00:01
981000 -- (-279.325) [-279.382] (-278.077) (-279.883) * (-277.726) [-277.528] (-278.017) (-278.262) -- 0:00:01
981500 -- (-277.019) (-279.041) [-277.143] (-278.569) * [-278.295] (-278.876) (-278.289) (-278.270) -- 0:00:01
982000 -- (-276.968) (-277.799) (-276.688) [-278.394] * (-280.432) [-279.923] (-277.358) (-281.028) -- 0:00:01
982500 -- (-281.346) [-278.673] (-278.126) (-278.175) * (-277.643) (-277.033) [-278.507] (-278.257) -- 0:00:01
983000 -- (-279.684) (-280.215) (-282.896) [-279.435] * [-277.270] (-277.370) (-281.034) (-283.754) -- 0:00:01
983500 -- [-282.096] (-279.872) (-280.353) (-277.454) * (-280.362) (-277.180) (-281.106) [-278.565] -- 0:00:00
984000 -- (-277.574) (-279.084) [-279.557] (-278.219) * (-277.426) (-277.337) [-281.887] (-278.269) -- 0:00:00
984500 -- [-279.439] (-278.505) (-278.408) (-287.679) * (-277.193) (-277.631) [-278.392] (-277.753) -- 0:00:00
985000 -- (-280.106) [-280.965] (-277.790) (-287.044) * (-278.093) [-276.561] (-278.138) (-279.031) -- 0:00:00
Average standard deviation of split frequencies: 0.007936
985500 -- [-277.221] (-279.001) (-278.252) (-281.458) * (-280.301) (-278.108) (-278.794) [-277.944] -- 0:00:00
986000 -- (-277.532) [-280.623] (-277.158) (-282.456) * (-281.416) [-277.881] (-281.531) (-279.226) -- 0:00:00
986500 -- [-280.345] (-278.667) (-277.386) (-283.710) * (-278.629) (-278.405) [-280.076] (-278.435) -- 0:00:00
987000 -- (-278.390) (-277.476) (-280.956) [-278.846] * (-279.242) (-280.292) (-283.147) [-277.219] -- 0:00:00
987500 -- [-277.169] (-278.730) (-277.955) (-282.062) * (-279.688) (-278.498) [-282.393] (-280.032) -- 0:00:00
988000 -- (-280.524) (-278.381) (-279.923) [-279.980] * [-277.911] (-279.419) (-280.007) (-281.261) -- 0:00:00
988500 -- (-278.356) [-278.390] (-278.360) (-278.595) * (-276.530) (-282.382) (-277.689) [-277.543] -- 0:00:00
989000 -- (-279.758) (-279.508) (-279.940) [-278.957] * (-277.385) (-279.362) (-279.437) [-279.287] -- 0:00:00
989500 -- (-280.765) [-278.665] (-277.517) (-278.315) * [-278.690] (-277.131) (-277.732) (-277.401) -- 0:00:00
990000 -- (-277.412) (-278.166) (-279.204) [-277.810] * (-281.343) [-278.349] (-277.382) (-281.122) -- 0:00:00
Average standard deviation of split frequencies: 0.007994
990500 -- (-280.713) (-278.533) (-278.633) [-277.874] * [-277.830] (-280.316) (-278.169) (-280.028) -- 0:00:00
991000 -- [-281.008] (-280.108) (-283.725) (-279.339) * (-277.551) (-279.707) [-279.996] (-282.901) -- 0:00:00
991500 -- (-278.729) (-278.416) [-281.566] (-279.946) * [-276.961] (-284.060) (-279.315) (-278.090) -- 0:00:00
992000 -- (-278.889) (-278.219) (-279.636) [-277.850] * (-278.786) (-281.283) [-277.258] (-278.185) -- 0:00:00
992500 -- (-277.827) (-278.328) [-279.808] (-279.833) * (-280.189) (-278.377) (-277.824) [-276.674] -- 0:00:00
993000 -- (-278.387) (-277.900) (-278.332) [-281.149] * [-278.230] (-279.444) (-277.143) (-276.599) -- 0:00:00
993500 -- (-277.019) (-278.751) (-276.621) [-278.107] * (-281.203) (-279.863) [-277.906] (-277.060) -- 0:00:00
994000 -- (-280.378) [-277.989] (-279.316) (-281.702) * (-278.068) (-281.215) (-277.551) [-277.742] -- 0:00:00
994500 -- (-278.719) (-278.489) (-277.583) [-278.325] * (-280.994) [-278.179] (-280.236) (-278.914) -- 0:00:00
995000 -- [-279.523] (-277.535) (-281.627) (-282.000) * (-279.690) (-281.963) (-282.070) [-278.401] -- 0:00:00
Average standard deviation of split frequencies: 0.008362
995500 -- (-278.369) [-277.506] (-278.007) (-280.083) * (-281.497) [-280.139] (-284.833) (-285.238) -- 0:00:00
996000 -- (-283.798) (-277.647) (-281.813) [-279.539] * [-277.329] (-283.174) (-279.007) (-278.370) -- 0:00:00
996500 -- (-284.500) (-277.967) (-277.274) [-277.409] * (-280.806) (-281.197) (-278.676) [-278.323] -- 0:00:00
997000 -- [-279.353] (-279.598) (-277.461) (-277.476) * [-277.381] (-283.701) (-278.645) (-277.831) -- 0:00:00
