--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:07:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsO/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -366.04 -370.68
2 -366.10 -369.37
--------------------------------------
TOTAL -366.07 -370.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887569 0.086489 0.359264 1.461230 0.858873 1501.00 1501.00 1.000
r(A<->C){all} 0.161625 0.017890 0.000001 0.420022 0.127798 170.79 190.61 1.000
r(A<->G){all} 0.175494 0.022005 0.000181 0.480996 0.138477 110.53 155.61 1.011
r(A<->T){all} 0.161499 0.017441 0.000001 0.420945 0.130394 217.25 222.52 1.000
r(C<->G){all} 0.156043 0.016683 0.000011 0.410048 0.125854 190.05 257.50 1.000
r(C<->T){all} 0.179838 0.021225 0.000021 0.479659 0.145186 160.73 175.11 1.001
r(G<->T){all} 0.165501 0.019680 0.000103 0.446196 0.126693 200.45 271.80 1.000
pi(A){all} 0.202998 0.000587 0.157728 0.250342 0.202472 1191.24 1217.94 1.000
pi(C){all} 0.288494 0.000773 0.232430 0.341451 0.288371 1039.69 1150.68 1.000
pi(G){all} 0.313013 0.000810 0.257231 0.367407 0.312416 1009.63 1136.80 1.001
pi(T){all} 0.195495 0.000610 0.147633 0.244896 0.194798 1164.11 1244.49 1.000
alpha{1,2} 0.403119 0.251401 0.000114 1.383848 0.230454 1020.20 1175.93 1.000
alpha{3} 0.445938 0.233448 0.000107 1.431139 0.288239 1192.95 1325.74 1.000
pinvar{all} 0.993354 0.000063 0.978507 0.999997 0.996012 1179.15 1216.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -343.89273
Model 2: PositiveSelection -343.892718
Model 0: one-ratio -343.892723
Model 7: beta -343.892735
Model 8: beta&w>1 -343.892713
Model 0 vs 1 1.3999999964653398E-5
Model 2 vs 1 2.3999999939405825E-5
Model 8 vs 7 4.400000000259752E-5
>C1
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C2
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C3
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C4
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C5
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C6
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=89
C1 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C2 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C3 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C4 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C5 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C6 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
**************************************************
C1 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C2 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C3 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C4 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C5 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C6 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
***************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 89 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 89 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2670]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2670]--->[2670]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.420 Mb, Max= 30.581 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C2 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C3 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C4 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C5 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C6 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
**************************************************
C1 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C2 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C3 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C4 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C5 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C6 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
***************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C2 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C3 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C4 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C5 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C6 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
**************************************************
C1 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C2 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C3 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C4 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C5 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C6 GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
**************************************************
C1 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C2 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C3 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C4 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C5 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C6 AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
**************************************************
C1 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C2 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C3 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C4 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C5 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C6 CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
**************************************************
C1 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C2 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C3 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C4 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C5 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C6 CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
**************************************************
C1 GGCTTGGTCTGCGCCGC
C2 GGCTTGGTCTGCGCCGC
C3 GGCTTGGTCTGCGCCGC
C4 GGCTTGGTCTGCGCCGC
C5 GGCTTGGTCTGCGCCGC
C6 GGCTTGGTCTGCGCCGC
*****************
>C1
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C2
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C3
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C4
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C5
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C6
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C1
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C2
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C3
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C4
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C5
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C6
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 267 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788371
Setting output file names to "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 697967409
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0007126144
Seed = 1594254976
Swapseed = 1579788371
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -597.558800 -- -24.965149
Chain 2 -- -597.558709 -- -24.965149
Chain 3 -- -597.558800 -- -24.965149
Chain 4 -- -597.558800 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -597.558800 -- -24.965149
Chain 2 -- -597.558800 -- -24.965149
Chain 3 -- -597.558800 -- -24.965149
Chain 4 -- -597.558800 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-597.559] (-597.559) (-597.559) (-597.559) * [-597.559] (-597.559) (-597.559) (-597.559)
500 -- [-373.584] (-381.496) (-389.291) (-381.859) * [-374.454] (-371.260) (-371.082) (-376.200) -- 0:00:00
1000 -- (-374.092) [-383.192] (-379.807) (-378.140) * (-373.723) (-377.892) (-375.866) [-378.969] -- 0:00:00
1500 -- (-382.000) (-375.506) (-389.223) [-368.915] * (-378.965) (-387.533) (-380.775) [-375.564] -- 0:00:00
2000 -- (-372.746) [-376.149] (-383.792) (-375.100) * (-375.029) (-375.104) [-373.926] (-372.637) -- 0:00:00
2500 -- (-385.216) (-375.627) (-375.365) [-379.629] * [-377.521] (-371.236) (-375.021) (-379.073) -- 0:00:00
3000 -- (-373.968) [-372.109] (-374.451) (-374.019) * (-373.671) (-370.600) [-380.304] (-379.140) -- 0:00:00
3500 -- (-381.060) (-373.603) (-390.375) [-380.152] * (-372.016) (-379.451) (-373.576) [-373.688] -- 0:00:00
4000 -- [-377.683] (-378.146) (-380.296) (-381.941) * (-376.608) [-375.604] (-380.451) (-374.349) -- 0:00:00
4500 -- (-374.926) (-376.453) (-376.156) [-370.575] * (-379.925) (-371.818) [-377.284] (-374.995) -- 0:00:00
5000 -- (-375.026) (-383.707) (-379.059) [-376.862] * (-380.320) (-377.723) (-378.527) [-374.643] -- 0:03:19
Average standard deviation of split frequencies: 0.088815
5500 -- (-378.326) (-378.816) [-375.248] (-375.169) * (-375.261) (-378.544) [-377.237] (-371.167) -- 0:03:00
6000 -- (-373.935) [-374.291] (-372.614) (-374.437) * (-388.524) (-374.902) (-385.007) [-371.839] -- 0:02:45
6500 -- (-374.341) [-377.163] (-373.802) (-383.102) * (-379.890) (-381.922) [-371.726] (-372.821) -- 0:02:32
7000 -- (-384.388) (-370.898) (-377.230) [-373.420] * (-377.807) (-375.790) (-376.347) [-375.973] -- 0:02:21
7500 -- (-370.838) [-373.625] (-370.883) (-378.491) * (-375.621) (-378.104) [-376.033] (-377.780) -- 0:02:12
8000 -- (-375.440) [-374.456] (-377.098) (-379.560) * (-381.145) [-377.487] (-379.306) (-386.417) -- 0:02:04
8500 -- (-379.890) (-377.041) [-373.627] (-378.895) * (-375.190) (-378.131) (-372.106) [-372.791] -- 0:01:56
9000 -- (-383.414) (-391.771) (-379.657) [-373.950] * [-374.258] (-373.783) (-377.841) (-375.376) -- 0:01:50
9500 -- (-376.487) [-370.244] (-372.425) (-379.547) * (-381.796) [-372.708] (-375.162) (-383.967) -- 0:01:44
10000 -- (-370.723) [-366.016] (-372.910) (-376.591) * [-374.141] (-377.087) (-382.701) (-372.559) -- 0:01:39
Average standard deviation of split frequencies: 0.083736
10500 -- (-367.562) [-365.555] (-373.565) (-370.786) * (-372.854) (-374.876) (-369.242) [-371.026] -- 0:01:34
11000 -- (-366.528) [-367.048] (-379.247) (-381.521) * (-371.479) (-377.113) [-364.477] (-378.670) -- 0:01:29
11500 -- [-366.465] (-369.953) (-372.830) (-371.280) * [-370.548] (-373.110) (-366.884) (-382.415) -- 0:01:25
12000 -- (-365.628) (-364.650) [-380.999] (-374.867) * [-370.892] (-373.363) (-366.545) (-367.102) -- 0:01:22
12500 -- [-369.470] (-371.584) (-378.151) (-374.908) * [-374.508] (-373.106) (-368.210) (-366.864) -- 0:01:19
13000 -- [-365.360] (-366.542) (-376.523) (-373.314) * (-374.103) (-374.768) (-367.076) [-368.286] -- 0:01:15
13500 -- (-365.368) (-368.087) (-389.464) [-374.412] * (-387.108) (-377.589) (-365.899) [-367.762] -- 0:01:13
14000 -- (-365.957) (-369.351) (-378.726) [-372.785] * (-386.765) (-380.171) [-364.826] (-365.745) -- 0:01:10
14500 -- (-367.875) [-365.594] (-373.607) (-372.756) * (-384.055) (-374.507) [-365.127] (-368.218) -- 0:01:07
15000 -- [-365.613] (-368.047) (-371.829) (-374.307) * (-381.513) [-374.549] (-365.150) (-367.539) -- 0:01:05
Average standard deviation of split frequencies: 0.057452
15500 -- (-374.496) [-366.414] (-365.668) (-374.761) * (-380.517) (-375.602) (-366.262) [-366.729] -- 0:01:03
16000 -- (-371.681) [-367.091] (-365.458) (-375.257) * (-383.004) [-381.282] (-369.174) (-365.263) -- 0:01:01
16500 -- (-369.866) (-365.081) (-368.079) [-371.785] * (-379.443) (-391.421) (-367.297) [-365.334] -- 0:00:59
17000 -- (-368.175) [-366.189] (-369.637) (-381.786) * (-380.188) [-378.312] (-364.723) (-368.006) -- 0:00:57
17500 -- [-365.103] (-366.927) (-366.719) (-380.879) * (-378.799) (-377.432) [-367.436] (-370.393) -- 0:00:56
18000 -- [-365.061] (-365.865) (-369.260) (-372.646) * (-373.879) (-374.153) (-367.424) [-366.032] -- 0:00:54
18500 -- (-367.756) [-366.745] (-365.196) (-371.158) * (-380.414) (-373.593) (-371.217) [-364.718] -- 0:00:53
19000 -- (-372.232) (-368.371) [-365.429] (-382.799) * (-381.990) (-381.851) [-366.098] (-368.332) -- 0:00:51
19500 -- (-368.427) (-368.378) [-366.639] (-381.592) * (-389.898) (-374.895) [-368.836] (-368.947) -- 0:00:50
20000 -- [-364.747] (-368.960) (-367.440) (-378.968) * (-385.528) [-376.658] (-366.751) (-366.086) -- 0:00:49
Average standard deviation of split frequencies: 0.045620
20500 -- [-366.257] (-367.862) (-368.103) (-377.020) * (-375.738) (-379.330) (-367.182) [-367.456] -- 0:01:35
21000 -- (-369.049) (-370.247) (-368.370) [-375.584] * (-370.806) (-374.081) [-371.312] (-367.087) -- 0:01:33
21500 -- (-367.262) (-366.915) [-364.867] (-379.844) * (-367.162) (-375.924) [-373.310] (-368.105) -- 0:01:31
22000 -- (-366.653) (-367.576) [-366.892] (-373.657) * (-365.799) (-373.391) (-371.881) [-367.903] -- 0:01:28
22500 -- (-365.675) (-366.277) [-366.938] (-379.617) * (-364.953) [-375.478] (-368.052) (-366.073) -- 0:01:26
23000 -- (-366.799) (-367.152) [-365.256] (-377.602) * [-366.979] (-382.299) (-366.273) (-367.240) -- 0:01:24