997500 -- (-277.815) (-279.632) (-276.912) [-278.585] * (-278.513) (-279.438) (-278.802) [-277.825] -- 0:00:00
998000 -- [-279.225] (-279.937) (-279.932) (-277.598) * (-281.088) (-278.863) [-277.675] (-282.404) -- 0:00:00
998500 -- [-277.521] (-278.194) (-278.603) (-279.415) * (-278.847) [-278.465] (-276.594) (-278.459) -- 0:00:00
999000 -- (-279.677) (-276.886) [-280.290] (-277.742) * (-276.731) (-278.128) (-279.122) [-281.219] -- 0:00:00
999500 -- (-277.133) [-279.705] (-280.480) (-279.918) * (-279.578) (-277.543) [-276.508] (-280.181) -- 0:00:00
1000000 -- [-279.311] (-278.763) (-277.416) (-276.667) * (-276.852) [-278.244] (-279.734) (-279.948) -- 0:00:00
Average standard deviation of split frequencies: 0.008040
Analysis completed in 59 seconds
Analysis used 57.54 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -276.19
Likelihood of best state for "cold" chain of run 2 was -276.21
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.8 % ( 72 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
47.1 % ( 38 %) Dirichlet(Pi{all})
44.8 % ( 36 %) Slider(Pi{all})
78.3 % ( 46 %) Multiplier(Alpha{1,2})
77.6 % ( 58 %) Multiplier(Alpha{3})
28.0 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 97 %) ExtSPR(Tau{all},V{all})
70.1 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 90 %) ParsSPR(Tau{all},V{all})
28.2 % ( 26 %) Multiplier(V{all})
97.4 % ( 95 %) Nodeslider(V{all})
30.7 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 64 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
47.2 % ( 42 %) Dirichlet(Pi{all})
44.2 % ( 29 %) Slider(Pi{all})
78.3 % ( 53 %) Multiplier(Alpha{1,2})
78.2 % ( 44 %) Multiplier(Alpha{3})
27.4 % ( 21 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 94 %) ParsSPR(Tau{all},V{all})
28.2 % ( 34 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.7 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166535 0.82 0.67
3 | 166036 165941 0.84
4 | 166961 167106 167421
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166160 0.82 0.67
3 | 166814 166586 0.84
4 | 166673 166651 167116
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -278.01
| 1 1 |
| 2 1 1 1 1 1 |
| 1 2 1 1 2 1 2 2|
|1 2 2 1 2 *2 1 2 * 1 |
| 1 212 2 1 21 22 2 2 2 1 2 1 22 |
|222 1 2 1 1 21 1 1 2 2 2 2 |
| 1 1 2 21 1 2 1 2 2 2 22*1 111 2 |
| 1 12 21 1 2 12 1 2 2 1 2 |
| 21 1 2 12 1 11 2 1|
| 1 11 2 1 |
| 1 1 |
| 2 2 |
| 2 1 |
| 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -279.74
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -277.92 -280.87
2 -277.92 -281.19
--------------------------------------
TOTAL -277.92 -281.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886290 0.091671 0.367363 1.527304 0.849951 1330.19 1400.61 1.000
r(A<->C){all} 0.171482 0.020879 0.000060 0.443435 0.133224 137.58 247.18 1.000
r(A<->G){all} 0.170099 0.021387 0.000020 0.471578 0.129353 155.07 160.26 1.003
r(A<->T){all} 0.174474 0.021613 0.000002 0.467150 0.135024 186.45 203.57 1.002
r(C<->G){all} 0.157900 0.018490 0.000060 0.430618 0.119455 307.49 312.62 1.000
r(C<->T){all} 0.161085 0.019075 0.000036 0.434949 0.123345 180.85 218.43 1.000
r(G<->T){all} 0.164961 0.019867 0.000042 0.450440 0.123252 154.00 203.51 1.000
pi(A){all} 0.215695 0.000825 0.163431 0.271397 0.214772 868.63 1136.12 1.000
pi(C){all} 0.277008 0.000967 0.218965 0.339891 0.275526 1162.25 1166.39 1.000
pi(G){all} 0.296982 0.001013 0.239065 0.361990 0.296544 1075.73 1135.08 1.000
pi(T){all} 0.210315 0.000797 0.157455 0.263733 0.209736 1447.53 1463.73 1.000
alpha{1,2} 0.413733 0.230972 0.000154 1.349037 0.246623 1067.75 1088.14 1.001
alpha{3} 0.463617 0.230946 0.000107 1.426167 0.308358 1030.13 1150.39 1.000
pinvar{all} 0.991693 0.000102 0.972132 0.999998 0.995013 971.68 1047.88 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*.*.
8 -- .*...*
9 -- ...**.
10 -- .****.
11 -- .*..*.
12 -- .**.**
13 -- ..**..
14 -- ..****
15 -- ..*..*
16 -- .*.*..
17 -- .***.*
18 -- .**...
19 -- .*.***
20 -- ....**
21 -- ...*.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 464 0.154564 0.019786 0.140573 0.168554 2
8 455 0.151566 0.006124 0.147235 0.155896 2
9 448 0.149234 0.003769 0.146569 0.151899 2
10 445 0.148235 0.003298 0.145903 0.150566 2
11 442 0.147235 0.001884 0.145903 0.148568 2
12 433 0.144237 0.013662 0.134577 0.153897 2
13 432 0.143904 0.016017 0.132578 0.155230 2
14 430 0.143238 0.003769 0.140573 0.145903 2
15 421 0.140240 0.018373 0.127249 0.153231 2
16 419 0.139574 0.002355 0.137908 0.141239 2
17 418 0.139241 0.013191 0.129913 0.148568 2
18 414 0.137908 0.002827 0.135909 0.139907 2
19 410 0.136576 0.009422 0.129913 0.143238 2
20 410 0.136576 0.000942 0.135909 0.137242 2
21 407 0.135576 0.005182 0.131912 0.139241 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096765 0.009556 0.000023 0.300794 0.065837 1.000 2
length{all}[2] 0.100660 0.009805 0.000052 0.296319 0.070532 1.000 2
length{all}[3] 0.096046 0.009015 0.000000 0.284345 0.066915 1.000 2
length{all}[4] 0.098447 0.010449 0.000041 0.298026 0.067075 1.000 2
length{all}[5] 0.097370 0.009739 0.000080 0.299325 0.067761 1.000 2
length{all}[6] 0.099967 0.009859 0.000031 0.305261 0.068286 1.000 2
length{all}[7] 0.112732 0.013150 0.000184 0.345997 0.075220 1.000 2
length{all}[8] 0.095349 0.009785 0.000072 0.310515 0.062331 0.998 2
length{all}[9] 0.094737 0.008432 0.000110 0.263183 0.065876 0.999 2
length{all}[10] 0.097142 0.010871 0.000589 0.299638 0.063415 0.998 2
length{all}[11] 0.094909 0.009800 0.000074 0.286207 0.064131 0.999 2
length{all}[12] 0.109769 0.011672 0.000123 0.340242 0.074223 0.999 2
length{all}[13] 0.094418 0.008322 0.000439 0.270974 0.070839 0.999 2
length{all}[14] 0.098951 0.010061 0.000125 0.301418 0.072398 0.998 2
length{all}[15] 0.097999 0.009209 0.000353 0.306592 0.064088 1.006 2
length{all}[16] 0.096849 0.008501 0.000048 0.279092 0.069847 0.998 2
length{all}[17] 0.099372 0.008939 0.000115 0.286313 0.070344 0.999 2
length{all}[18] 0.092509 0.008372 0.000125 0.261071 0.068806 0.998 2
length{all}[19] 0.105328 0.010010 0.000209 0.348664 0.076687 1.001 2
length{all}[20] 0.098177 0.011038 0.000251 0.291126 0.072982 0.998 2
length{all}[21] 0.100233 0.008173 0.000749 0.280326 0.072063 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.008040
Maximum standard deviation of split frequencies = 0.019786
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\---------------------------------------------------------------------- C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 201
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 35 patterns at 67 / 67 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 35 patterns at 67 / 67 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
34160 bytes for conP
3080 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.048770 0.027145 0.094335 0.071140 0.062927 0.020748 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -284.399796
Iterating by ming2
Initial: fx= 284.399796
x= 0.04877 0.02714 0.09434 0.07114 0.06293 0.02075 0.30000 1.30000
1 h-m-p 0.0000 0.0003 161.6367 +++ 276.220932 m 0.0003 14 | 1/8
2 h-m-p 0.0016 0.0510 29.2109 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 147.9286 ++ 274.108919 m 0.0001 45 | 2/8
4 h-m-p 0.0005 0.0606 25.2888 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 132.2609 +++ 268.370594 m 0.0003 77 | 3/8
6 h-m-p 0.0018 0.0751 20.9864 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 114.8489 +++ 265.532583 m 0.0002 110 | 4/8
8 h-m-p 0.0012 0.0984 16.7461 -----------.. | 4/8
9 h-m-p 0.0000 0.0001 93.9023 ++ 264.430895 m 0.0001 141 | 5/8
10 h-m-p 0.0007 0.1468 11.5001 -----------.. | 5/8
11 h-m-p 0.0000 0.0004 66.3574 +++ 262.868244 m 0.0004 173 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 262.868244 m 8.0000 184 | 6/8
13 h-m-p 0.0951 8.0000 0.0001 ------Y 262.868244 0 0.0000 203
Out..