23500 -- (-367.126) (-365.886) [-365.770] (-383.081) * (-369.509) (-380.073) (-369.083) [-367.842] -- 0:01:23
24000 -- [-366.795] (-366.738) (-365.911) (-374.782) * [-365.926] (-386.557) (-365.678) (-364.786) -- 0:01:21
24500 -- (-364.668) (-368.848) [-365.768] (-378.512) * (-365.244) [-370.941] (-369.667) (-366.099) -- 0:01:19
25000 -- (-365.184) (-365.686) [-368.748] (-374.052) * [-366.019] (-368.033) (-373.921) (-368.319) -- 0:01:18
Average standard deviation of split frequencies: 0.031082
25500 -- (-367.590) [-368.360] (-367.446) (-373.693) * (-366.812) [-368.332] (-371.743) (-368.303) -- 0:01:16
26000 -- (-365.302) (-365.999) [-364.969] (-376.913) * (-366.661) [-365.255] (-369.422) (-367.576) -- 0:01:14
26500 -- (-366.746) (-369.030) [-366.647] (-373.193) * (-368.117) [-367.360] (-365.765) (-369.699) -- 0:01:13
27000 -- (-368.011) (-366.964) (-365.741) [-370.611] * (-366.095) (-366.070) [-368.981] (-369.652) -- 0:01:12
27500 -- (-366.455) (-364.891) [-369.100] (-380.480) * (-367.214) (-365.281) (-367.351) [-366.130] -- 0:01:10
28000 -- (-367.685) [-364.705] (-369.013) (-377.247) * (-368.187) [-368.434] (-366.091) (-365.679) -- 0:01:09
28500 -- [-366.701] (-365.924) (-365.936) (-374.534) * (-372.176) [-366.658] (-365.962) (-365.421) -- 0:01:08
29000 -- (-366.839) (-365.561) (-369.616) [-373.460] * (-368.814) (-366.954) (-364.672) [-366.744] -- 0:01:06
29500 -- (-365.118) [-364.777] (-369.578) (-375.335) * [-366.978] (-368.484) (-365.506) (-366.283) -- 0:01:05
30000 -- [-367.134] (-365.455) (-369.478) (-379.789) * (-365.687) (-370.192) [-366.774] (-365.798) -- 0:01:04
Average standard deviation of split frequencies: 0.035136
30500 -- (-366.468) [-367.834] (-367.512) (-383.542) * (-364.939) (-366.048) [-369.856] (-364.765) -- 0:01:03
31000 -- (-368.020) (-368.516) [-368.406] (-387.030) * (-367.905) (-366.875) (-366.146) [-365.798] -- 0:01:02
31500 -- (-365.126) (-370.479) (-366.637) [-380.312] * [-365.707] (-365.837) (-366.561) (-366.494) -- 0:01:01
32000 -- (-368.450) (-366.722) (-366.488) [-382.681] * (-366.712) [-368.464] (-365.453) (-371.596) -- 0:01:00
32500 -- (-367.123) [-365.442] (-370.081) (-379.293) * (-366.344) [-369.350] (-369.830) (-364.982) -- 0:00:59
33000 -- [-367.405] (-364.887) (-368.101) (-387.068) * [-368.349] (-367.453) (-371.798) (-366.769) -- 0:00:58
33500 -- [-365.815] (-365.276) (-366.577) (-381.583) * (-369.666) [-367.823] (-370.943) (-365.697) -- 0:00:57
34000 -- (-372.227) [-365.304] (-365.922) (-373.175) * (-370.067) [-369.099] (-365.497) (-370.536) -- 0:00:56
34500 -- (-367.341) (-364.873) [-367.371] (-375.787) * (-367.063) [-367.990] (-367.948) (-376.031) -- 0:00:55
35000 -- (-364.774) (-365.891) [-367.540] (-367.289) * (-365.905) (-367.087) [-366.402] (-371.970) -- 0:00:55
Average standard deviation of split frequencies: 0.039907
35500 -- [-367.867] (-365.401) (-366.185) (-365.337) * [-367.903] (-365.642) (-365.861) (-365.273) -- 0:00:54
36000 -- (-366.305) (-368.525) [-370.841] (-370.662) * (-367.969) (-366.602) [-366.251] (-365.872) -- 0:01:20
36500 -- (-367.242) [-367.626] (-366.300) (-371.787) * (-371.925) (-365.776) [-365.533] (-365.654) -- 0:01:19
37000 -- [-368.400] (-366.028) (-369.990) (-372.257) * [-365.558] (-365.806) (-368.638) (-365.380) -- 0:01:18
37500 -- (-366.645) (-364.478) (-367.317) [-366.767] * (-365.185) [-369.497] (-371.280) (-367.819) -- 0:01:17
38000 -- (-365.420) (-369.724) (-366.167) [-367.508] * (-365.299) (-364.900) (-368.077) [-367.682] -- 0:01:15
38500 -- (-368.308) (-366.981) (-368.594) [-369.261] * [-366.180] (-369.179) (-369.049) (-368.908) -- 0:01:14
39000 -- (-368.108) (-367.050) (-366.053) [-365.733] * (-365.629) (-368.948) (-366.683) [-364.872] -- 0:01:13
39500 -- (-369.416) [-366.070] (-367.541) (-365.684) * (-366.222) (-365.553) (-367.213) [-365.604] -- 0:01:12
40000 -- (-371.041) (-366.072) [-366.354] (-365.564) * (-366.998) (-367.877) (-368.427) [-368.168] -- 0:01:12
Average standard deviation of split frequencies: 0.035355
40500 -- (-365.487) (-364.675) (-365.349) [-365.027] * (-366.370) (-369.124) (-366.326) [-365.797] -- 0:01:11
41000 -- (-365.635) [-364.836] (-367.277) (-368.079) * (-368.463) (-369.458) [-365.927] (-365.362) -- 0:01:10
41500 -- (-365.862) (-368.255) (-366.354) [-368.056] * (-369.910) (-364.904) [-366.749] (-368.724) -- 0:01:09
42000 -- (-366.054) [-367.182] (-366.592) (-365.336) * (-368.565) (-365.486) [-369.102] (-369.948) -- 0:01:08
42500 -- (-366.049) (-368.998) (-366.535) [-365.400] * [-364.940] (-366.844) (-366.794) (-367.378) -- 0:01:07
43000 -- (-369.466) (-369.004) (-369.409) [-367.442] * (-365.768) (-366.134) (-368.009) [-365.488] -- 0:01:06
43500 -- (-368.505) (-365.605) [-371.142] (-365.731) * (-365.558) [-369.472] (-367.414) (-368.194) -- 0:01:05
44000 -- [-369.186] (-366.142) (-365.506) (-366.352) * (-367.433) (-368.703) (-367.119) [-368.232] -- 0:01:05
44500 -- (-364.770) [-366.566] (-365.615) (-366.392) * (-367.055) (-366.505) [-367.369] (-368.893) -- 0:01:04
45000 -- (-365.200) [-365.417] (-365.557) (-367.725) * (-367.989) (-367.173) [-365.436] (-365.741) -- 0:01:03
Average standard deviation of split frequencies: 0.034843
45500 -- [-365.364] (-368.240) (-365.105) (-370.250) * (-369.361) (-365.100) [-365.772] (-366.173) -- 0:01:02
46000 -- (-365.879) (-367.866) (-367.001) [-365.346] * (-366.579) [-368.550] (-366.792) (-367.802) -- 0:01:02
46500 -- (-366.203) [-367.485] (-366.452) (-365.042) * (-365.777) (-366.025) [-366.622] (-369.428) -- 0:01:01
47000 -- (-367.782) [-366.236] (-369.109) (-372.878) * (-364.539) (-371.199) (-367.003) [-366.831] -- 0:01:00
47500 -- (-369.085) [-367.071] (-367.678) (-370.560) * (-364.821) [-372.232] (-370.372) (-366.285) -- 0:01:00
48000 -- (-366.739) (-365.605) [-365.939] (-367.009) * [-365.006] (-368.807) (-365.915) (-366.515) -- 0:00:59
48500 -- [-366.184] (-364.662) (-365.018) (-367.205) * (-365.872) (-369.919) [-365.809] (-365.693) -- 0:00:58
49000 -- [-366.155] (-370.630) (-366.921) (-365.644) * (-367.111) (-368.333) [-367.808] (-365.800) -- 0:00:58
49500 -- (-365.781) (-369.147) (-364.523) [-366.118] * [-366.676] (-366.832) (-365.175) (-365.239) -- 0:00:57
50000 -- (-369.041) (-367.448) (-364.512) [-366.408] * (-365.914) (-366.184) [-365.169] (-366.660) -- 0:00:57
Average standard deviation of split frequencies: 0.030361
50500 -- [-368.177] (-367.642) (-365.401) (-366.264) * (-365.294) (-367.347) (-366.500) [-367.835] -- 0:00:56
51000 -- (-367.522) (-368.568) (-366.524) [-366.421] * [-365.962] (-367.371) (-366.763) (-365.465) -- 0:01:14
51500 -- (-367.294) (-367.308) (-366.753) [-364.874] * (-365.221) (-368.654) (-370.553) [-367.299] -- 0:01:13
52000 -- (-364.933) [-366.044] (-367.044) (-366.501) * [-365.732] (-366.022) (-367.038) (-366.894) -- 0:01:12
52500 -- (-366.593) [-365.101] (-366.068) (-367.879) * (-365.425) (-365.195) [-370.784] (-366.529) -- 0:01:12
53000 -- [-365.589] (-366.802) (-367.489) (-371.995) * [-366.505] (-366.585) (-371.727) (-367.303) -- 0:01:11
53500 -- (-365.948) (-368.770) [-371.451] (-367.267) * [-365.309] (-366.140) (-371.801) (-366.426) -- 0:01:10
54000 -- (-366.139) (-371.482) [-366.675] (-366.987) * (-366.714) (-367.027) (-368.776) [-365.553] -- 0:01:10
54500 -- [-367.686] (-366.956) (-368.450) (-365.656) * (-367.672) (-370.386) [-366.970] (-366.335) -- 0:01:09
55000 -- (-366.778) (-367.228) (-364.835) [-369.265] * (-366.881) (-365.902) (-366.274) [-366.781] -- 0:01:08
Average standard deviation of split frequencies: 0.028355
55500 -- [-369.150] (-367.843) (-366.391) (-367.609) * (-368.218) [-366.384] (-366.518) (-365.579) -- 0:01:08
56000 -- (-366.295) [-367.095] (-366.567) (-367.686) * (-367.404) (-366.764) (-369.502) [-366.508] -- 0:01:07
56500 -- [-364.755] (-366.018) (-365.742) (-368.098) * (-368.117) [-367.186] (-367.330) (-365.949) -- 0:01:06
57000 -- (-368.428) (-369.655) (-366.542) [-367.918] * [-366.856] (-368.101) (-369.131) (-367.365) -- 0:01:06
57500 -- [-365.921] (-368.527) (-369.056) (-368.090) * [-369.521] (-365.002) (-366.322) (-365.851) -- 0:01:05
58000 -- (-364.963) [-368.391] (-365.799) (-367.668) * [-366.023] (-367.649) (-370.024) (-365.955) -- 0:01:04
58500 -- (-366.981) [-369.711] (-366.809) (-367.857) * (-370.662) [-367.115] (-367.320) (-366.586) -- 0:01:04
59000 -- (-366.044) [-366.794] (-365.810) (-365.998) * (-368.942) (-369.215) [-365.931] (-367.558) -- 0:01:03
59500 -- (-367.911) (-368.678) [-364.854] (-367.267) * [-367.520] (-371.127) (-368.049) (-369.810) -- 0:01:03
60000 -- [-368.690] (-367.210) (-366.678) (-366.127) * (-365.029) (-370.357) [-368.082] (-368.617) -- 0:01:02
Average standard deviation of split frequencies: 0.031513
60500 -- (-366.150) [-365.206] (-368.809) (-365.572) * [-365.353] (-369.036) (-368.923) (-365.229) -- 0:01:02
61000 -- (-366.752) [-367.665] (-367.206) (-369.545) * [-369.540] (-365.332) (-366.839) (-364.991) -- 0:01:01
61500 -- (-367.370) [-365.480] (-366.402) (-368.882) * (-369.932) (-365.846) (-367.448) [-364.743] -- 0:01:01
62000 -- (-371.638) [-366.304] (-368.908) (-367.271) * (-366.525) [-365.841] (-369.690) (-366.356) -- 0:01:00
62500 -- (-366.850) [-365.007] (-365.170) (-366.577) * (-368.814) (-365.209) [-365.794] (-364.802) -- 0:01:00
63000 -- [-367.064] (-365.150) (-366.271) (-368.912) * (-366.507) [-364.916] (-369.139) (-365.306) -- 0:00:59
63500 -- (-368.043) (-365.776) [-369.757] (-366.489) * [-365.721] (-367.112) (-368.779) (-365.210) -- 0:00:58
64000 -- (-367.464) [-367.109] (-370.369) (-365.327) * (-369.932) (-366.739) [-366.401] (-366.918) -- 0:00:58
64500 -- (-365.796) [-365.623] (-365.745) (-365.604) * (-365.322) [-365.649] (-366.498) (-365.778) -- 0:00:58
65000 -- (-369.587) [-367.002] (-366.173) (-367.672) * [-367.420] (-366.547) (-368.217) (-366.345) -- 0:00:57
Average standard deviation of split frequencies: 0.026189
65500 -- (-366.685) [-366.023] (-368.647) (-366.048) * (-365.279) [-365.761] (-365.515) (-366.219) -- 0:00:57
66000 -- (-369.125) [-368.079] (-365.081) (-370.538) * [-365.289] (-366.876) (-368.192) (-367.965) -- 0:00:56
66500 -- [-367.156] (-366.621) (-366.448) (-368.068) * (-365.825) (-373.954) [-365.924] (-366.790) -- 0:01:10
67000 -- (-367.829) (-367.794) [-368.325] (-366.229) * (-367.630) (-370.596) (-367.976) [-366.929] -- 0:01:09
67500 -- (-370.012) [-368.887] (-370.180) (-365.322) * (-368.519) [-367.002] (-370.502) (-364.629) -- 0:01:09
68000 -- (-368.455) (-369.238) [-368.210] (-366.499) * (-365.966) (-366.075) [-365.855] (-365.316) -- 0:01:08
68500 -- (-364.444) (-373.339) [-366.568] (-368.734) * [-366.038] (-364.416) (-365.412) (-367.337) -- 0:01:07
69000 -- (-367.085) (-368.564) [-365.549] (-367.258) * (-366.895) (-367.174) [-365.982] (-366.436) -- 0:01:07
69500 -- (-366.914) [-368.119] (-366.851) (-368.423) * (-369.000) (-368.192) (-367.413) [-367.331] -- 0:01:06
70000 -- [-368.112] (-365.344) (-367.117) (-369.735) * (-371.147) (-367.977) [-366.342] (-365.922) -- 0:01:06
Average standard deviation of split frequencies: 0.026366
70500 -- (-368.756) (-366.884) (-366.449) [-366.633] * [-365.000] (-370.556) (-371.292) (-365.789) -- 0:01:05
71000 -- (-366.109) (-367.716) (-370.989) [-368.893] * (-366.242) (-367.946) [-365.184] (-366.362) -- 0:01:05
71500 -- [-365.146] (-373.349) (-369.094) (-366.667) * (-366.850) [-367.257] (-370.017) (-366.007) -- 0:01:04
72000 -- (-365.077) (-368.371) [-366.594] (-366.078) * [-368.041] (-365.628) (-367.763) (-365.962) -- 0:01:04
72500 -- (-367.716) (-368.417) [-366.801] (-369.269) * (-367.093) (-366.070) (-366.758) [-367.638] -- 0:01:03
73000 -- (-367.352) (-367.512) (-366.459) [-367.009] * (-367.531) (-368.723) [-365.050] (-365.224) -- 0:01:03
73500 -- (-365.313) [-366.101] (-367.559) (-366.268) * (-365.544) (-366.058) [-364.629] (-364.979) -- 0:01:03
74000 -- (-365.639) (-366.966) [-366.022] (-368.615) * (-365.475) (-366.404) (-369.947) [-367.247] -- 0:01:02
74500 -- [-364.879] (-367.481) (-365.586) (-367.094) * (-366.293) [-367.866] (-372.206) (-369.241) -- 0:01:02
75000 -- (-366.070) (-366.477) (-366.445) [-365.799] * [-368.364] (-367.511) (-365.271) (-369.677) -- 0:01:01
Average standard deviation of split frequencies: 0.028532
75500 -- (-367.419) (-365.700) [-366.143] (-366.861) * [-367.550] (-366.015) (-368.922) (-365.007) -- 0:01:01
76000 -- (-366.704) (-365.626) (-366.779) [-368.157] * (-366.978) (-365.492) (-369.514) [-364.899] -- 0:01:00
76500 -- (-366.683) (-365.735) [-365.689] (-370.771) * (-370.871) [-364.824] (-373.671) (-367.066) -- 0:01:00
77000 -- (-368.571) (-366.140) (-366.901) [-367.390] * (-367.080) (-368.038) (-368.341) [-366.749] -- 0:00:59
77500 -- (-369.535) (-368.341) [-366.799] (-367.494) * [-367.662] (-365.839) (-371.353) (-367.166) -- 0:00:59