lnL = -262.868244
204 lfun, 204 eigenQcodon, 1224 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.095807 0.011191 0.064467 0.021866 0.075050 0.080703 0.300110 0.769647 0.415563
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.761432
np = 9
lnL0 = -285.085068
Iterating by ming2
Initial: fx= 285.085068
x= 0.09581 0.01119 0.06447 0.02187 0.07505 0.08070 0.30011 0.76965 0.41556
1 h-m-p 0.0000 0.0002 152.3729 +++ 280.928724 m 0.0002 15 | 1/9
2 h-m-p 0.0001 0.0003 148.3768 ++ 277.502338 m 0.0003 27 | 2/9
3 h-m-p 0.0003 0.0016 59.2151 ++ 267.067943 m 0.0016 39 | 3/9
4 h-m-p 0.0003 0.0017 39.2991 ++ 264.640693 m 0.0017 51 | 4/9
5 h-m-p 0.0000 0.0000 404.8542 ++ 263.853217 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 3592.4860 ++ 262.868196 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0001 ++ 262.868196 m 8.0000 87 | 6/9
8 h-m-p 0.0064 3.2190 0.3434 ------------.. | 6/9
9 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868196 m 8.0000 130 | 6/9
10 h-m-p 0.0096 4.7780 0.2095 ----------C 262.868196 0 0.0000 155 | 6/9
11 h-m-p 0.0160 8.0000 0.0034 +++++ 262.868191 m 8.0000 173 | 6/9
12 h-m-p 0.1167 4.9036 0.2299 ---------------.. | 6/9
13 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868191 m 8.0000 219 | 6/9
14 h-m-p 0.0105 5.2348 0.1962 -----------Y 262.868191 0 0.0000 245 | 6/9
15 h-m-p 0.0160 8.0000 0.0012 +++++ 262.868190 m 8.0000 263 | 6/9
16 h-m-p 0.0417 4.0214 0.2259 --------------.. | 6/9
17 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868189 m 8.0000 308 | 6/9
18 h-m-p 0.0108 5.3977 0.1916 ---------Y 262.868189 0 0.0000 332 | 6/9
19 h-m-p 0.0160 8.0000 0.0007 +++++ 262.868188 m 8.0000 350 | 6/9
20 h-m-p 0.0280 5.5151 0.1923 ------------Y 262.868188 0 0.0000 377 | 6/9
21 h-m-p 0.0160 8.0000 0.0003 +++++ 262.868188 m 8.0000 395 | 6/9
22 h-m-p 0.0067 2.3597 0.3400 ----------Y 262.868188 0 0.0000 420 | 6/9
23 h-m-p 0.0160 8.0000 0.0006 +++++ 262.868187 m 8.0000 438 | 6/9
24 h-m-p 0.0107 2.0976 0.4305 -------------.. | 6/9
25 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868187 m 8.0000 482 | 6/9
26 h-m-p 0.0111 5.5636 0.1865 -----------C 262.868187 0 0.0000 508 | 6/9
27 h-m-p 0.0160 8.0000 0.0004 +++++ 262.868187 m 8.0000 526 | 6/9
28 h-m-p 0.0121 1.6922 0.2753 ----------C 262.868187 0 0.0000 551 | 6/9
29 h-m-p 0.0160 8.0000 0.0003 +++++ 262.868186 m 8.0000 569 | 6/9
30 h-m-p 0.0054 1.9961 0.3928 ---------C 262.868186 0 0.0000 593 | 6/9
31 h-m-p 0.0160 8.0000 0.0003 --------C 262.868186 0 0.0000 616 | 6/9
32 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868186 m 8.0000 634 | 6/9
33 h-m-p 0.0005 0.0986 1.1758 ++++ 262.868180 m 0.0986 651 | 7/9
34 h-m-p 0.2217 1.2679 0.2430 ++ 262.868056 m 1.2679 663 | 8/9
35 h-m-p 1.0825 8.0000 0.1465 ------------C 262.868056 0 0.0000 689 | 8/9
36 h-m-p 0.0160 8.0000 0.0002 -------C 262.868056 0 0.0000 709
Out..
lnL = -262.868056
710 lfun, 2130 eigenQcodon, 8520 P(t)
Time used: 0:03
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027839 0.012217 0.046133 0.100374 0.017438 0.068943 0.169438 1.055724 0.387671 0.205973 1.480052
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 10.915128
np = 11
lnL0 = -279.688611
Iterating by ming2
Initial: fx= 279.688611
x= 0.02784 0.01222 0.04613 0.10037 0.01744 0.06894 0.16944 1.05572 0.38767 0.20597 1.48005
1 h-m-p 0.0000 0.0002 142.1398 +++ 275.402144 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0007 53.3184 ++ 273.702124 m 0.0007 31 | 2/11
3 h-m-p 0.0001 0.0004 72.3454 ++ 271.458578 m 0.0004 45 | 3/11
4 h-m-p 0.0002 0.0012 73.6342 ++ 268.472407 m 0.0012 59 | 4/11
5 h-m-p 0.0001 0.0003 254.3727 ++ 265.569510 m 0.0003 73 | 5/11
6 h-m-p 0.0000 0.0000 17682.1584 ++ 265.380777 m 0.0000 87 | 6/11
7 h-m-p 0.0021 1.0282 2.3652 ------------.. | 6/11