78000 -- (-368.068) (-367.286) [-365.637] (-367.827) * (-367.734) (-368.594) [-368.940] (-366.320) -- 0:00:59
78500 -- (-364.776) (-364.743) (-367.550) [-369.707] * (-366.991) [-368.787] (-370.214) (-369.416) -- 0:00:58
79000 -- [-371.183] (-371.453) (-368.767) (-369.205) * (-374.579) [-365.530] (-368.361) (-365.944) -- 0:00:58
79500 -- [-367.493] (-367.119) (-367.795) (-369.076) * (-370.140) (-368.593) [-365.948] (-366.008) -- 0:00:57
80000 -- [-367.922] (-369.113) (-371.958) (-368.500) * (-365.606) [-368.964] (-369.329) (-366.715) -- 0:00:57
Average standard deviation of split frequencies: 0.032559
80500 -- [-365.652] (-368.032) (-371.339) (-369.235) * (-365.612) (-368.243) [-364.440] (-365.368) -- 0:00:57
81000 -- (-367.300) (-369.123) [-368.861] (-369.697) * (-368.504) [-369.911] (-366.187) (-365.782) -- 0:00:56
81500 -- (-370.717) (-366.694) [-368.434] (-371.718) * (-365.675) (-365.925) [-368.929] (-366.727) -- 0:00:56
82000 -- (-365.654) (-369.668) (-367.458) [-366.228] * [-365.615] (-366.241) (-366.541) (-370.418) -- 0:00:55
82500 -- [-366.982] (-369.132) (-368.469) (-366.859) * [-367.711] (-366.342) (-366.135) (-371.096) -- 0:00:55
83000 -- (-367.751) (-369.058) (-366.550) [-365.114] * (-369.506) (-369.001) [-364.534] (-366.811) -- 0:00:55
83500 -- (-365.777) (-366.685) (-368.592) [-367.509] * (-366.054) (-365.773) [-365.885] (-365.486) -- 0:00:54
84000 -- (-369.341) (-365.018) (-365.485) [-365.480] * [-365.701] (-366.938) (-367.602) (-375.172) -- 0:01:05
84500 -- (-367.390) (-365.117) [-365.584] (-371.144) * [-365.709] (-368.906) (-367.239) (-373.460) -- 0:01:05
85000 -- [-367.816] (-366.323) (-366.057) (-365.258) * (-369.190) [-366.560] (-366.462) (-371.759) -- 0:01:04
Average standard deviation of split frequencies: 0.029650
85500 -- (-365.749) (-368.141) [-365.582] (-367.555) * [-366.373] (-367.120) (-367.192) (-366.141) -- 0:01:04
86000 -- (-371.561) [-365.785] (-368.959) (-366.778) * (-365.873) (-365.072) (-367.167) [-365.714] -- 0:01:03
86500 -- (-373.571) [-365.890] (-369.150) (-371.290) * (-366.171) [-368.750] (-366.655) (-366.526) -- 0:01:03
87000 -- (-367.704) (-367.380) (-366.158) [-365.269] * (-366.506) [-368.978] (-365.689) (-367.500) -- 0:01:02
87500 -- (-366.505) (-366.668) (-374.016) [-366.216] * [-365.907] (-367.521) (-369.651) (-369.408) -- 0:01:02
88000 -- (-368.451) (-368.928) (-367.526) [-366.349] * (-366.031) [-365.934] (-365.734) (-367.345) -- 0:01:02
88500 -- [-369.222] (-368.531) (-366.275) (-367.940) * (-369.661) [-367.403] (-368.075) (-367.615) -- 0:01:01
89000 -- (-369.684) [-367.043] (-369.094) (-367.087) * [-367.072] (-368.583) (-366.866) (-364.844) -- 0:01:01
89500 -- (-366.523) (-367.456) (-365.272) [-366.616] * [-367.388] (-372.953) (-368.157) (-364.804) -- 0:01:01
90000 -- (-368.504) [-366.518] (-366.626) (-365.135) * (-364.653) (-366.602) (-367.293) [-365.385] -- 0:01:00
Average standard deviation of split frequencies: 0.033456
90500 -- (-371.091) [-366.608] (-365.985) (-367.377) * [-365.522] (-367.462) (-366.030) (-365.621) -- 0:01:00
91000 -- (-372.678) (-365.173) (-366.262) [-366.524] * (-367.027) (-367.999) [-366.596] (-366.199) -- 0:00:59
91500 -- (-366.620) (-364.910) [-367.428] (-366.361) * [-365.788] (-366.368) (-366.822) (-366.234) -- 0:00:59
92000 -- (-367.691) (-366.825) (-366.445) [-365.802] * (-369.064) (-365.801) (-369.407) [-366.705] -- 0:00:59
92500 -- (-365.873) [-366.232] (-365.420) (-366.005) * (-365.453) [-367.227] (-364.946) (-369.159) -- 0:00:58
93000 -- (-365.725) [-365.839] (-368.520) (-368.026) * [-366.078] (-365.353) (-367.783) (-369.776) -- 0:00:58
93500 -- (-366.690) (-367.652) (-366.249) [-365.860] * (-368.726) [-366.372] (-372.047) (-367.587) -- 0:00:58
94000 -- (-367.186) (-368.424) [-366.195] (-365.314) * (-366.185) (-368.601) (-368.329) [-367.420] -- 0:00:57
94500 -- (-365.828) (-367.705) [-367.591] (-367.414) * [-369.655] (-367.168) (-365.470) (-366.500) -- 0:00:57
95000 -- [-365.452] (-365.613) (-367.236) (-370.065) * (-368.539) (-367.139) [-367.054] (-366.693) -- 0:00:57
Average standard deviation of split frequencies: 0.032879
95500 -- (-366.959) (-368.523) [-367.340] (-369.626) * (-370.627) [-368.439] (-366.013) (-369.863) -- 0:00:56
96000 -- [-367.929] (-370.065) (-365.302) (-366.605) * [-366.857] (-367.128) (-365.126) (-367.655) -- 0:00:56
96500 -- (-367.356) (-366.519) [-366.858] (-366.149) * [-368.171] (-367.436) (-365.792) (-370.646) -- 0:00:56
97000 -- (-364.893) (-367.970) (-369.591) [-366.859] * (-364.510) [-364.821] (-365.471) (-365.292) -- 0:00:55
97500 -- (-366.864) [-365.669] (-364.688) (-373.156) * (-370.024) (-365.311) (-366.224) [-366.425] -- 0:00:55
98000 -- (-366.839) (-366.300) (-366.354) [-365.844] * [-368.334] (-366.049) (-366.377) (-368.414) -- 0:00:55
98500 -- (-366.469) (-367.658) (-367.515) [-367.162] * (-365.911) (-364.450) [-370.723] (-369.111) -- 0:00:54
99000 -- [-367.885] (-367.274) (-366.162) (-368.134) * [-365.645] (-368.714) (-365.791) (-367.818) -- 0:00:54
99500 -- [-367.165] (-370.195) (-369.108) (-370.945) * [-364.827] (-367.370) (-365.961) (-365.916) -- 0:00:54
100000 -- [-373.106] (-369.436) (-367.176) (-367.361) * (-367.904) (-364.803) [-364.732] (-369.296) -- 0:00:54
Average standard deviation of split frequencies: 0.031219
100500 -- (-367.829) (-365.595) [-365.634] (-367.104) * [-365.963] (-367.311) (-366.531) (-365.487) -- 0:00:53
101000 -- (-367.927) (-368.162) [-366.392] (-367.731) * (-365.495) (-365.822) [-365.866] (-367.303) -- 0:01:02
101500 -- (-364.644) (-369.417) [-367.852] (-372.782) * (-368.451) (-365.362) [-366.483] (-366.963) -- 0:01:01
102000 -- (-365.092) (-367.389) (-365.447) [-369.319] * (-365.765) (-368.857) (-367.372) [-366.170] -- 0:01:01
102500 -- (-371.397) (-368.770) [-365.632] (-365.719) * [-364.511] (-366.381) (-365.962) (-373.371) -- 0:01:01
103000 -- (-365.263) (-366.002) (-366.923) [-368.105] * (-364.985) (-366.049) [-367.742] (-368.370) -- 0:01:00
103500 -- (-367.576) [-366.729] (-364.990) (-365.464) * (-365.011) (-366.019) (-369.453) [-365.762] -- 0:01:00
104000 -- (-370.860) (-366.512) [-366.568] (-369.907) * (-368.152) [-366.020] (-369.222) (-365.365) -- 0:01:00
104500 -- (-366.526) (-367.183) (-367.250) [-366.445] * (-367.687) (-368.123) [-367.193] (-369.699) -- 0:00:59
105000 -- [-365.191] (-367.391) (-365.711) (-366.616) * (-366.874) (-370.340) [-366.698] (-364.677) -- 0:00:59
Average standard deviation of split frequencies: 0.029715
105500 -- [-364.898] (-365.445) (-366.684) (-367.321) * (-365.510) (-366.499) [-366.798] (-365.104) -- 0:00:59
106000 -- (-364.822) [-365.342] (-369.253) (-366.147) * [-366.270] (-365.491) (-366.663) (-371.158) -- 0:00:59
106500 -- (-365.700) (-365.916) (-369.819) [-365.404] * (-368.081) (-365.960) [-365.101] (-373.999) -- 0:00:58
107000 -- (-365.449) (-366.445) [-369.831] (-367.513) * (-367.421) (-366.858) [-368.068] (-368.648) -- 0:00:58
107500 -- (-367.170) [-365.412] (-368.730) (-369.163) * [-367.153] (-366.923) (-366.237) (-369.601) -- 0:00:58
108000 -- (-369.781) [-370.535] (-367.596) (-373.498) * (-367.977) [-365.506] (-368.575) (-371.327) -- 0:00:57
108500 -- (-366.746) (-366.663) [-369.281] (-367.150) * (-366.785) (-367.156) [-365.660] (-367.871) -- 0:00:57
109000 -- (-365.352) (-373.200) (-370.453) [-366.665] * (-367.395) (-365.006) [-365.840] (-366.050) -- 0:00:57
109500 -- (-364.867) (-370.373) [-364.574] (-365.578) * (-365.622) (-368.441) (-366.785) [-370.625] -- 0:00:56
110000 -- (-364.944) (-374.922) (-370.281) [-364.955] * (-365.710) (-366.689) [-366.400] (-365.716) -- 0:00:56
Average standard deviation of split frequencies: 0.029594
110500 -- (-366.556) (-365.880) [-370.981] (-366.432) * (-365.501) [-366.331] (-371.620) (-369.441) -- 0:00:56
111000 -- (-366.117) (-366.071) (-368.128) [-367.261] * (-364.804) (-365.291) (-365.823) [-367.520] -- 0:00:56
111500 -- (-367.163) [-365.720] (-368.352) (-365.981) * [-368.289] (-368.557) (-368.525) (-366.688) -- 0:00:55
112000 -- [-365.207] (-366.964) (-369.788) (-365.798) * (-366.861) (-367.404) [-367.480] (-369.085) -- 0:00:55
112500 -- (-366.074) (-367.015) (-369.175) [-367.116] * (-366.048) (-367.101) [-368.612] (-370.005) -- 0:00:55
113000 -- (-364.641) (-366.893) (-367.234) [-364.794] * (-368.119) (-367.550) (-365.068) [-367.384] -- 0:00:54
113500 -- [-366.875] (-365.774) (-368.810) (-367.148) * (-366.591) (-370.516) [-365.450] (-364.714) -- 0:00:54
114000 -- [-366.868] (-367.822) (-367.062) (-365.478) * [-367.772] (-368.657) (-371.080) (-366.094) -- 0:00:54
114500 -- (-369.678) [-365.715] (-366.850) (-367.991) * (-364.963) (-365.930) [-364.844] (-366.159) -- 0:00:54
115000 -- [-364.818] (-366.602) (-367.334) (-364.820) * (-367.776) (-370.664) (-366.124) [-367.582] -- 0:00:53
Average standard deviation of split frequencies: 0.030276
115500 -- (-366.969) [-365.691] (-366.804) (-368.766) * (-367.388) [-367.271] (-367.607) (-368.316) -- 0:00:53
116000 -- (-367.103) [-365.676] (-365.476) (-367.864) * (-370.118) [-366.300] (-367.475) (-368.935) -- 0:00:53
116500 -- (-365.513) (-365.495) [-369.075] (-367.073) * (-367.957) [-366.829] (-365.719) (-367.213) -- 0:00:53
117000 -- (-371.684) (-365.730) (-368.905) [-367.552] * (-366.070) (-369.382) (-365.040) [-365.248] -- 0:00:52
117500 -- (-367.084) [-368.381] (-365.695) (-368.825) * (-367.934) (-365.214) [-368.169] (-365.494) -- 0:00:52
118000 -- [-366.026] (-367.160) (-365.346) (-365.131) * (-368.953) [-368.293] (-368.528) (-369.581) -- 0:00:59
118500 -- (-366.554) (-365.329) [-366.461] (-367.322) * (-372.102) (-368.469) [-366.280] (-365.540) -- 0:00:59
119000 -- (-365.700) (-367.217) [-365.433] (-366.358) * [-365.971] (-367.327) (-367.121) (-366.215) -- 0:00:59
119500 -- (-366.388) (-366.423) (-364.818) [-365.388] * (-364.939) [-369.108] (-368.052) (-368.081) -- 0:00:58
120000 -- (-368.211) [-367.416] (-367.178) (-366.475) * [-365.632] (-366.936) (-369.127) (-365.562) -- 0:00:58
Average standard deviation of split frequencies: 0.029197
120500 -- [-365.961] (-366.394) (-369.351) (-368.045) * [-366.171] (-368.092) (-365.813) (-366.888) -- 0:00:58
121000 -- (-366.629) [-365.239] (-366.605) (-373.766) * (-366.828) (-365.809) [-367.709] (-365.739) -- 0:00:58
121500 -- [-366.316] (-367.168) (-370.552) (-365.983) * (-365.788) [-372.710] (-364.687) (-367.423) -- 0:00:57
122000 -- (-365.774) (-366.749) [-366.702] (-364.963) * (-367.248) (-367.780) [-366.073] (-365.720) -- 0:00:57
122500 -- [-367.421] (-372.593) (-365.873) (-364.978) * (-365.224) (-366.751) (-366.898) [-364.811] -- 0:00:57
123000 -- (-366.851) (-365.530) [-365.833] (-367.149) * [-365.113] (-365.260) (-367.830) (-367.084) -- 0:00:57
123500 -- (-365.463) (-368.349) [-366.675] (-366.931) * (-366.903) [-364.474] (-368.782) (-364.568) -- 0:00:56
124000 -- (-366.256) [-365.260] (-367.231) (-365.083) * (-368.993) [-364.969] (-369.647) (-370.222) -- 0:00:56
124500 -- (-366.325) [-367.809] (-367.166) (-368.512) * [-366.234] (-365.944) (-370.042) (-366.511) -- 0:00:56
125000 -- (-366.335) (-366.005) (-366.278) [-365.299] * (-372.252) [-365.971] (-373.590) (-366.544) -- 0:00:56
Average standard deviation of split frequencies: 0.026750
125500 -- (-373.287) (-365.201) [-369.322] (-368.825) * (-366.239) [-365.766] (-367.181) (-365.068) -- 0:00:55
126000 -- (-370.770) [-365.353] (-366.704) (-365.085) * (-364.454) (-366.490) [-368.939] (-367.798) -- 0:00:55
126500 -- (-372.211) (-368.623) (-374.296) [-366.118] * [-365.594] (-368.971) (-368.817) (-367.151) -- 0:00:55
127000 -- [-365.464] (-367.043) (-377.965) (-365.298) * (-368.762) (-368.626) [-365.065] (-364.990) -- 0:00:54
127500 -- (-367.720) [-366.219] (-374.050) (-368.490) * [-364.442] (-368.154) (-367.684) (-366.176) -- 0:00:54
128000 -- (-364.645) (-366.231) (-370.027) [-369.518] * (-366.061) (-367.333) (-365.717) [-370.739] -- 0:00:54
128500 -- (-369.542) [-366.241] (-370.522) (-369.934) * [-365.942] (-366.837) (-365.619) (-367.920) -- 0:00:54
129000 -- [-365.946] (-366.786) (-371.531) (-366.925) * (-368.522) (-365.521) [-366.369] (-366.616) -- 0:00:54
129500 -- [-366.396] (-366.712) (-372.322) (-368.018) * (-369.077) (-365.583) (-364.781) [-366.746] -- 0:00:53
130000 -- (-367.381) [-366.624] (-368.432) (-366.151) * (-368.564) (-365.868) [-364.512] (-366.857) -- 0:00:53
Average standard deviation of split frequencies: 0.025823
130500 -- [-365.348] (-366.306) (-368.759) (-367.962) * (-369.206) (-367.708) [-365.904] (-365.634) -- 0:00:53
131000 -- [-368.738] (-367.509) (-366.548) (-368.909) * (-370.896) (-365.269) [-367.157] (-367.299) -- 0:00:53
131500 -- (-369.169) (-368.316) (-367.606) [-367.613] * (-366.290) [-367.974] (-366.189) (-369.026) -- 0:00:52
132000 -- (-366.915) (-367.711) (-365.110) [-367.142] * (-365.879) [-368.931] (-367.306) (-372.871) -- 0:00:52
132500 -- (-366.799) [-364.950] (-368.327) (-368.787) * (-365.874) [-367.909] (-368.450) (-364.613) -- 0:00:52
133000 -- (-365.384) (-364.723) [-366.875] (-369.520) * (-365.393) [-365.890] (-365.735) (-366.628) -- 0:00:52
133500 -- (-364.996) (-366.933) [-364.614] (-366.118) * (-365.415) [-366.824] (-365.200) (-367.201) -- 0:00:51
134000 -- [-364.759] (-366.445) (-367.305) (-366.864) * (-367.603) (-365.637) (-365.851) [-366.515] -- 0:00:51
134500 -- (-365.425) (-367.068) [-366.391] (-365.983) * (-365.380) (-366.620) (-365.322) [-369.413] -- 0:00:51
135000 -- [-366.278] (-367.598) (-365.916) (-365.312) * (-365.315) (-365.161) (-366.592) [-364.553] -- 0:00:51
Average standard deviation of split frequencies: 0.022986
135500 -- (-365.468) (-365.231) (-365.544) [-367.134] * (-369.299) [-365.591] (-365.081) (-365.812) -- 0:00:57
136000 -- (-370.506) (-367.034) [-365.503] (-366.635) * (-367.509) (-365.285) [-366.912] (-367.409) -- 0:00:57
136500 -- [-365.812] (-367.469) (-365.769) (-369.623) * (-367.496) (-364.617) (-365.419) [-366.625] -- 0:00:56
137000 -- [-370.530] (-366.805) (-365.127) (-365.964) * (-365.904) (-366.647) (-365.481) [-367.545] -- 0:00:56
137500 -- (-365.721) (-366.061) (-365.908) [-368.249] * [-367.727] (-364.699) (-369.006) (-368.387) -- 0:00:56
138000 -- [-364.828] (-366.164) (-365.316) (-364.483) * (-367.571) (-364.826) (-369.467) [-365.384] -- 0:00:56
138500 -- (-366.101) [-365.942] (-366.423) (-367.263) * (-372.251) [-368.452] (-368.724) (-364.859) -- 0:00:55
139000 -- (-365.847) (-368.817) [-365.758] (-366.553) * (-371.095) (-366.339) [-365.521] (-365.507) -- 0:00:55
139500 -- (-367.737) (-368.250) [-368.215] (-366.488) * (-367.693) [-364.957] (-369.583) (-366.449) -- 0:00:55
140000 -- (-366.576) [-366.422] (-365.023) (-369.705) * (-366.853) (-365.683) (-368.467) [-365.133] -- 0:00:55
Average standard deviation of split frequencies: 0.021411
140500 -- (-368.132) (-367.024) [-366.026] (-368.776) * (-365.864) (-365.859) [-365.842] (-366.349) -- 0:00:55
141000 -- (-366.347) (-365.105) [-367.205] (-366.525) * (-371.410) (-366.417) (-365.638) [-367.670] -- 0:00:54
141500 -- (-366.157) (-366.504) (-367.983) [-367.411] * [-365.064] (-367.044) (-366.445) (-369.747) -- 0:00:54
142000 -- (-365.463) (-365.916) (-365.957) [-366.332] * (-368.114) (-368.803) (-364.757) [-364.566] -- 0:00:54
142500 -- [-367.188] (-364.979) (-365.591) (-366.853) * (-368.459) (-366.119) (-366.107) [-365.391] -- 0:00:54
143000 -- [-365.645] (-364.654) (-365.512) (-366.442) * [-366.362] (-366.879) (-366.210) (-367.679) -- 0:00:53
143500 -- (-369.030) (-369.061) (-366.005) [-366.785] * (-370.175) (-367.139) (-366.050) [-367.120] -- 0:00:53
144000 -- [-366.486] (-364.475) (-366.771) (-366.321) * (-367.236) (-368.688) [-365.737] (-367.518) -- 0:00:53
144500 -- (-366.336) (-365.320) (-364.525) [-365.212] * (-372.053) (-367.807) (-367.612) [-367.068] -- 0:00:53
145000 -- (-367.986) (-366.045) [-374.444] (-366.224) * (-367.903) [-368.852] (-367.331) (-366.148) -- 0:00:53
Average standard deviation of split frequencies: 0.019050
145500 -- (-366.024) [-367.570] (-366.994) (-367.789) * (-365.442) (-369.939) (-366.942) [-365.799] -- 0:00:52
146000 -- (-365.592) (-365.797) [-364.661] (-366.981) * (-366.204) (-368.639) [-365.555] (-365.609) -- 0:00:52
146500 -- (-366.337) (-365.770) (-366.949) [-364.984] * (-369.850) (-367.003) (-367.737) [-364.526] -- 0:00:52
147000 -- (-368.512) [-365.724] (-365.784) (-364.715) * [-364.759] (-365.721) (-366.098) (-366.904) -- 0:00:52
147500 -- [-367.171] (-366.512) (-367.032) (-366.144) * (-366.901) (-367.777) [-367.679] (-368.353) -- 0:00:52
148000 -- [-365.509] (-365.152) (-365.860) (-365.576) * (-366.959) (-371.720) [-365.752] (-365.092) -- 0:00:51
148500 -- (-365.407) [-366.353] (-372.643) (-366.569) * (-368.380) [-365.296] (-366.159) (-367.410) -- 0:00:51
149000 -- (-365.191) (-369.162) [-366.987] (-368.338) * [-367.519] (-366.462) (-367.147) (-366.964) -- 0:00:51
149500 -- [-365.939] (-366.081) (-365.408) (-368.778) * (-368.786) [-367.780] (-365.076) (-370.252) -- 0:00:51
150000 -- (-368.704) [-365.797] (-367.631) (-366.250) * [-367.902] (-367.145) (-367.176) (-365.651) -- 0:00:51
Average standard deviation of split frequencies: 0.017126
150500 -- (-372.234) (-367.770) [-364.670] (-365.695) * (-366.922) [-365.900] (-368.171) (-366.119) -- 0:00:50
151000 -- (-367.810) [-366.471] (-367.150) (-366.926) * [-368.009] (-366.519) (-366.036) (-366.551) -- 0:00:50
151500 -- (-365.805) (-367.202) [-366.277] (-367.775) * (-367.579) (-365.363) (-366.398) [-367.185] -- 0:00:50
152000 -- (-364.657) [-367.559] (-371.370) (-369.756) * [-365.215] (-366.351) (-369.958) (-366.129) -- 0:00:50
152500 -- [-364.501] (-368.267) (-371.810) (-368.771) * [-367.660] (-366.221) (-368.989) (-366.405) -- 0:00:55
153000 -- [-365.660] (-367.521) (-372.256) (-368.022) * (-367.819) [-367.217] (-367.073) (-366.259) -- 0:00:55
153500 -- (-367.141) (-365.975) (-370.304) [-368.591] * (-366.750) (-373.608) [-369.921] (-367.648) -- 0:00:55
154000 -- (-367.760) [-366.000] (-365.753) (-366.712) * [-369.181] (-367.772) (-367.269) (-365.014) -- 0:00:54
154500 -- (-366.574) [-365.854] (-366.591) (-367.232) * [-366.409] (-366.183) (-367.650) (-364.961) -- 0:00:54
155000 -- (-367.925) (-365.219) (-364.698) [-365.770] * (-369.580) (-366.370) (-370.234) [-365.165] -- 0:00:54
Average standard deviation of split frequencies: 0.021656
155500 -- (-367.119) (-365.256) (-365.818) [-365.154] * (-364.551) [-364.919] (-366.368) (-368.674) -- 0:00:54
156000 -- (-368.652) (-366.411) (-370.689) [-366.319] * [-365.711] (-370.103) (-366.745) (-372.760) -- 0:00:54
156500 -- (-369.574) (-364.944) [-366.316] (-366.139) * (-365.939) [-369.744] (-366.907) (-368.333) -- 0:00:53
157000 -- [-367.460] (-365.807) (-367.941) (-364.730) * (-365.964) (-372.601) [-364.661] (-367.670) -- 0:00:53
157500 -- (-366.988) [-368.292] (-366.237) (-367.747) * [-365.329] (-369.420) (-366.045) (-366.271) -- 0:00:53
158000 -- (-366.087) (-369.007) [-366.200] (-367.916) * (-366.723) (-368.346) [-365.409] (-366.504) -- 0:00:53
158500 -- (-367.732) (-368.334) (-370.269) [-370.348] * (-366.399) [-367.744] (-366.062) (-365.807) -- 0:00:53
159000 -- (-364.836) [-365.156] (-369.368) (-369.942) * (-365.889) (-366.080) [-371.346] (-369.835) -- 0:00:52
159500 -- [-367.403] (-367.655) (-368.538) (-364.902) * (-365.640) (-367.360) (-366.747) [-366.170] -- 0:00:52
160000 -- (-369.985) (-367.970) [-369.355] (-365.919) * [-370.281] (-366.195) (-365.501) (-366.423) -- 0:00:52
Average standard deviation of split frequencies: 0.021027
160500 -- (-370.093) (-367.108) (-369.127) [-365.935] * (-370.214) (-369.692) [-364.704] (-366.718) -- 0:00:52
161000 -- (-370.947) [-365.755] (-368.143) (-365.271) * [-368.665] (-368.338) (-365.809) (-366.058) -- 0:00:52
161500 -- (-371.586) (-368.134) (-366.460) [-367.942] * (-370.407) (-370.242) (-366.557) [-366.887] -- 0:00:51
162000 -- (-367.424) [-367.147] (-371.983) (-368.469) * [-368.265] (-367.365) (-367.056) (-367.190) -- 0:00:51
162500 -- (-367.151) (-367.761) (-366.304) [-368.218] * (-365.389) [-365.878] (-366.567) (-367.942) -- 0:00:51
163000 -- [-365.249] (-366.556) (-367.734) (-366.139) * [-371.747] (-365.172) (-365.206) (-364.839) -- 0:00:51
163500 -- [-368.971] (-366.552) (-368.665) (-364.795) * (-374.708) [-366.386] (-365.076) (-365.388) -- 0:00:51
164000 -- [-364.865] (-364.653) (-366.773) (-366.017) * (-371.105) (-364.441) (-368.077) [-368.583] -- 0:00:50
164500 -- (-367.133) (-366.382) [-366.176] (-365.042) * [-364.919] (-367.067) (-367.423) (-367.089) -- 0:00:50
165000 -- (-366.677) [-367.862] (-368.135) (-365.923) * (-368.589) [-364.675] (-367.260) (-369.761) -- 0:00:50
Average standard deviation of split frequencies: 0.021456
165500 -- [-367.359] (-367.750) (-366.642) (-366.470) * (-365.364) [-364.646] (-371.831) (-365.623) -- 0:00:50
166000 -- (-369.122) (-369.248) [-366.631] (-365.551) * (-366.053) [-366.996] (-369.133) (-364.910) -- 0:00:50
166500 -- (-368.773) (-368.213) [-365.622] (-364.667) * (-367.832) (-368.572) (-365.519) [-365.218] -- 0:00:50
167000 -- (-368.585) (-368.419) (-366.831) [-364.561] * [-365.141] (-370.492) (-368.544) (-367.218) -- 0:00:49
167500 -- (-366.717) (-367.419) (-365.650) [-365.283] * [-366.748] (-364.721) (-367.296) (-365.488) -- 0:00:49
168000 -- (-365.898) [-366.829] (-365.108) (-366.514) * [-364.983] (-368.368) (-366.073) (-369.832) -- 0:00:49
168500 -- (-367.938) [-365.475] (-368.814) (-366.358) * (-368.123) [-367.441] (-370.592) (-364.514) -- 0:00:49
169000 -- [-367.778] (-368.225) (-368.159) (-365.250) * (-368.386) [-369.416] (-368.306) (-368.072) -- 0:00:49
169500 -- (-366.770) (-371.299) [-367.615] (-368.432) * (-366.713) [-365.119] (-369.142) (-367.415) -- 0:00:53
170000 -- [-365.754] (-364.503) (-367.502) (-367.433) * (-366.253) [-365.135] (-367.554) (-367.136) -- 0:00:53
Average standard deviation of split frequencies: 0.020797
170500 -- (-368.395) (-364.882) (-367.018) [-365.820] * (-364.784) (-366.589) [-369.320] (-366.870) -- 0:00:53
171000 -- (-367.984) [-367.171] (-366.067) (-368.742) * [-366.166] (-367.219) (-367.200) (-364.935) -- 0:00:53
171500 -- (-369.999) (-365.380) (-366.128) [-367.258] * [-367.642] (-367.271) (-368.390) (-368.101) -- 0:00:53
172000 -- (-367.077) [-365.639] (-368.326) (-365.931) * [-366.388] (-367.609) (-367.444) (-370.366) -- 0:00:52
172500 -- (-366.017) (-367.016) (-371.123) [-367.854] * [-365.068] (-364.939) (-364.993) (-365.147) -- 0:00:52
173000 -- (-366.955) [-366.489] (-371.289) (-371.894) * (-368.058) (-367.233) [-364.933] (-367.419) -- 0:00:52
173500 -- (-369.565) (-370.782) [-366.241] (-368.497) * (-365.120) (-365.023) (-365.327) [-366.557] -- 0:00:52
174000 -- [-366.228] (-367.751) (-365.461) (-369.395) * (-365.301) [-367.413] (-370.708) (-365.220) -- 0:00:52
174500 -- (-365.093) (-365.345) [-364.880] (-365.434) * (-365.977) (-364.916) [-367.613] (-367.831) -- 0:00:52
175000 -- (-366.384) [-365.272] (-367.408) (-366.347) * (-367.242) (-367.098) (-365.302) [-367.872] -- 0:00:51
Average standard deviation of split frequencies: 0.020482
175500 -- (-366.436) (-366.522) (-369.823) [-366.393] * (-367.173) (-367.493) (-368.347) [-366.606] -- 0:00:51
176000 -- (-369.097) (-367.704) [-367.097] (-367.522) * (-366.114) [-365.682] (-366.828) (-368.191) -- 0:00:51
176500 -- (-365.826) (-367.681) (-367.298) [-368.757] * [-366.511] (-366.715) (-365.687) (-368.496) -- 0:00:51
177000 -- (-366.253) (-367.093) (-365.199) [-365.660] * (-365.204) [-367.788] (-366.625) (-367.416) -- 0:00:51
177500 -- (-365.238) (-366.578) (-365.418) [-367.931] * (-366.870) (-365.345) (-365.143) [-365.166] -- 0:00:50
178000 -- (-367.512) [-367.336] (-368.028) (-365.923) * (-366.553) (-364.870) (-367.069) [-364.983] -- 0:00:50
178500 -- [-367.158] (-366.470) (-369.014) (-367.707) * (-366.352) (-365.660) (-366.545) [-364.756] -- 0:00:50
179000 -- [-367.909] (-367.307) (-372.195) (-368.689) * [-365.516] (-365.348) (-368.705) (-364.811) -- 0:00:50
179500 -- (-373.176) (-365.153) (-365.166) [-367.229] * (-366.714) (-365.640) (-367.894) [-366.885] -- 0:00:50
180000 -- (-367.512) (-365.786) (-365.734) [-370.052] * (-365.204) (-365.208) [-366.610] (-369.314) -- 0:00:50
Average standard deviation of split frequencies: 0.020874
180500 -- (-366.747) (-368.350) [-365.808] (-368.523) * [-365.893] (-367.961) (-365.639) (-368.790) -- 0:00:49
181000 -- (-368.370) [-367.881] (-364.692) (-366.299) * (-366.725) [-366.336] (-368.293) (-369.258) -- 0:00:49
181500 -- (-368.347) [-365.870] (-368.256) (-366.284) * [-366.436] (-366.220) (-367.787) (-368.592) -- 0:00:49
182000 -- (-367.327) (-369.661) [-366.426] (-368.378) * (-366.293) (-368.479) [-365.516] (-365.925) -- 0:00:49
182500 -- (-364.673) (-366.434) (-366.046) [-365.594] * (-367.568) (-369.620) (-365.199) [-368.077] -- 0:00:49
183000 -- (-364.511) (-367.662) (-366.546) [-365.478] * (-365.114) (-367.401) (-371.945) [-364.846] -- 0:00:49
183500 -- [-366.215] (-368.121) (-366.561) (-365.784) * (-365.742) [-370.598] (-373.418) (-376.442) -- 0:00:48
184000 -- [-366.145] (-368.933) (-368.176) (-368.402) * (-365.310) [-367.243] (-365.324) (-369.030) -- 0:00:48
184500 -- (-365.392) (-365.866) [-365.554] (-365.347) * [-367.579] (-366.031) (-365.885) (-365.226) -- 0:00:48
185000 -- (-370.247) (-370.013) (-367.385) [-367.149] * [-367.085] (-367.588) (-366.032) (-366.255) -- 0:00:48
Average standard deviation of split frequencies: 0.018934
185500 -- [-365.828] (-366.299) (-365.641) (-365.261) * (-372.956) [-368.600] (-367.538) (-366.260) -- 0:00:48