8 h-m-p 0.0000 0.0006 62.4064 +++ 262.868216 m 0.0006 126 | 7/11
9 h-m-p 1.6000 8.0000 0.0000 ++ 262.868216 m 8.0000 140 | 7/11
10 h-m-p 0.0160 8.0000 0.0139 -------------.. | 7/11
11 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868216 m 8.0000 190 | 7/11
12 h-m-p 0.0001 0.0735 4.4944 --------C 262.868216 0 0.0000 216 | 7/11
13 h-m-p 0.0160 8.0000 0.0008 +++++ 262.868216 m 8.0000 233 | 7/11
14 h-m-p 0.0035 0.3012 1.8909 ----------Y 262.868216 0 0.0000 261 | 7/11
15 h-m-p 0.0160 8.0000 0.0003 +++++ 262.868216 m 8.0000 278 | 7/11
16 h-m-p 0.0015 0.4020 1.7065 -----------.. | 7/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868216 m 8.0000 322 | 7/11
18 h-m-p 0.0058 2.9068 0.1177 --------Y 262.868216 0 0.0000 348 | 7/11
19 h-m-p 0.0160 8.0000 0.0007 +++++ 262.868216 m 8.0000 369 | 7/11
20 h-m-p 0.0024 0.1760 2.3966 ----------Y 262.868216 0 0.0000 397 | 7/11
21 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868216 m 8.0000 414 | 7/11
22 h-m-p 0.0160 8.0000 1.2010 -----------C 262.868216 0 0.0000 443 | 7/11
23 h-m-p 0.0160 8.0000 0.0003 +++++ 262.868216 m 8.0000 460 | 7/11
24 h-m-p 0.0160 8.0000 1.1615 -------------.. | 7/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868216 m 8.0000 506 | 7/11
26 h-m-p 0.0160 8.0000 0.0363 -----------Y 262.868216 0 0.0000 535 | 7/11
27 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868216 m 8.0000 556 | 7/11
28 h-m-p 0.0160 8.0000 1.8942 ----------Y 262.868216 0 0.0000 584 | 7/11
29 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868216 m 8.0000 601 | 7/11
30 h-m-p 0.0160 8.0000 0.2043 +++++ 262.868212 m 8.0000 622 | 7/11
31 h-m-p 1.6000 8.0000 0.0084 Y 262.868212 0 2.7611 640 | 7/11
32 h-m-p 1.6000 8.0000 0.0004 ++ 262.868212 m 8.0000 658 | 7/11
33 h-m-p 0.0302 8.0000 0.1185 +++C 262.868212 0 1.9906 679 | 7/11
34 h-m-p 1.6000 8.0000 0.0222 ++ 262.868211 m 8.0000 697 | 7/11
35 h-m-p 0.2079 2.7297 0.8550 ----------Y 262.868211 0 0.0000 725 | 7/11
36 h-m-p 0.0010 0.5229 0.6544 +++++ 262.868209 m 0.5229 746 | 8/11
37 h-m-p 0.1408 6.8501 1.9930 +++ 262.868058 m 6.8501 765 | 9/11
38 h-m-p 1.6000 8.0000 5.2290 ++ 262.868044 m 8.0000 779 | 9/11
39 h-m-p 1.6000 8.0000 0.0000 Y 262.868044 0 1.6000 793 | 9/11
40 h-m-p 0.0160 8.0000 0.0000 N 262.868044 0 0.0160 809
Out..
lnL = -262.868044
810 lfun, 3240 eigenQcodon, 14580 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -262.889847 S = -262.868482 -0.008198
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:06
did 20 / 35 patterns 0:06
did 30 / 35 patterns 0:06
did 35 / 35 patterns 0:06
Time used: 0:06
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.046587 0.109237 0.039514 0.020703 0.076125 0.027606 0.000100 0.731594 1.656100
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 20.626441
np = 9
lnL0 = -282.258374
Iterating by ming2
Initial: fx= 282.258374
x= 0.04659 0.10924 0.03951 0.02070 0.07613 0.02761 0.00011 0.73159 1.65610
1 h-m-p 0.0000 0.0000 140.8322 ++ 282.087701 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0276 22.7045 +++++ 272.709132 m 0.0276 29 | 2/9
3 h-m-p 0.0000 0.0000 2017.0497 ++ 271.497284 m 0.0000 41 | 3/9
4 h-m-p 0.0001 0.0005 36.9872 ++ 270.519637 m 0.0005 53 | 4/9
5 h-m-p 0.0003 0.0017 14.4343 ++ 270.191621 m 0.0017 65 | 5/9
6 h-m-p 0.0030 0.0352 5.5395 ------------.. | 5/9
7 h-m-p 0.0000 0.0003 95.2133 +++ 267.352136 m 0.0003 100 | 6/9
8 h-m-p 0.0185 8.0000 1.2784 -------------.. | 6/9
9 h-m-p 0.0000 0.0004 78.1226 +++ 264.602522 m 0.0004 136 | 7/9
10 h-m-p 0.0327 8.0000 0.7321 --------------.. | 7/9
11 h-m-p 0.0000 0.0005 55.9367 +++ 262.868044 m 0.0005 175 | 8/9
12 h-m-p 1.6000 8.0000 0.0000 N 262.868044 0 1.6000 187 | 8/9
13 h-m-p 1.6000 8.0000 0.0000 +Y 262.868044 0 6.4000 201
Out..