186000 -- [-365.968] (-366.087) (-367.248) (-365.548) * (-369.258) (-367.948) [-367.368] (-367.247) -- 0:00:48
186500 -- (-367.947) (-366.353) (-369.148) [-366.446] * (-365.892) (-367.173) [-366.887] (-367.177) -- 0:00:47
187000 -- (-370.181) (-366.827) (-366.068) [-365.692] * (-367.026) [-365.993] (-372.880) (-367.464) -- 0:00:52
187500 -- [-366.262] (-366.493) (-366.716) (-373.093) * (-367.291) (-365.976) [-368.234] (-366.230) -- 0:00:52
188000 -- (-367.242) (-366.720) (-370.885) [-367.129] * (-367.309) (-366.541) [-364.620] (-368.127) -- 0:00:51
188500 -- (-364.778) (-366.012) (-374.086) [-365.190] * (-365.806) (-369.300) [-367.268] (-366.128) -- 0:00:51
189000 -- (-365.530) [-364.773] (-367.005) (-366.255) * (-366.197) [-366.702] (-367.176) (-365.331) -- 0:00:51
189500 -- [-365.544] (-365.492) (-365.834) (-368.247) * [-366.145] (-364.357) (-366.823) (-366.853) -- 0:00:51
190000 -- (-364.554) [-369.150] (-368.396) (-369.060) * (-371.816) [-366.786] (-375.015) (-368.728) -- 0:00:51
Average standard deviation of split frequencies: 0.016725
190500 -- (-365.165) (-370.669) [-366.527] (-365.141) * [-365.961] (-365.594) (-367.298) (-367.971) -- 0:00:50
191000 -- (-367.857) (-365.926) [-367.444] (-367.899) * (-366.203) [-367.072] (-369.468) (-366.998) -- 0:00:50
191500 -- (-365.831) [-367.111] (-368.854) (-369.585) * (-369.244) (-366.620) (-368.030) [-367.172] -- 0:00:50
192000 -- (-365.241) [-366.967] (-366.647) (-370.136) * (-365.625) (-366.762) (-365.860) [-370.218] -- 0:00:50
192500 -- [-365.280] (-367.141) (-368.247) (-368.148) * [-368.291] (-367.552) (-367.591) (-367.510) -- 0:00:50
193000 -- (-367.682) (-368.621) [-367.116] (-366.100) * (-367.556) [-367.286] (-365.386) (-364.572) -- 0:00:50
193500 -- [-366.390] (-366.694) (-366.990) (-367.646) * (-368.951) [-366.005] (-364.358) (-368.534) -- 0:00:50
194000 -- (-365.818) (-366.800) [-365.156] (-371.867) * [-368.638] (-369.460) (-366.886) (-365.994) -- 0:00:49
194500 -- (-374.002) (-367.037) [-366.665] (-369.800) * [-366.953] (-366.930) (-366.077) (-367.039) -- 0:00:49
195000 -- (-369.897) [-367.351] (-371.113) (-366.212) * (-367.593) [-365.875] (-364.867) (-370.826) -- 0:00:49
Average standard deviation of split frequencies: 0.016553
195500 -- [-365.425] (-368.127) (-366.752) (-365.300) * (-371.700) [-365.496] (-369.871) (-370.861) -- 0:00:49
196000 -- (-365.142) [-367.209] (-371.532) (-365.298) * (-366.136) (-367.285) (-371.924) [-369.298] -- 0:00:49
196500 -- (-371.962) [-366.199] (-372.051) (-364.868) * (-369.098) (-367.846) (-367.929) [-366.658] -- 0:00:49
197000 -- [-367.089] (-366.012) (-374.468) (-367.199) * (-365.062) (-367.330) (-367.562) [-364.824] -- 0:00:48
197500 -- (-367.568) (-366.950) [-368.042] (-367.783) * (-367.641) [-365.588] (-365.722) (-368.282) -- 0:00:48
198000 -- (-370.401) (-364.569) (-369.517) [-367.034] * [-366.591] (-372.595) (-370.565) (-365.186) -- 0:00:48
198500 -- [-367.661] (-368.007) (-367.732) (-369.806) * (-367.178) (-369.707) (-367.330) [-365.406] -- 0:00:48
199000 -- (-370.029) (-367.085) (-369.940) [-365.965] * (-366.278) [-365.600] (-365.012) (-364.555) -- 0:00:48
199500 -- [-367.195] (-366.531) (-369.065) (-371.334) * (-370.127) (-367.912) (-365.529) [-367.206] -- 0:00:48
200000 -- (-365.870) [-366.149] (-366.502) (-365.288) * (-367.773) (-366.321) (-367.998) [-366.313] -- 0:00:48
Average standard deviation of split frequencies: 0.017688
200500 -- [-369.077] (-368.581) (-366.114) (-366.171) * [-367.380] (-367.507) (-368.920) (-367.401) -- 0:00:47
201000 -- (-365.759) (-367.402) (-372.183) [-366.891] * (-365.495) (-367.813) (-365.416) [-366.859] -- 0:00:47
201500 -- (-368.272) [-367.573] (-365.006) (-370.814) * (-367.071) (-367.281) (-366.721) [-365.424] -- 0:00:47
202000 -- [-366.015] (-369.685) (-367.144) (-366.450) * (-368.316) (-366.503) [-365.644] (-366.402) -- 0:00:47
202500 -- (-367.230) (-368.812) [-368.593] (-364.726) * (-366.307) (-367.130) [-366.074] (-366.693) -- 0:00:47
203000 -- (-367.961) (-366.285) [-367.678] (-366.167) * (-364.631) [-366.818] (-368.639) (-366.197) -- 0:00:47
203500 -- [-365.550] (-371.155) (-364.639) (-367.783) * (-368.119) (-367.456) (-366.628) [-365.889] -- 0:00:46
204000 -- (-366.606) [-366.658] (-367.020) (-365.907) * (-367.649) (-367.982) [-366.560] (-364.898) -- 0:00:50
204500 -- (-368.851) [-366.231] (-366.490) (-366.853) * (-366.091) (-364.980) (-366.105) [-364.814] -- 0:00:50
205000 -- (-365.084) [-368.417] (-365.947) (-365.779) * [-366.486] (-366.873) (-372.692) (-365.294) -- 0:00:50
Average standard deviation of split frequencies: 0.015637
205500 -- (-366.394) [-366.687] (-366.806) (-367.298) * [-364.871] (-369.603) (-369.175) (-365.725) -- 0:00:50
206000 -- (-366.548) (-366.184) (-372.165) [-369.178] * (-366.149) (-365.005) (-369.568) [-366.021] -- 0:00:50
206500 -- (-365.701) (-367.573) (-365.987) [-365.046] * (-368.155) (-365.152) [-366.317] (-371.399) -- 0:00:49
207000 -- (-366.892) (-367.494) [-364.927] (-370.443) * (-369.182) (-365.194) [-366.306] (-368.520) -- 0:00:49
207500 -- (-365.454) (-365.579) [-367.683] (-368.181) * (-366.009) (-366.696) [-365.324] (-366.664) -- 0:00:49
208000 -- [-365.283] (-365.148) (-366.095) (-367.419) * (-370.660) (-366.377) [-366.803] (-366.550) -- 0:00:49
208500 -- [-369.299] (-366.984) (-366.468) (-369.700) * (-365.964) (-368.631) (-366.317) [-365.415] -- 0:00:49
209000 -- (-366.622) [-366.026] (-366.229) (-365.989) * (-365.424) [-365.125] (-365.040) (-365.864) -- 0:00:49
209500 -- (-366.565) (-366.918) [-365.805] (-369.163) * (-365.186) (-369.306) (-367.890) [-369.136] -- 0:00:49
210000 -- (-364.786) (-371.410) (-366.051) [-370.221] * (-366.366) (-369.654) (-366.867) [-367.570] -- 0:00:48
Average standard deviation of split frequencies: 0.015310
210500 -- (-368.308) [-367.987] (-368.231) (-367.634) * [-368.294] (-370.420) (-365.867) (-369.567) -- 0:00:48
211000 -- (-368.446) [-374.144] (-365.838) (-370.960) * (-365.162) (-367.363) (-368.231) [-369.208] -- 0:00:48
211500 -- (-366.797) (-372.043) [-365.465] (-368.446) * (-365.338) [-365.142] (-366.135) (-365.985) -- 0:00:48
212000 -- [-366.913] (-368.207) (-365.379) (-365.725) * (-365.768) (-366.861) [-366.858] (-368.282) -- 0:00:48
212500 -- (-365.985) (-366.304) (-368.171) [-366.855] * (-365.405) [-364.867] (-367.882) (-367.063) -- 0:00:48
213000 -- (-367.299) [-366.379] (-369.717) (-366.268) * (-365.087) (-366.857) [-366.835] (-366.312) -- 0:00:48
213500 -- (-366.758) [-366.047] (-365.898) (-365.952) * (-368.990) [-368.368] (-367.513) (-366.567) -- 0:00:47
214000 -- (-366.372) [-366.563] (-365.765) (-366.477) * (-366.467) (-367.340) [-366.742] (-368.427) -- 0:00:47
214500 -- (-368.944) [-366.988] (-369.442) (-368.292) * (-367.817) (-367.023) (-365.729) [-366.567] -- 0:00:47
215000 -- (-368.768) (-365.676) [-365.741] (-366.960) * (-370.330) (-370.641) [-368.679] (-366.888) -- 0:00:47
Average standard deviation of split frequencies: 0.015277
215500 -- (-367.673) [-365.961] (-368.521) (-366.212) * (-368.914) (-367.465) (-366.068) [-367.981] -- 0:00:47
216000 -- (-366.861) (-364.689) (-370.028) [-366.942] * [-364.982] (-369.122) (-366.171) (-368.465) -- 0:00:47
216500 -- (-366.420) (-367.242) [-366.859] (-367.541) * [-366.211] (-366.327) (-373.522) (-368.142) -- 0:00:47
217000 -- (-369.834) [-367.344] (-367.695) (-366.376) * (-368.102) (-364.586) [-366.405] (-368.077) -- 0:00:46
217500 -- (-367.406) (-369.361) [-365.428] (-370.322) * (-368.164) [-366.609] (-369.148) (-368.886) -- 0:00:46
218000 -- (-365.541) [-366.432] (-366.392) (-366.864) * (-367.927) (-368.984) (-366.976) [-364.686] -- 0:00:46
218500 -- (-365.043) [-367.876] (-366.515) (-369.400) * [-366.753] (-367.626) (-365.861) (-364.825) -- 0:00:46
219000 -- (-371.942) (-374.493) (-368.572) [-364.923] * [-365.845] (-366.165) (-366.120) (-365.720) -- 0:00:46
219500 -- (-369.009) (-370.437) (-366.322) [-367.676] * (-366.519) (-366.682) [-368.407] (-368.050) -- 0:00:46
220000 -- (-367.189) [-367.529] (-367.277) (-368.632) * (-368.113) (-365.448) (-369.082) [-365.746] -- 0:00:46
Average standard deviation of split frequencies: 0.016289
220500 -- (-369.209) (-366.173) [-365.724] (-373.618) * [-367.114] (-368.371) (-365.002) (-365.057) -- 0:00:45
221000 -- (-370.915) [-366.137] (-368.415) (-369.788) * (-368.784) (-365.765) [-366.935] (-366.186) -- 0:00:49
221500 -- [-367.189] (-370.491) (-366.231) (-370.658) * (-368.482) (-365.415) [-367.700] (-367.177) -- 0:00:49
222000 -- [-367.174] (-370.024) (-368.143) (-368.620) * (-367.311) [-365.564] (-365.253) (-368.696) -- 0:00:49
222500 -- (-367.799) (-372.645) [-370.975] (-366.206) * (-365.289) (-366.090) [-365.032] (-366.782) -- 0:00:48
223000 -- (-366.558) (-370.218) (-369.444) [-366.331] * (-370.605) (-367.864) (-365.151) [-365.149] -- 0:00:48
223500 -- (-366.113) (-368.445) [-367.757] (-366.158) * (-366.867) (-367.439) [-366.658] (-365.245) -- 0:00:48
224000 -- [-367.259] (-366.068) (-368.517) (-365.793) * (-367.409) (-365.611) (-366.393) [-366.891] -- 0:00:48
224500 -- (-366.023) [-367.050] (-368.398) (-367.827) * (-368.269) [-366.083] (-368.879) (-365.803) -- 0:00:48
225000 -- (-366.151) [-367.562] (-365.947) (-366.902) * (-369.886) (-365.758) (-364.985) [-366.154] -- 0:00:48
Average standard deviation of split frequencies: 0.015876
225500 -- (-367.712) (-367.591) [-371.207] (-368.235) * (-368.310) (-368.121) (-367.250) [-368.075] -- 0:00:48
226000 -- (-366.377) [-365.558] (-368.412) (-365.022) * (-368.312) (-364.928) (-365.221) [-367.632] -- 0:00:47
226500 -- (-365.678) [-366.490] (-365.901) (-368.852) * [-366.032] (-365.586) (-365.005) (-365.764) -- 0:00:47
227000 -- (-365.603) [-366.551] (-366.514) (-366.275) * (-365.307) (-368.063) [-365.822] (-366.104) -- 0:00:47
227500 -- (-368.161) (-366.822) (-367.997) [-365.452] * (-366.043) (-365.947) (-365.719) [-365.507] -- 0:00:47
228000 -- (-367.151) (-365.411) [-367.456] (-370.538) * (-365.302) (-371.579) (-365.614) [-364.926] -- 0:00:47
228500 -- [-373.781] (-366.455) (-365.310) (-366.872) * [-364.709] (-367.006) (-367.547) (-366.541) -- 0:00:47
229000 -- (-370.983) (-364.708) [-365.261] (-365.414) * (-370.259) [-365.261] (-369.200) (-368.722) -- 0:00:47
229500 -- (-369.418) (-371.463) [-370.982] (-366.450) * (-368.786) (-365.203) [-367.235] (-367.223) -- 0:00:47
230000 -- (-365.949) (-367.988) [-365.866] (-366.758) * (-368.083) (-365.708) (-365.508) [-370.175] -- 0:00:46
Average standard deviation of split frequencies: 0.014944
230500 -- (-366.013) [-366.006] (-368.615) (-367.280) * (-367.630) [-366.821] (-364.822) (-365.827) -- 0:00:46
231000 -- (-366.717) [-366.730] (-367.186) (-367.304) * (-366.026) (-366.765) [-365.430] (-370.048) -- 0:00:46
231500 -- (-364.863) [-366.343] (-368.515) (-368.254) * (-369.072) (-364.775) (-368.569) [-366.280] -- 0:00:46
232000 -- (-367.627) (-365.823) (-369.215) [-367.426] * (-366.942) (-368.080) (-367.418) [-370.078] -- 0:00:46
232500 -- (-366.740) (-369.245) [-370.414] (-366.176) * [-368.241] (-372.009) (-365.151) (-367.574) -- 0:00:46
233000 -- (-369.107) [-367.958] (-367.094) (-364.485) * (-365.605) (-371.104) (-369.558) [-367.618] -- 0:00:46
233500 -- (-366.651) (-365.757) [-369.392] (-366.323) * (-366.256) (-373.576) (-364.936) [-366.980] -- 0:00:45
234000 -- (-365.682) [-366.470] (-366.924) (-366.048) * (-366.421) [-366.898] (-368.016) (-366.090) -- 0:00:45
234500 -- (-368.250) [-368.255] (-365.824) (-366.247) * (-366.670) (-366.910) (-368.208) [-365.163] -- 0:00:45
235000 -- [-365.443] (-371.022) (-364.717) (-365.224) * (-369.775) (-365.715) [-365.444] (-366.336) -- 0:00:45
Average standard deviation of split frequencies: 0.013395
235500 -- (-365.043) [-365.242] (-365.816) (-366.294) * (-369.776) (-365.220) [-367.977] (-366.573) -- 0:00:45
236000 -- [-365.493] (-367.294) (-364.686) (-368.927) * (-369.932) [-365.280] (-367.460) (-365.833) -- 0:00:45
236500 -- [-366.461] (-367.600) (-366.811) (-365.196) * (-369.485) [-366.789] (-366.887) (-366.128) -- 0:00:45
237000 -- (-365.591) (-367.124) [-367.657] (-366.566) * [-369.776] (-368.269) (-366.161) (-369.480) -- 0:00:45
237500 -- (-366.157) (-365.854) (-365.911) [-369.356] * (-370.618) (-366.404) [-366.087] (-366.796) -- 0:00:44
238000 -- (-366.199) (-369.834) [-365.177] (-366.797) * (-372.652) (-364.962) (-365.560) [-365.167] -- 0:00:44
238500 -- (-365.617) (-371.182) (-367.255) [-367.791] * (-375.274) (-366.012) (-368.705) [-364.505] -- 0:00:47
239000 -- (-365.225) (-368.847) [-367.610] (-366.779) * [-374.316] (-365.110) (-365.880) (-364.305) -- 0:00:47
239500 -- (-367.598) (-369.454) (-369.563) [-366.844] * [-365.536] (-365.858) (-366.300) (-364.804) -- 0:00:47
240000 -- (-370.234) (-365.854) [-364.883] (-365.369) * (-365.979) [-365.048] (-366.389) (-367.706) -- 0:00:47
Average standard deviation of split frequencies: 0.013834
240500 -- [-366.744] (-365.531) (-364.980) (-365.664) * [-364.729] (-368.131) (-369.864) (-367.525) -- 0:00:47
241000 -- (-366.258) (-365.364) (-367.895) [-366.661] * (-365.729) (-370.198) (-369.895) [-365.782] -- 0:00:47
241500 -- (-365.155) [-364.754] (-365.969) (-373.846) * [-368.861] (-367.035) (-366.326) (-365.508) -- 0:00:47
242000 -- (-365.449) [-365.770] (-366.581) (-367.383) * (-367.097) (-369.422) [-365.728] (-368.312) -- 0:00:46
242500 -- [-367.220] (-366.944) (-367.135) (-367.084) * (-367.515) (-367.574) (-367.767) [-366.868] -- 0:00:46
243000 -- [-368.117] (-371.103) (-365.243) (-368.459) * (-368.296) (-365.921) (-365.968) [-365.163] -- 0:00:46
243500 -- [-367.892] (-371.651) (-364.622) (-369.090) * (-367.750) [-366.743] (-366.238) (-364.506) -- 0:00:46
244000 -- (-366.026) [-367.007] (-364.688) (-367.122) * (-367.859) (-368.439) [-368.625] (-368.671) -- 0:00:46
244500 -- [-365.156] (-368.959) (-366.452) (-370.447) * [-365.060] (-367.052) (-365.517) (-367.989) -- 0:00:46
245000 -- (-366.366) [-365.566] (-366.960) (-370.155) * (-366.012) (-370.245) [-365.255] (-371.254) -- 0:00:46
Average standard deviation of split frequencies: 0.013893
245500 -- (-365.335) [-366.299] (-364.955) (-366.809) * (-368.933) (-369.969) [-365.181] (-366.390) -- 0:00:46
246000 -- (-365.865) (-370.171) (-370.813) [-365.298] * [-369.508] (-366.226) (-366.191) (-365.823) -- 0:00:45
246500 -- (-370.770) [-365.560] (-365.481) (-366.950) * (-366.512) (-368.999) (-367.808) [-365.805] -- 0:00:45
247000 -- (-366.936) (-364.845) [-366.486] (-366.769) * (-369.173) [-365.126] (-366.722) (-371.960) -- 0:00:45
247500 -- [-365.006] (-365.967) (-365.643) (-364.662) * (-367.626) (-365.498) [-365.658] (-367.709) -- 0:00:45
248000 -- [-366.376] (-369.478) (-365.354) (-367.319) * (-366.304) (-367.619) [-365.989] (-366.252) -- 0:00:45
248500 -- (-366.264) (-372.084) [-364.569] (-368.724) * (-370.699) (-365.174) (-367.853) [-365.967] -- 0:00:45
249000 -- (-367.190) (-368.172) (-366.407) [-367.260] * (-366.338) [-369.534] (-367.451) (-365.015) -- 0:00:45
249500 -- [-367.121] (-368.289) (-368.810) (-369.632) * [-368.580] (-365.959) (-368.384) (-365.826) -- 0:00:45
250000 -- (-365.990) (-370.313) [-368.862] (-368.296) * (-368.623) (-366.483) [-364.554] (-366.199) -- 0:00:45
Average standard deviation of split frequencies: 0.015162
250500 -- [-367.493] (-367.903) (-369.065) (-369.818) * (-366.852) [-366.880] (-368.195) (-367.354) -- 0:00:44
251000 -- (-367.428) (-366.555) [-366.352] (-369.093) * (-366.644) (-369.234) [-369.130] (-366.091) -- 0:00:44
251500 -- (-373.597) (-371.319) [-366.511] (-367.525) * (-364.719) (-368.140) (-366.056) [-366.095] -- 0:00:44
252000 -- (-365.441) (-376.470) [-365.376] (-365.490) * [-365.474] (-366.523) (-367.546) (-370.546) -- 0:00:44
252500 -- (-365.122) (-368.006) (-365.961) [-365.252] * [-365.616] (-367.536) (-365.923) (-366.816) -- 0:00:44
253000 -- (-367.224) (-364.868) [-368.374] (-367.622) * [-366.461] (-365.553) (-368.784) (-366.413) -- 0:00:44
253500 -- (-365.398) (-365.152) (-365.843) [-366.685] * (-367.465) (-368.549) (-366.280) [-367.599] -- 0:00:44
254000 -- (-367.602) (-367.732) (-365.876) [-366.636] * (-365.312) [-367.394] (-365.619) (-370.040) -- 0:00:44
254500 -- (-366.856) (-365.615) (-365.567) [-366.301] * [-365.656] (-369.167) (-365.522) (-368.423) -- 0:00:43
255000 -- (-368.148) (-365.542) (-365.375) [-365.651] * (-367.738) [-368.286] (-367.115) (-369.121) -- 0:00:43
Average standard deviation of split frequencies: 0.014271
255500 -- (-366.493) (-365.818) (-366.175) [-366.607] * (-365.393) (-366.190) (-369.260) [-368.321] -- 0:00:46
256000 -- (-370.564) (-366.164) (-365.396) [-366.806] * (-368.217) [-368.383] (-365.547) (-368.287) -- 0:00:46
256500 -- [-367.544] (-365.085) (-367.270) (-368.358) * [-365.830] (-365.332) (-365.789) (-367.391) -- 0:00:46
257000 -- (-369.510) [-367.668] (-365.823) (-365.256) * [-374.608] (-369.696) (-364.882) (-366.884) -- 0:00:46
257500 -- (-366.053) (-367.460) [-368.986] (-367.305) * (-369.626) [-367.126] (-366.299) (-368.209) -- 0:00:46
258000 -- (-367.259) [-369.129] (-369.381) (-366.168) * (-366.738) (-368.582) (-366.847) [-365.964] -- 0:00:46
258500 -- (-366.100) [-367.449] (-368.575) (-366.932) * (-367.603) (-365.016) (-373.013) [-367.093] -- 0:00:45
259000 -- (-369.903) (-367.348) [-364.527] (-366.630) * [-365.590] (-367.078) (-366.416) (-365.921) -- 0:00:45
259500 -- (-368.881) [-367.161] (-366.369) (-366.003) * [-366.322] (-366.482) (-367.523) (-367.554) -- 0:00:45
260000 -- (-367.502) (-365.831) [-364.961] (-365.796) * (-372.284) [-365.692] (-365.789) (-365.613) -- 0:00:45
Average standard deviation of split frequencies: 0.016276
260500 -- [-370.373] (-366.726) (-364.740) (-366.422) * (-367.611) (-365.490) [-367.454] (-365.162) -- 0:00:45
261000 -- [-367.555] (-370.863) (-368.172) (-367.523) * [-366.756] (-365.883) (-367.435) (-368.649) -- 0:00:45
261500 -- [-365.450] (-369.140) (-366.768) (-366.261) * (-369.611) (-368.838) [-367.167] (-367.013) -- 0:00:45
262000 -- (-368.190) [-369.609] (-371.837) (-367.018) * (-365.680) (-364.740) (-367.125) [-369.748] -- 0:00:45
262500 -- (-367.641) (-369.269) (-365.676) [-365.764] * [-365.965] (-365.987) (-366.778) (-368.287) -- 0:00:44
263000 -- [-367.971] (-368.127) (-367.311) (-366.861) * (-366.113) (-367.397) [-367.010] (-372.466) -- 0:00:44
263500 -- (-364.938) (-366.699) (-374.302) [-367.221] * (-365.654) (-367.631) (-368.859) [-365.238] -- 0:00:44
264000 -- (-364.920) (-367.833) (-365.987) [-368.103] * (-365.848) (-369.795) (-367.341) [-367.597] -- 0:00:44
264500 -- (-368.160) (-367.119) [-367.333] (-369.555) * (-367.234) (-366.001) (-366.692) [-366.002] -- 0:00:44
265000 -- (-366.005) (-368.067) (-365.905) [-366.894] * [-370.370] (-370.140) (-370.000) (-364.699) -- 0:00:44
Average standard deviation of split frequencies: 0.014670
265500 -- (-367.295) (-367.652) (-364.960) [-368.439] * (-367.257) [-368.475] (-366.371) (-367.582) -- 0:00:44
266000 -- (-369.260) (-365.796) [-366.889] (-365.277) * (-366.198) [-365.484] (-366.848) (-367.838) -- 0:00:44
266500 -- (-369.688) [-366.592] (-365.844) (-366.933) * [-365.999] (-367.431) (-367.052) (-368.273) -- 0:00:44
267000 -- (-365.160) [-365.952] (-366.310) (-367.052) * [-366.462] (-366.914) (-365.271) (-369.816) -- 0:00:43
267500 -- [-372.212] (-366.202) (-366.923) (-364.768) * (-365.269) [-370.642] (-367.606) (-366.740) -- 0:00:43
268000 -- [-368.814] (-366.861) (-368.245) (-367.267) * [-364.569] (-372.481) (-372.495) (-366.259) -- 0:00:43
268500 -- (-370.595) (-368.266) (-367.270) [-367.100] * (-365.104) (-370.327) [-369.119] (-364.595) -- 0:00:43
269000 -- (-365.442) (-369.183) [-366.251] (-369.132) * [-365.671] (-369.883) (-368.843) (-368.657) -- 0:00:43
269500 -- (-367.780) (-367.974) (-365.157) [-367.107] * (-367.239) [-366.830] (-364.833) (-367.351) -- 0:00:43
270000 -- [-367.493] (-369.362) (-365.508) (-368.395) * (-367.939) [-366.723] (-365.580) (-367.604) -- 0:00:43
Average standard deviation of split frequencies: 0.014610
270500 -- (-364.667) (-366.646) (-368.959) [-368.779] * [-365.191] (-364.684) (-367.452) (-370.061) -- 0:00:43
271000 -- [-367.919] (-366.665) (-367.600) (-365.489) * (-365.259) (-366.843) (-364.888) [-366.803] -- 0:00:43
271500 -- [-365.431] (-365.662) (-370.631) (-366.242) * [-366.709] (-367.860) (-364.703) (-365.783) -- 0:00:42
272000 -- [-364.822] (-369.594) (-371.285) (-368.539) * (-367.942) (-365.520) (-369.177) [-364.757] -- 0:00:42
272500 -- [-365.480] (-366.361) (-369.285) (-368.375) * (-366.798) (-367.992) (-373.781) [-370.513] -- 0:00:45
273000 -- [-366.204] (-365.844) (-364.883) (-365.842) * (-368.459) (-369.444) (-365.252) [-369.331] -- 0:00:45
273500 -- [-367.469] (-367.396) (-365.196) (-366.493) * [-367.611] (-367.879) (-365.208) (-370.738) -- 0:00:45
274000 -- [-365.711] (-365.419) (-366.102) (-365.970) * [-365.509] (-369.169) (-364.532) (-367.716) -- 0:00:45
274500 -- (-366.008) (-364.844) (-365.712) [-364.824] * (-365.871) (-366.683) (-368.181) [-365.611] -- 0:00:44
275000 -- [-367.435] (-365.388) (-368.413) (-365.617) * [-367.723] (-367.805) (-369.401) (-365.356) -- 0:00:44
Average standard deviation of split frequencies: 0.015277
275500 -- (-365.629) [-365.881] (-366.259) (-365.710) * (-367.135) [-367.990] (-368.710) (-366.503) -- 0:00:44
276000 -- (-367.585) (-366.833) (-366.605) [-365.159] * (-368.809) (-369.407) (-364.653) [-365.652] -- 0:00:44
276500 -- [-366.606] (-367.350) (-365.420) (-369.390) * (-370.486) (-368.341) [-367.419] (-366.379) -- 0:00:44
277000 -- (-367.566) [-366.709] (-365.628) (-365.900) * [-365.015] (-369.737) (-366.065) (-368.042) -- 0:00:44
277500 -- (-367.157) [-365.383] (-365.099) (-366.687) * [-366.326] (-366.395) (-366.130) (-367.985) -- 0:00:44
278000 -- (-368.275) (-369.174) [-366.023] (-364.973) * (-365.363) (-371.324) (-366.485) [-366.507] -- 0:00:44
278500 -- [-365.801] (-364.886) (-366.727) (-365.967) * (-371.059) (-369.682) (-366.428) [-368.525] -- 0:00:44
279000 -- (-367.104) (-366.255) (-365.274) [-367.504] * [-365.280] (-367.444) (-366.597) (-368.756) -- 0:00:43
279500 -- [-377.743] (-371.619) (-367.032) (-365.541) * [-365.299] (-369.501) (-365.735) (-366.554) -- 0:00:43
280000 -- (-370.524) (-369.241) (-365.536) [-364.635] * (-369.709) [-369.031] (-368.235) (-365.269) -- 0:00:43
Average standard deviation of split frequencies: 0.015808
280500 -- (-367.405) (-366.415) (-367.314) [-364.886] * (-367.581) (-370.285) (-364.940) [-367.651] -- 0:00:43
281000 -- (-367.017) (-370.592) [-364.404] (-364.985) * (-367.859) (-367.694) (-368.463) [-373.145] -- 0:00:43
281500 -- [-365.040] (-366.240) (-365.348) (-364.476) * (-365.883) [-369.427] (-371.193) (-366.948) -- 0:00:43
282000 -- (-365.016) (-367.461) (-366.925) [-364.681] * (-365.990) (-367.440) (-366.068) [-365.518] -- 0:00:43
282500 -- [-365.041] (-370.955) (-367.423) (-365.450) * (-366.737) (-365.904) (-369.031) [-370.045] -- 0:00:43
283000 -- (-371.063) (-365.124) [-368.040] (-365.694) * (-368.336) (-366.875) (-369.155) [-370.282] -- 0:00:43
283500 -- (-369.154) (-366.389) [-368.627] (-370.200) * [-364.733] (-366.668) (-369.010) (-366.430) -- 0:00:42
284000 -- (-367.135) (-368.187) [-365.389] (-370.825) * (-365.283) (-368.622) (-366.768) [-368.212] -- 0:00:42
284500 -- (-367.249) (-364.931) [-365.487] (-369.135) * [-366.219] (-365.959) (-365.236) (-365.401) -- 0:00:42
285000 -- (-367.051) (-364.801) (-373.516) [-366.458] * (-367.961) (-366.857) [-367.604] (-367.400) -- 0:00:42
Average standard deviation of split frequencies: 0.014834
285500 -- (-366.718) (-366.459) [-367.136] (-366.363) * (-368.565) (-368.217) (-369.104) [-365.138] -- 0:00:42
286000 -- (-368.710) (-365.464) (-365.020) [-365.852] * (-366.257) (-366.795) [-365.250] (-368.217) -- 0:00:42
286500 -- (-366.408) [-366.612] (-367.378) (-367.891) * (-367.496) (-369.611) (-364.625) [-368.840] -- 0:00:42
287000 -- [-365.076] (-365.905) (-367.389) (-370.340) * (-368.158) (-369.718) (-364.496) [-368.616] -- 0:00:42
287500 -- [-366.057] (-365.058) (-366.214) (-366.111) * (-365.086) (-368.064) [-367.468] (-368.457) -- 0:00:42
288000 -- (-366.899) (-365.005) (-367.833) [-366.352] * [-367.209] (-367.155) (-365.663) (-368.856) -- 0:00:42
288500 -- (-366.143) (-366.365) [-365.713] (-365.910) * (-367.056) [-365.649] (-366.259) (-370.172) -- 0:00:41
289000 -- (-364.934) (-366.046) [-364.717] (-369.872) * [-367.550] (-366.724) (-366.101) (-369.201) -- 0:00:41
289500 -- (-366.979) (-366.614) (-365.215) [-371.415] * (-364.621) [-365.633] (-366.967) (-365.031) -- 0:00:44
290000 -- (-365.233) (-366.773) [-365.890] (-367.893) * (-367.341) [-366.619] (-366.826) (-370.626) -- 0:00:44
Average standard deviation of split frequencies: 0.015279
290500 -- (-364.571) (-366.820) [-368.889] (-369.793) * [-368.381] (-368.589) (-365.218) (-372.465) -- 0:00:43
291000 -- [-365.740] (-367.849) (-365.965) (-365.904) * [-372.565] (-367.706) (-365.748) (-370.351) -- 0:00:43
291500 -- (-366.719) (-369.642) (-367.119) [-368.434] * (-365.889) [-366.378] (-365.076) (-375.219) -- 0:00:43
292000 -- (-368.265) (-369.567) (-367.201) [-366.080] * (-366.666) (-367.805) (-366.310) [-365.673] -- 0:00:43
292500 -- (-369.058) (-369.250) [-366.345] (-365.998) * (-367.006) [-365.870] (-367.185) (-369.888) -- 0:00:43
293000 -- (-367.691) (-366.658) (-365.594) [-367.319] * (-367.295) (-365.987) (-370.755) [-369.554] -- 0:00:43
293500 -- (-365.611) [-367.704] (-367.521) (-365.938) * (-365.288) [-365.346] (-365.381) (-365.184) -- 0:00:43