lnL = -262.868044
202 lfun, 2222 eigenQcodon, 12120 P(t)
Time used: 0:09
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026916 0.013869 0.026499 0.058956 0.046351 0.030822 0.000100 0.900000 0.884429 1.797310 1.299843
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 16.556904
np = 11
lnL0 = -275.467971
Iterating by ming2
Initial: fx= 275.467971
x= 0.02692 0.01387 0.02650 0.05896 0.04635 0.03082 0.00011 0.90000 0.88443 1.79731 1.29984
1 h-m-p 0.0000 0.0000 144.8381 ++ 274.866217 m 0.0000 16 | 1/11
2 h-m-p 0.0002 0.0199 21.4578 ++++ 268.617944 m 0.0199 32 | 2/11
3 h-m-p 0.0000 0.0001 1213.9099 ++ 265.201194 m 0.0001 46 | 3/11
4 h-m-p 0.0000 0.0002 21.2034 ++ 265.187591 m 0.0002 60 | 4/11
5 h-m-p 0.0000 0.0001 400.9744 ++ 265.101972 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0004 1433.4040 +++ 263.574909 m 0.0004 89 | 6/11
7 h-m-p 0.0004 0.0021 121.2934 ++ 262.868246 m 0.0021 103 | 7/11
8 h-m-p 1.6000 8.0000 0.0006 ++ 262.868246 m 8.0000 117 | 7/11
9 h-m-p 0.0055 0.4142 0.9319 ------------.. | 7/11
10 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868246 m 8.0000 166 | 7/11
11 h-m-p 0.0015 0.7594 0.4894 ----------Y 262.868246 0 0.0000 194 | 7/11
12 h-m-p 0.0160 8.0000 0.0009 +++++ 262.868246 m 8.0000 215 | 7/11
13 h-m-p 0.0126 0.7815 0.5514 ----------C 262.868246 0 0.0000 243 | 7/11
14 h-m-p 0.0160 8.0000 0.0005 +++++ 262.868245 m 8.0000 264 | 7/11
15 h-m-p 0.0078 0.8066 0.5457 ----------C 262.868245 0 0.0000 292 | 7/11
16 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868245 m 8.0000 313 | 7/11
17 h-m-p 0.0027 0.7508 0.6004 ---------C 262.868245 0 0.0000 340 | 7/11
18 h-m-p 0.0160 8.0000 0.0006 +++++ 262.868245 m 8.0000 361 | 7/11
19 h-m-p 0.0079 0.7298 0.6413 ---------C 262.868245 0 0.0000 388 | 7/11
20 h-m-p 0.0160 8.0000 0.0003 --------Y 262.868245 0 0.0000 414 | 7/11
21 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868245 m 8.0000 435 | 7/11
22 h-m-p 0.0021 1.0439 0.6360 ---------Y 262.868245 0 0.0000 462 | 7/11
23 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868245 m 8.0000 483 | 7/11
24 h-m-p 0.0019 0.9702 0.6978 ------------.. | 7/11
25 h-m-p 0.0160 8.0000 0.0000 +++++ 262.868245 m 8.0000 532 | 7/11
26 h-m-p 0.0016 0.8242 0.4692 ----------C 262.868245 0 0.0000 560 | 7/11
27 h-m-p 0.0160 8.0000 0.0166 +++++ 262.868239 m 8.0000 581 | 7/11
28 h-m-p 0.1947 0.9736 0.5433 ---------------.. | 7/11
29 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868239 m 8.0000 633 | 7/11
30 h-m-p 0.0024 1.2154 0.4165 ----------Y 262.868239 0 0.0000 661 | 7/11
31 h-m-p 0.0160 8.0000 0.0103 +++++ 262.868234 m 8.0000 682 | 7/11
32 h-m-p 0.1917 1.3376 0.4315 ---------------.. | 7/11
33 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868234 m 8.0000 734 | 7/11
34 h-m-p 0.0031 1.5619 0.3737 ----------Y 262.868234 0 0.0000 762 | 7/11
35 h-m-p 0.0094 4.6991 0.1022 +++++ 262.868140 m 4.6991 783 | 8/11
36 h-m-p 0.6582 8.0000 0.2491 -------------Y 262.868140 0 0.0000 814 | 8/11
37 h-m-p 0.0160 8.0000 0.0003 -----N 262.868140 0 0.0000 836 | 8/11
38 h-m-p 0.0160 8.0000 0.0001 +++++ 262.868140 m 8.0000 856 | 8/11
39 h-m-p 0.0160 8.0000 0.7201 -----------Y 262.868140 0 0.0000 884 | 8/11
40 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868140 m 8.0000 904 | 8/11
41 h-m-p 0.0037 0.9428 0.4877 ----------Y 262.868140 0 0.0000 931 | 8/11
42 h-m-p 0.0160 8.0000 0.0002 +++++ 262.868140 m 8.0000 951 | 8/11
43 h-m-p 0.0160 8.0000 1.9992 +++++ 262.868119 m 8.0000 971 | 8/11
44 h-m-p 0.0109 0.0545 1137.1225 +
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
+ 262.868045 m 0.0545 985
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 6.011787e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03358) = 5.808997e-161 2000 rounds
| 9/11
45 h-m-p 1.6000 8.0000 1.4845
QuantileBeta(0.15, 0.00500, 3.97065) = 5.913546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.78186) = 6.250976e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
+ 262.868045 m 8.0000 999
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.594592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71894) = 6.372139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
| 9/11
46 h-m-p 0.0252 0.1411 470.5677
QuantileBeta(0.15, 0.00500, 3.40429) = 7.055644e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46037) = 1.039089e-160 2000 rounds
++ 262.868044 m 0.1411 1013 | 10/11
47 h-m-p 1.0000 8.0000 1.7594
QuantileBeta(0.15, 0.00500, 3.71893) = 6.372143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.99711) = 2.423268e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
+ 262.868044 m 8.0000 1027
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.372479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
| 10/11
48 h-m-p 1.5388 7.6940 2.0834
QuantileBeta(0.15, 0.00500, 12.82875) = 1.670800e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.23320) = 1.398287e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.83432) = 1.343502e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 15.98459) = 1.330470e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.02216) = 1.327252e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03156) = 1.326449e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03390) = 1.326249e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03449) = 1.326199e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03464) = 1.326186e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03467) = 1.326183e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03468) = 1.326183e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.372479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
| 10/11
49 h-m-p 0.0160 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
Y 262.868044 0 0.0040 1069
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
Out..