294000 -- (-365.936) [-368.222] (-366.095) (-367.959) * (-367.232) (-366.438) [-367.856] (-369.540) -- 0:00:43
294500 -- (-367.962) (-365.568) [-365.686] (-366.705) * [-367.789] (-366.375) (-366.641) (-370.269) -- 0:00:43
295000 -- [-365.377] (-372.005) (-367.088) (-367.486) * (-365.829) (-372.022) (-366.035) [-367.110] -- 0:00:43
Average standard deviation of split frequencies: 0.013998
295500 -- (-367.330) (-366.122) [-366.299] (-366.048) * [-366.009] (-367.868) (-365.645) (-367.990) -- 0:00:42
296000 -- (-366.293) (-368.682) (-367.944) [-366.322] * (-367.668) [-365.693] (-366.535) (-368.580) -- 0:00:42
296500 -- [-365.361] (-367.240) (-368.916) (-365.867) * (-370.098) [-367.724] (-366.338) (-366.688) -- 0:00:42
297000 -- (-365.640) (-365.541) [-371.176] (-366.672) * [-366.018] (-366.088) (-364.604) (-369.530) -- 0:00:42
297500 -- (-367.686) (-365.202) (-370.249) [-369.087] * (-366.217) (-367.456) [-365.076] (-372.358) -- 0:00:42
298000 -- [-370.497] (-368.314) (-372.465) (-370.340) * [-367.645] (-367.794) (-364.445) (-366.870) -- 0:00:42
298500 -- (-367.403) (-370.710) (-364.849) [-365.080] * (-368.169) [-367.119] (-364.596) (-365.657) -- 0:00:42
299000 -- [-365.809] (-367.255) (-366.903) (-366.007) * (-366.013) (-371.604) (-365.753) [-365.927] -- 0:00:42
299500 -- [-365.618] (-366.363) (-374.716) (-367.131) * (-364.403) (-366.046) (-367.732) [-366.202] -- 0:00:42
300000 -- [-366.956] (-369.791) (-374.356) (-364.812) * [-365.937] (-371.787) (-365.949) (-369.001) -- 0:00:42
Average standard deviation of split frequencies: 0.015349
300500 -- [-368.427] (-366.151) (-367.659) (-365.408) * [-368.486] (-369.082) (-365.879) (-372.053) -- 0:00:41
301000 -- (-368.443) (-370.129) [-368.996] (-365.102) * (-368.697) (-368.311) (-365.572) [-366.587] -- 0:00:41
301500 -- [-369.144] (-367.816) (-365.411) (-365.647) * (-366.233) (-373.163) (-365.173) [-368.357] -- 0:00:41
302000 -- (-367.304) (-364.892) [-364.913] (-364.611) * [-366.809] (-365.004) (-366.818) (-367.702) -- 0:00:41
302500 -- (-365.996) (-365.011) (-365.215) [-366.465] * (-365.539) [-366.329] (-366.931) (-364.753) -- 0:00:41
303000 -- (-366.370) [-365.084] (-365.250) (-365.131) * (-366.100) (-365.475) [-365.198] (-371.074) -- 0:00:41
303500 -- (-366.785) [-366.844] (-370.447) (-365.398) * [-365.334] (-365.390) (-366.678) (-365.999) -- 0:00:41
304000 -- (-364.894) [-365.805] (-369.856) (-368.444) * (-365.437) (-365.537) (-366.179) [-365.385] -- 0:00:41
304500 -- [-367.785] (-366.252) (-366.996) (-365.021) * [-367.389] (-366.733) (-366.737) (-366.270) -- 0:00:41
305000 -- [-367.046] (-365.565) (-365.389) (-367.327) * [-365.675] (-369.870) (-367.413) (-365.795) -- 0:00:41
Average standard deviation of split frequencies: 0.016216
305500 -- (-365.310) (-366.608) [-365.830] (-367.157) * (-368.204) (-366.851) [-366.423] (-368.898) -- 0:00:40
306000 -- (-365.175) (-366.235) (-370.964) [-364.788] * (-371.490) [-367.623] (-366.142) (-369.405) -- 0:00:40
306500 -- [-369.547] (-366.044) (-368.168) (-365.175) * (-370.748) (-366.950) (-367.709) [-367.484] -- 0:00:42
307000 -- (-366.096) [-365.376] (-367.472) (-370.823) * (-365.045) (-369.934) [-365.315] (-365.712) -- 0:00:42
307500 -- (-365.411) [-368.661] (-365.992) (-365.561) * (-365.003) (-370.445) (-368.803) [-366.997] -- 0:00:42
308000 -- (-364.876) (-365.438) [-367.234] (-367.211) * (-364.622) [-366.569] (-372.739) (-365.415) -- 0:00:42
308500 -- (-366.309) (-370.894) [-366.950] (-368.593) * (-364.758) (-368.903) [-368.354] (-367.405) -- 0:00:42
309000 -- (-365.250) (-368.109) [-364.779] (-365.842) * [-366.313] (-366.760) (-367.887) (-367.205) -- 0:00:42
309500 -- (-365.181) [-365.716] (-370.810) (-365.650) * (-371.485) (-367.940) (-368.893) [-366.339] -- 0:00:42
310000 -- (-367.488) [-369.654] (-366.461) (-368.020) * (-370.136) (-368.385) (-366.490) [-365.107] -- 0:00:42
Average standard deviation of split frequencies: 0.015573
310500 -- (-367.112) (-368.538) [-368.859] (-366.458) * (-367.850) (-373.152) (-365.306) [-369.314] -- 0:00:42
311000 -- [-364.931] (-374.221) (-368.737) (-366.528) * (-369.803) (-367.375) [-365.924] (-371.202) -- 0:00:42
311500 -- (-366.959) (-368.180) [-373.293] (-367.413) * (-368.797) (-367.469) [-366.667] (-372.013) -- 0:00:41
312000 -- (-368.359) [-365.426] (-368.401) (-368.275) * (-367.247) (-366.233) (-369.316) [-369.008] -- 0:00:41
312500 -- (-365.562) (-367.749) [-365.612] (-365.015) * (-367.694) [-367.462] (-367.868) (-366.946) -- 0:00:41
313000 -- (-367.745) [-366.158] (-370.038) (-367.488) * [-367.359] (-366.618) (-365.733) (-366.336) -- 0:00:41
313500 -- (-369.813) [-365.872] (-367.030) (-365.668) * [-369.850] (-366.664) (-368.525) (-365.388) -- 0:00:41
314000 -- [-366.532] (-370.233) (-366.803) (-366.547) * [-367.753] (-365.243) (-367.666) (-366.435) -- 0:00:41
314500 -- (-365.293) [-366.813] (-371.873) (-366.082) * [-366.722] (-371.906) (-365.188) (-365.848) -- 0:00:41
315000 -- (-367.229) [-367.043] (-365.780) (-366.868) * [-364.893] (-365.029) (-369.128) (-367.099) -- 0:00:41
Average standard deviation of split frequencies: 0.014669
315500 -- (-367.156) (-367.882) (-367.205) [-366.431] * (-368.446) [-366.588] (-367.827) (-368.524) -- 0:00:41
316000 -- (-367.822) [-365.148] (-366.832) (-366.700) * [-364.668] (-367.325) (-368.184) (-369.992) -- 0:00:41
316500 -- (-367.224) [-365.419] (-368.865) (-366.046) * (-365.707) [-369.449] (-366.597) (-367.803) -- 0:00:41
317000 -- (-366.803) (-367.882) [-365.869] (-367.163) * (-367.408) [-368.726] (-367.433) (-367.413) -- 0:00:40
317500 -- (-365.029) (-365.950) (-367.947) [-368.935] * (-366.905) [-365.524] (-366.836) (-367.218) -- 0:00:40
318000 -- (-369.765) (-365.993) [-369.673] (-370.739) * (-367.264) (-365.285) [-367.799] (-366.426) -- 0:00:40
318500 -- (-365.978) (-364.944) [-368.781] (-367.188) * (-367.801) [-370.736] (-365.273) (-369.431) -- 0:00:40
319000 -- [-364.786] (-367.431) (-366.454) (-365.038) * (-367.949) (-373.408) [-365.050] (-366.420) -- 0:00:40
319500 -- (-369.856) (-370.315) [-369.940] (-366.631) * (-369.900) (-368.753) (-366.355) [-365.621] -- 0:00:40
320000 -- (-365.993) [-365.557] (-367.955) (-366.777) * (-367.363) [-366.132] (-365.350) (-367.592) -- 0:00:40
Average standard deviation of split frequencies: 0.015133
320500 -- (-365.420) [-366.964] (-370.415) (-366.708) * (-367.626) (-369.045) [-365.673] (-369.850) -- 0:00:40
321000 -- (-369.456) (-366.962) (-366.363) [-365.248] * (-368.152) (-370.787) [-370.377] (-367.089) -- 0:00:40
321500 -- (-365.282) (-366.270) (-365.775) [-367.110] * [-365.988] (-368.815) (-372.138) (-365.917) -- 0:00:40
322000 -- (-366.595) (-368.236) [-366.646] (-366.688) * [-366.636] (-368.857) (-373.227) (-364.842) -- 0:00:40
322500 -- (-366.406) [-367.352] (-365.657) (-366.902) * (-366.235) (-370.888) (-375.066) [-366.638] -- 0:00:39
323000 -- (-372.126) [-364.858] (-367.161) (-365.825) * (-366.830) (-364.922) [-368.807] (-366.770) -- 0:00:39
323500 -- [-366.660] (-364.925) (-366.396) (-370.263) * (-365.415) (-366.499) (-366.503) [-367.205] -- 0:00:41
324000 -- (-365.226) (-369.773) [-364.779] (-367.373) * (-369.579) (-373.033) [-367.953] (-366.629) -- 0:00:41
324500 -- (-364.587) (-366.273) (-368.859) [-366.085] * (-366.427) [-364.777] (-366.556) (-365.993) -- 0:00:41
325000 -- (-367.851) (-367.320) [-365.821] (-366.297) * [-365.525] (-365.970) (-367.261) (-368.502) -- 0:00:41
Average standard deviation of split frequencies: 0.014384
325500 -- (-365.678) (-370.816) (-364.912) [-366.031] * (-365.025) (-366.967) [-365.842] (-365.196) -- 0:00:41
326000 -- (-366.768) (-366.145) (-364.451) [-365.549] * (-365.867) [-366.501] (-368.155) (-365.511) -- 0:00:41
326500 -- (-366.165) [-365.026] (-368.805) (-365.907) * (-366.151) (-365.419) [-365.826] (-366.976) -- 0:00:41
327000 -- (-366.801) (-366.577) (-370.829) [-364.816] * [-367.751] (-364.839) (-367.665) (-368.780) -- 0:00:41
327500 -- (-366.779) [-365.054] (-372.912) (-368.825) * [-366.998] (-365.173) (-366.796) (-370.923) -- 0:00:41
328000 -- (-367.712) [-367.323] (-365.856) (-366.213) * (-372.981) (-364.448) (-365.394) [-367.388] -- 0:00:40
328500 -- (-366.936) [-368.389] (-365.977) (-366.795) * (-368.205) [-367.414] (-368.901) (-369.894) -- 0:00:40
329000 -- [-367.898] (-369.560) (-365.698) (-365.160) * [-366.196] (-367.922) (-366.416) (-367.161) -- 0:00:40
329500 -- (-365.675) (-371.128) (-366.110) [-365.427] * (-369.645) (-364.968) [-369.952] (-368.799) -- 0:00:40
330000 -- (-365.556) (-368.492) (-368.874) [-366.464] * (-368.551) (-367.548) [-366.945] (-365.930) -- 0:00:40
Average standard deviation of split frequencies: 0.013656
330500 -- (-369.575) (-367.342) (-367.501) [-367.472] * (-364.858) (-366.301) [-365.384] (-369.159) -- 0:00:40
331000 -- [-367.794] (-369.203) (-370.009) (-366.206) * (-366.680) (-367.188) [-368.886] (-367.529) -- 0:00:40
331500 -- (-369.809) (-367.792) [-369.148] (-373.581) * [-366.220] (-373.205) (-366.103) (-364.735) -- 0:00:40
332000 -- (-367.572) (-365.018) (-369.757) [-364.665] * [-365.325] (-366.809) (-365.293) (-365.408) -- 0:00:40
332500 -- (-365.059) [-367.520] (-371.602) (-367.390) * [-366.846] (-368.938) (-365.529) (-370.118) -- 0:00:40
333000 -- (-364.968) [-370.283] (-368.406) (-364.989) * (-365.842) (-369.069) [-366.387] (-370.807) -- 0:00:40
333500 -- (-365.177) (-366.938) (-368.211) [-366.476] * (-365.546) (-365.556) [-365.153] (-367.336) -- 0:00:39
334000 -- (-367.914) (-369.424) [-365.842] (-371.143) * (-365.600) (-367.675) [-365.322] (-366.248) -- 0:00:39
334500 -- [-369.071] (-366.768) (-366.457) (-367.002) * (-367.860) [-365.975] (-365.539) (-366.727) -- 0:00:39
335000 -- (-366.397) (-366.838) [-366.208] (-368.173) * (-367.470) (-364.988) [-368.075] (-369.500) -- 0:00:39
Average standard deviation of split frequencies: 0.013365
335500 -- [-367.236] (-367.619) (-365.628) (-366.797) * [-368.680] (-370.220) (-366.657) (-368.595) -- 0:00:39
336000 -- [-365.179] (-367.700) (-369.062) (-365.615) * (-367.104) (-366.782) [-366.781] (-367.885) -- 0:00:39
336500 -- (-367.573) [-366.966] (-367.768) (-367.293) * [-367.297] (-365.263) (-365.730) (-371.476) -- 0:00:39
337000 -- (-372.257) (-366.267) [-365.730] (-370.521) * (-366.796) (-369.393) (-366.908) [-365.808] -- 0:00:39
337500 -- (-368.240) [-365.750] (-366.051) (-367.549) * (-365.620) (-369.615) (-371.721) [-370.560] -- 0:00:39
338000 -- (-367.151) (-367.426) (-367.797) [-364.985] * (-370.545) (-367.181) [-366.089] (-365.775) -- 0:00:39
338500 -- [-365.889] (-368.320) (-366.776) (-369.424) * (-366.352) (-366.765) (-366.882) [-368.924] -- 0:00:39
339000 -- [-365.985] (-365.706) (-366.722) (-370.028) * (-369.781) [-366.767] (-369.135) (-370.191) -- 0:00:38
339500 -- (-368.013) (-365.640) (-367.021) [-365.933] * (-367.469) (-365.885) [-367.847] (-367.927) -- 0:00:38
340000 -- (-365.259) (-366.033) (-367.066) [-365.167] * (-365.595) (-367.937) [-367.259] (-366.428) -- 0:00:38
Average standard deviation of split frequencies: 0.014789
340500 -- (-365.307) (-365.775) [-368.887] (-364.669) * (-366.472) (-368.626) (-365.403) [-365.292] -- 0:00:40
341000 -- [-366.889] (-366.254) (-370.091) (-365.454) * (-368.836) (-368.276) (-367.029) [-367.052] -- 0:00:40
341500 -- (-367.479) (-365.845) [-368.035] (-367.679) * (-367.800) [-365.304] (-364.568) (-365.008) -- 0:00:40
342000 -- (-370.057) (-367.017) (-366.669) [-365.380] * (-365.862) (-365.207) [-366.471] (-368.125) -- 0:00:40
342500 -- (-367.015) (-372.833) (-367.443) [-365.755] * (-365.362) (-365.945) [-367.120] (-365.946) -- 0:00:40
343000 -- (-373.821) (-367.160) (-366.277) [-365.207] * (-366.905) (-365.380) (-365.908) [-368.391] -- 0:00:40
343500 -- (-370.045) (-367.198) (-369.817) [-367.576] * (-374.288) [-365.741] (-371.949) (-366.429) -- 0:00:40
344000 -- (-366.351) [-367.527] (-370.836) (-365.360) * (-375.075) (-368.132) (-369.325) [-365.130] -- 0:00:40
344500 -- [-367.896] (-367.774) (-366.232) (-366.165) * [-365.644] (-366.733) (-366.182) (-365.312) -- 0:00:39
345000 -- (-366.981) (-366.284) (-368.186) [-366.161] * [-366.641] (-368.221) (-366.924) (-365.197) -- 0:00:39
Average standard deviation of split frequencies: 0.013304
345500 -- (-366.134) [-366.761] (-367.111) (-368.156) * (-367.745) [-365.993] (-367.435) (-365.895) -- 0:00:39
346000 -- [-371.763] (-366.618) (-367.520) (-365.544) * [-365.429] (-369.391) (-365.305) (-365.870) -- 0:00:39
346500 -- (-366.573) [-365.677] (-365.878) (-367.086) * (-365.786) [-368.453] (-366.825) (-365.997) -- 0:00:39
347000 -- (-368.212) [-365.568] (-369.696) (-366.228) * (-364.884) (-364.915) (-369.597) [-369.055] -- 0:00:39
347500 -- (-365.086) (-368.535) (-374.059) [-369.502] * (-367.446) [-367.571] (-371.335) (-372.194) -- 0:00:39