lnL = -262.868044
1070 lfun, 12840 eigenQcodon, 70620 P(t)
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -262.896331 S = -262.868482 -0.012274
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 35 patterns 0:27
did 20 / 35 patterns 0:27
did 30 / 35 patterns 0:27
did 35 / 35 patterns 0:28
QuantileBeta(0.15, 0.00500, 16.03469) = 1.326182e-161 2000 rounds
Time used: 0:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=67
NC_011896_1_WP_007166602_1_202_MLBR_RS00990 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
NC_002677_1_NP_301266_1_138_cspA MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF
**************************************************
NC_011896_1_WP_007166602_1_202_MLBR_RS00990 EIGHSPKGPQATGVRSV
NC_002677_1_NP_301266_1_138_cspA EIGHSPKGPQATGVRSV
NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655 EIGHSPKGPQATGVRSV
NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570 EIGHSPKGPQATGVRSV
NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050 EIGHSPKGPQATGVRSV
NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080 EIGHSPKGPQATGVRSV
*****************
>NC_011896_1_WP_007166602_1_202_MLBR_RS00990 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C >NC_002677_1_NP_301266_1_138_cspA ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C >NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C >NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C >NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C >NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080 ATGCCACAGGGAACTGTGAAGTGGTTCAACGCGGAGAAGGGGTTCGGCTT TATCGCCCCCGAAGACGGTTCTGCGGATGTTTTTGTCCACTACACTGAGA TTCAGGGTTCGGGCTTCCGCACCCTTGAAGAGAACCAGAAGGTCGAGTTT GAGATCGGCCACAGCCCCAAGGGCCCCCAAGCCACTGGAGTTCGCTCCGT C
>NC_011896_1_WP_007166602_1_202_MLBR_RS00990 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV >NC_002677_1_NP_301266_1_138_cspA MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV >NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV >NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV >NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV >NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080 MPQGTVKWFNAEKGFGFIAPEDGSADVFVHYTEIQGSGFRTLEENQKVEF EIGHSPKGPQATGVRSV
#NEXUS
[ID: 8786924235]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_007166602_1_202_MLBR_RS00990
NC_002677_1_NP_301266_1_138_cspA
NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655
NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570
NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050
NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080
;
end;
begin trees;
translate
1 NC_011896_1_WP_007166602_1_202_MLBR_RS00990,
2 NC_002677_1_NP_301266_1_138_cspA,
3 NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655,
4 NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570,
5 NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050,
6 NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06583689,2:0.07053188,3:0.06691468,4:0.0670754,5:0.06776138,6:0.06828647);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06583689,2:0.07053188,3:0.06691468,4:0.0670754,5:0.06776138,6:0.06828647);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -277.92 -280.87
2 -277.92 -281.19
--------------------------------------
TOTAL -277.92 -281.04
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/1res/cspA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.886290 0.091671 0.367363 1.527304 0.849951 1330.19 1400.61 1.000
r(A<->C){all} 0.171482 0.020879 0.000060 0.443435 0.133224 137.58 247.18 1.000
r(A<->G){all} 0.170099 0.021387 0.000020 0.471578 0.129353 155.07 160.26 1.003
r(A<->T){all} 0.174474 0.021613 0.000002 0.467150 0.135024 186.45 203.57 1.002
r(C<->G){all} 0.157900 0.018490 0.000060 0.430618 0.119455 307.49 312.62 1.000
r(C<->T){all} 0.161085 0.019075 0.000036 0.434949 0.123345 180.85 218.43 1.000
r(G<->T){all} 0.164961 0.019867 0.000042 0.450440 0.123252 154.00 203.51 1.000
pi(A){all} 0.215695 0.000825 0.163431 0.271397 0.214772 868.63 1136.12 1.000
pi(C){all} 0.277008 0.000967 0.218965 0.339891 0.275526 1162.25 1166.39 1.000
pi(G){all} 0.296982 0.001013 0.239065 0.361990 0.296544 1075.73 1135.08 1.000
pi(T){all} 0.210315 0.000797 0.157455 0.263733 0.209736 1447.53 1463.73 1.000
alpha{1,2} 0.413733 0.230972 0.000154 1.349037 0.246623 1067.75 1088.14 1.001
alpha{3} 0.463617 0.230946 0.000107 1.426167 0.308358 1030.13 1150.39 1.000
pinvar{all} 0.991693 0.000102 0.972132 0.999998 0.995013 971.68 1047.88 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/1res/cspA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 67
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 3 3 | Ser TCT 1 1 1 1 1 1 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 3 3 3 3 3 3 | TCC 1 1 1 1 1 1 | TAC 1 1 1 1 1 1 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 0 0 0 0 0 0 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 0 0 0 0 0 0 | Arg CGT 0 0 0 0 0 0
CTC 0 0 0 0 0 0 | CCC 3 3 3 3 3 3 | CAC 2 2 2 2 2 2 | CGC 2 2 2 2 2 2
CTA 0 0 0 0 0 0 | CCA 1 1 1 1 1 1 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 0 0 0 0 0 0 | CCG 0 0 0 0 0 0 | CAG 3 3 3 3 3 3 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 1 1 1 1 1 1 | Thr ACT 3 3 3 3 3 3 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 1 1 1 1 1 1 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 0 0 0 0 0 0 | Arg AGA 0 0 0 0 0 0
Met ATG 1 1 1 1 1 1 | ACG 0 0 0 0 0 0 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 2 2 2 2 2 2
GTC 3 3 3 3 3 3 | GCC 2 2 2 2 2 2 | GAC 1 1 1 1 1 1 | GGC 4 4 4 4 4 4
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 1 1 1 1 1 1 | GCG 2 2 2 2 2 2 | GAG 5 5 5 5 5 5 | GGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_007166602_1_202_MLBR_RS00990
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
#2: NC_002677_1_NP_301266_1_138_cspA
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
#3: NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
#4: NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
#5: NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
#6: NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 18 | Ser S TCT 6 | Tyr Y TAT 0 | Cys C TGT 0
TTC 18 | TCC 6 | TAC 6 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 0 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 0 | Arg R CGT 0
CTC 0 | CCC 18 | CAC 12 | CGC 12
CTA 0 | CCA 6 | Gln Q CAA 6 | CGA 0
CTG 0 | CCG 0 | CAG 18 | CGG 0
------------------------------------------------------------------------------
Ile I ATT 6 | Thr T ACT 18 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 6 | AAC 12 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 0 | Arg R AGA 0
Met M ATG 6 | ACG 0 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 12 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 12
GTC 18 | GCC 12 | GAC 6 | GGC 24
GTA 0 | GCA 0 | Glu E GAA 12 | GGA 12
GTG 6 | GCG 12 | GAG 30 | GGG 6
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16418 C:0.19403 A:0.22388 G:0.41791
position 2: T:0.25373 C:0.22388 A:0.32836 G:0.19403
position 3: T:0.20896 C:0.41791 A:0.08955 G:0.28358
Average T:0.20896 C:0.27861 A:0.21393 G:0.29851
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -262.868244 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300110 1.299843
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_007166602_1_202_MLBR_RS00990: 0.000004, NC_002677_1_NP_301266_1_138_cspA: 0.000004, NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655: 0.000004, NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570: 0.000004, NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050: 0.000004, NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30011
omega (dN/dS) = 1.29984
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
7..2 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
7..3 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
7..4 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
7..5 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
7..6 0.000 165.7 35.3 1.2998 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -262.868056 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.169438 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_007166602_1_202_MLBR_RS00990: 0.000004, NC_002677_1_NP_301266_1_138_cspA: 0.000004, NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655: 0.000004, NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570: 0.000004, NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050: 0.000004, NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.16944
MLEs of dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 167.2 33.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:03
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -262.868044 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_007166602_1_202_MLBR_RS00990: 0.000004, NC_002677_1_NP_301266_1_138_cspA: 0.000004, NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655: 0.000004, NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570: 0.000004, NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050: 0.000004, NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_007166602_1_202_MLBR_RS00990)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.101 0.101 0.101 0.100 0.100 0.100 0.100 0.099 0.099 0.099
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:06
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -262.868044 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.719876
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_007166602_1_202_MLBR_RS00990: 0.000004, NC_002677_1_NP_301266_1_138_cspA: 0.000004, NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655: 0.000004, NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570: 0.000004, NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050: 0.000004, NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.71988
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -262.868044 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 16.034687 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_007166602_1_202_MLBR_RS00990: 0.000004, NC_002677_1_NP_301266_1_138_cspA: 0.000004, NZ_LVXE01000064_1_WP_007166602_1_2434_A3216_RS12655: 0.000004, NZ_LYPH01000068_1_WP_007166602_1_2406_A8144_RS11570: 0.000004, NZ_CP029543_1_WP_007166602_1_203_DIJ64_RS01050: 0.000004, NZ_AP014567_1_WP_007166602_1_209_JK2ML_RS01080: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 16.03469
(p1 = 0.00001) w = 1.00000
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 169.4 31.6 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_007166602_1_202_MLBR_RS00990)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.098 0.098 0.099 0.099 0.100 0.100 0.101 0.101 0.102 0.102
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Time used: 0:28
Model 1: NearlyNeutral -262.868056 Model 2: PositiveSelection -262.868044 Model 0: one-ratio -262.868244 Model 7: beta -262.868044 Model 8: beta&w>1 -262.868044 Model 0 vs 1 3.7599999996018596E-4 Model 2 vs 1 2.4000000053092663E-5 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