348000 -- (-369.504) [-369.043] (-368.897) (-368.795) * [-368.291] (-367.185) (-369.121) (-369.499) -- 0:00:39
348500 -- (-369.544) (-370.582) (-369.705) [-369.419] * (-367.120) (-366.564) [-365.902] (-367.606) -- 0:00:39
349000 -- (-366.149) [-367.156] (-368.256) (-369.012) * [-369.350] (-364.748) (-371.726) (-369.123) -- 0:00:39
349500 -- (-368.949) (-365.178) [-367.748] (-365.354) * (-368.295) (-367.807) [-368.505] (-377.082) -- 0:00:39
350000 -- (-368.268) (-364.672) [-365.493] (-375.179) * (-365.117) (-368.845) [-365.181] (-372.182) -- 0:00:39
Average standard deviation of split frequencies: 0.013527
350500 -- (-365.901) (-365.910) [-365.912] (-369.004) * [-366.274] (-373.436) (-366.030) (-366.486) -- 0:00:38
351000 -- (-366.347) (-365.915) [-365.875] (-371.043) * [-367.200] (-371.331) (-365.435) (-368.909) -- 0:00:38
351500 -- [-367.155] (-365.404) (-367.350) (-374.010) * (-366.280) [-367.860] (-368.078) (-365.223) -- 0:00:38
352000 -- [-366.479] (-366.464) (-369.678) (-368.546) * (-364.966) (-366.831) (-366.285) [-366.841] -- 0:00:38
352500 -- [-370.591] (-367.601) (-370.527) (-368.583) * (-366.965) (-364.780) (-366.445) [-366.834] -- 0:00:38
353000 -- [-366.899] (-371.255) (-365.654) (-364.769) * (-366.343) [-367.212] (-366.372) (-367.078) -- 0:00:38
353500 -- (-365.139) (-368.243) [-367.551] (-367.354) * (-368.463) (-365.098) [-365.609] (-367.361) -- 0:00:38
354000 -- [-367.833] (-368.656) (-367.874) (-367.899) * (-364.809) (-366.440) [-365.929] (-365.683) -- 0:00:38
354500 -- (-367.431) (-369.961) [-365.556] (-367.565) * (-366.202) (-369.540) (-365.648) [-366.324] -- 0:00:38
355000 -- (-368.242) [-365.386] (-365.892) (-365.956) * [-366.297] (-365.665) (-365.828) (-367.309) -- 0:00:38
Average standard deviation of split frequencies: 0.012229
355500 -- [-366.076] (-367.829) (-366.725) (-366.149) * (-368.266) (-365.478) (-368.083) [-368.464] -- 0:00:38
356000 -- (-367.813) (-364.952) (-366.257) [-365.755] * (-366.605) [-365.165] (-366.828) (-368.374) -- 0:00:37
356500 -- (-367.408) (-365.443) (-367.958) [-365.031] * (-369.603) [-370.606] (-366.795) (-365.995) -- 0:00:37
357000 -- (-365.760) (-367.640) (-366.744) [-365.872] * (-365.674) [-368.597] (-366.708) (-366.245) -- 0:00:37
357500 -- (-371.268) (-371.133) [-367.667] (-367.087) * [-365.908] (-365.005) (-368.053) (-366.520) -- 0:00:39
358000 -- [-368.524] (-369.709) (-370.617) (-366.820) * (-367.502) (-365.974) [-368.320] (-369.855) -- 0:00:39
358500 -- [-366.552] (-371.251) (-373.869) (-364.838) * (-367.995) (-365.986) (-366.553) [-366.313] -- 0:00:39
359000 -- (-365.192) [-366.881] (-370.243) (-364.794) * (-366.174) [-365.783] (-368.209) (-368.897) -- 0:00:39
359500 -- (-375.007) [-365.659] (-367.789) (-366.174) * (-368.321) (-365.353) [-367.088] (-365.313) -- 0:00:39
360000 -- (-366.062) (-369.780) (-366.711) [-367.741] * (-365.671) (-367.790) [-365.961] (-370.993) -- 0:00:39
Average standard deviation of split frequencies: 0.013070
360500 -- (-366.841) (-371.567) [-366.729] (-365.823) * (-365.518) (-366.511) [-367.310] (-370.533) -- 0:00:39
361000 -- (-371.961) [-366.251] (-368.089) (-368.621) * (-365.587) [-366.717] (-366.488) (-368.428) -- 0:00:38
361500 -- (-369.105) (-365.030) [-366.412] (-366.797) * (-365.381) (-366.815) (-365.372) [-365.128] -- 0:00:38
362000 -- [-367.777] (-364.501) (-368.407) (-366.121) * (-366.218) (-368.051) [-368.611] (-370.354) -- 0:00:38
362500 -- (-367.480) (-370.071) (-366.538) [-367.161] * (-370.019) (-367.622) (-365.927) [-365.055] -- 0:00:38
363000 -- (-371.263) (-370.469) [-365.506] (-367.323) * [-366.384] (-366.337) (-367.356) (-367.464) -- 0:00:38
363500 -- [-368.472] (-366.662) (-367.619) (-367.035) * [-366.438] (-367.835) (-366.844) (-366.342) -- 0:00:38
364000 -- (-366.143) (-366.929) [-368.224] (-367.982) * (-368.039) [-366.119] (-366.585) (-364.590) -- 0:00:38
364500 -- (-367.543) (-366.747) [-366.503] (-367.438) * (-368.966) [-366.005] (-369.072) (-367.187) -- 0:00:38
365000 -- [-365.975] (-367.926) (-366.431) (-368.922) * [-366.060] (-368.846) (-366.986) (-366.837) -- 0:00:38
Average standard deviation of split frequencies: 0.013166
365500 -- [-366.801] (-366.709) (-367.162) (-365.607) * (-371.857) (-366.529) (-365.284) [-367.117] -- 0:00:38
366000 -- (-366.648) (-365.939) [-367.162] (-366.391) * (-368.066) [-368.457] (-369.518) (-364.740) -- 0:00:38
366500 -- (-369.530) [-367.180] (-369.419) (-364.735) * (-370.477) (-371.028) [-368.401] (-365.876) -- 0:00:38
367000 -- (-367.370) [-365.955] (-372.496) (-365.576) * (-365.834) (-367.385) (-366.363) [-365.460] -- 0:00:37
367500 -- (-367.369) (-365.791) (-369.913) [-365.975] * [-364.948] (-366.561) (-366.486) (-365.654) -- 0:00:37
368000 -- (-368.694) (-370.586) (-366.578) [-369.138] * (-365.038) [-365.003] (-367.743) (-367.987) -- 0:00:37
368500 -- [-368.936] (-365.372) (-365.196) (-368.777) * (-367.098) (-366.044) [-367.104] (-368.240) -- 0:00:37
369000 -- (-372.302) [-366.152] (-369.860) (-365.815) * (-367.572) [-366.706] (-373.207) (-365.627) -- 0:00:37
369500 -- [-365.070] (-365.917) (-371.714) (-365.927) * (-364.565) (-369.317) (-370.424) [-365.230] -- 0:00:37
370000 -- [-366.241] (-365.911) (-372.984) (-365.509) * (-365.861) (-366.270) (-366.481) [-366.423] -- 0:00:37
Average standard deviation of split frequencies: 0.013283
370500 -- (-366.156) [-368.272] (-365.048) (-366.988) * [-364.888] (-366.636) (-366.338) (-366.376) -- 0:00:37
371000 -- [-365.616] (-365.748) (-367.339) (-365.575) * [-368.823] (-366.347) (-366.742) (-366.096) -- 0:00:37
371500 -- (-367.198) [-366.593] (-369.702) (-368.992) * (-365.654) (-367.999) (-365.343) [-369.846] -- 0:00:37
372000 -- (-365.424) [-367.037] (-369.960) (-367.959) * (-366.781) (-369.493) (-364.967) [-365.339] -- 0:00:37
372500 -- [-365.667] (-369.647) (-368.325) (-364.777) * (-367.286) [-366.316] (-366.790) (-366.999) -- 0:00:37
373000 -- (-367.258) (-374.483) (-367.423) [-365.853] * (-367.917) (-366.597) [-369.970] (-365.279) -- 0:00:36
373500 -- [-365.286] (-366.708) (-370.410) (-367.910) * (-366.216) (-366.216) [-372.382] (-365.173) -- 0:00:36
374000 -- (-366.569) [-366.578] (-365.484) (-367.064) * (-367.858) (-369.108) (-368.653) [-366.241] -- 0:00:36
374500 -- (-369.837) [-365.794] (-368.023) (-367.790) * (-364.905) (-366.419) (-367.755) [-364.773] -- 0:00:38
375000 -- (-365.724) [-366.594] (-367.785) (-365.685) * (-366.345) (-368.419) [-364.853] (-367.219) -- 0:00:38
Average standard deviation of split frequencies: 0.013422
375500 -- (-365.736) (-366.658) [-367.073] (-365.789) * (-364.745) (-368.947) [-364.924] (-365.724) -- 0:00:38
376000 -- [-365.763] (-366.948) (-366.601) (-366.375) * [-365.618] (-365.404) (-366.092) (-365.661) -- 0:00:38
376500 -- (-366.883) [-366.326] (-367.453) (-368.411) * (-368.708) [-365.130] (-365.430) (-367.238) -- 0:00:38
377000 -- (-367.966) [-366.149] (-366.515) (-369.100) * (-367.332) [-365.645] (-368.810) (-364.769) -- 0:00:38
377500 -- (-366.263) (-366.564) [-370.034] (-368.701) * (-367.589) (-366.011) [-366.665] (-365.693) -- 0:00:37
378000 -- (-365.213) [-368.342] (-368.638) (-369.950) * [-365.468] (-366.253) (-365.670) (-367.596) -- 0:00:37
378500 -- [-364.549] (-367.401) (-368.905) (-365.799) * (-366.980) (-367.457) (-366.157) [-365.811] -- 0:00:37
379000 -- (-367.439) [-367.556] (-369.806) (-365.231) * (-370.393) (-366.928) (-366.743) [-369.705] -- 0:00:37
379500 -- (-367.978) (-365.369) (-365.392) [-365.743] * (-367.153) (-365.461) [-368.087] (-365.144) -- 0:00:37
380000 -- (-364.984) (-366.693) (-367.339) [-365.741] * (-369.657) (-368.589) [-367.830] (-365.495) -- 0:00:37
Average standard deviation of split frequencies: 0.013768
380500 -- [-368.388] (-365.741) (-364.879) (-365.194) * [-365.778] (-367.458) (-365.006) (-364.874) -- 0:00:37
381000 -- (-369.290) (-365.390) [-366.272] (-365.838) * [-369.539] (-370.589) (-366.439) (-370.112) -- 0:00:37
381500 -- (-365.469) [-366.580] (-366.852) (-367.022) * (-365.202) (-369.472) [-369.507] (-369.185) -- 0:00:37
382000 -- (-370.689) [-364.659] (-366.784) (-366.834) * [-368.276] (-367.641) (-368.039) (-372.614) -- 0:00:37
382500 -- (-365.901) (-368.205) (-366.044) [-365.310] * [-365.076] (-372.036) (-368.588) (-369.907) -- 0:00:37
383000 -- (-366.569) (-369.713) [-369.177] (-365.225) * (-366.878) [-366.493] (-369.232) (-367.468) -- 0:00:37
383500 -- [-365.054] (-365.295) (-366.571) (-369.146) * [-367.157] (-367.994) (-367.178) (-369.769) -- 0:00:36
384000 -- (-368.834) [-364.550] (-366.329) (-368.877) * (-366.532) [-365.882] (-366.858) (-367.995) -- 0:00:36
384500 -- (-366.405) (-368.289) [-365.971] (-366.022) * (-365.037) [-368.141] (-367.148) (-366.071) -- 0:00:36
385000 -- (-365.779) [-368.557] (-370.594) (-365.428) * (-366.932) (-367.073) [-366.021] (-364.655) -- 0:00:36
Average standard deviation of split frequencies: 0.014511
385500 -- [-366.619] (-367.250) (-366.160) (-367.336) * (-368.382) [-367.493] (-367.387) (-365.743) -- 0:00:36
386000 -- (-366.358) [-368.117] (-372.926) (-366.891) * [-364.657] (-370.109) (-367.415) (-368.765) -- 0:00:36
386500 -- (-366.820) (-368.310) (-369.770) [-370.853] * (-365.283) (-366.332) [-367.217] (-364.636) -- 0:00:36
387000 -- [-367.908] (-365.759) (-367.362) (-367.813) * (-368.631) [-365.977] (-368.517) (-370.787) -- 0:00:36
387500 -- (-365.665) [-365.700] (-368.937) (-368.223) * (-367.800) (-372.502) [-365.643] (-367.481) -- 0:00:36
388000 -- [-366.947] (-364.769) (-364.743) (-366.846) * (-366.407) (-370.816) (-368.353) [-367.773] -- 0:00:36
388500 -- (-367.694) [-366.030] (-364.979) (-366.048) * (-367.389) (-369.424) [-371.956] (-366.299) -- 0:00:36
389000 -- (-371.733) (-367.652) (-372.696) [-367.124] * [-366.228] (-372.461) (-367.296) (-366.541) -- 0:00:36
389500 -- [-365.120] (-366.720) (-367.625) (-366.752) * (-366.040) [-366.840] (-367.524) (-366.779) -- 0:00:36
390000 -- [-368.200] (-365.375) (-365.388) (-373.731) * (-366.314) [-365.643] (-369.463) (-366.607) -- 0:00:35
Average standard deviation of split frequencies: 0.014551
390500 -- (-369.119) (-367.595) [-364.835] (-366.148) * (-370.885) (-365.181) (-369.958) [-366.177] -- 0:00:35
391000 -- (-366.076) (-365.452) [-366.842] (-365.172) * (-371.389) (-367.850) (-365.201) [-365.941] -- 0:00:35
391500 -- (-367.359) (-365.209) (-368.061) [-367.908] * [-369.861] (-366.136) (-367.030) (-365.223) -- 0:00:35
392000 -- [-368.319] (-365.064) (-365.493) (-367.244) * (-366.282) (-371.600) [-366.620] (-365.769) -- 0:00:37
392500 -- (-367.587) [-370.026] (-365.683) (-365.662) * (-366.546) (-367.194) (-367.436) [-365.755] -- 0:00:37
393000 -- [-365.879] (-366.794) (-366.569) (-366.723) * (-368.976) (-364.996) (-367.065) [-366.586] -- 0:00:37
393500 -- (-364.871) (-370.245) [-366.278] (-365.816) * (-365.812) [-364.676] (-366.311) (-365.908) -- 0:00:36
394000 -- (-365.434) (-371.832) [-368.163] (-368.952) * [-369.044] (-367.038) (-366.314) (-366.718) -- 0:00:36
394500 -- [-365.764] (-366.169) (-365.044) (-369.892) * (-366.519) (-365.090) [-368.833] (-365.697) -- 0:00:36
395000 -- [-367.509] (-369.991) (-365.321) (-366.685) * (-366.646) (-367.265) (-365.822) [-365.897] -- 0:00:36
Average standard deviation of split frequencies: 0.014775
395500 -- [-366.861] (-367.545) (-367.290) (-369.228) * (-369.285) (-366.397) [-365.811] (-368.238) -- 0:00:36
396000 -- [-367.692] (-366.624) (-365.704) (-367.668) * (-365.939) (-368.558) [-365.544] (-364.996) -- 0:00:36
396500 -- (-365.914) (-367.843) [-366.458] (-368.622) * [-366.974] (-368.353) (-365.339) (-365.537) -- 0:00:36
397000 -- (-366.920) (-370.241) (-366.139) [-365.872] * (-365.909) (-368.622) (-365.609) [-366.762] -- 0:00:36
397500 -- (-369.117) (-368.712) (-369.319) [-365.869] * [-366.660] (-365.438) (-367.743) (-365.373) -- 0:00:36
398000 -- (-370.231) (-364.797) (-369.329) [-365.833] * (-367.125) (-367.081) [-366.022] (-365.982) -- 0:00:36
398500 -- (-369.501) (-367.400) [-366.614] (-365.833) * (-367.045) (-367.481) [-368.242] (-364.652) -- 0:00:36
399000 -- [-365.492] (-368.834) (-366.027) (-365.991) * (-366.193) [-366.770] (-366.030) (-366.157) -- 0:00:36
399500 -- (-373.279) (-371.927) (-366.366) [-366.041] * (-365.763) (-366.556) (-367.004) [-365.499] -- 0:00:36
400000 -- (-368.587) [-365.390] (-371.664) (-366.327) * (-367.390) (-364.978) [-367.172] (-367.601) -- 0:00:36
Average standard deviation of split frequencies: 0.014465
400500 -- (-370.400) [-367.570] (-366.496) (-366.634) * (-368.445) [-366.379] (-370.527) (-367.276) -- 0:00:35
401000 -- (-367.238) [-367.748] (-367.043) (-368.439) * (-368.107) (-367.770) [-370.830] (-366.484) -- 0:00:35
401500 -- (-366.913) (-368.316) (-368.421) [-368.014] * (-370.376) (-367.252) [-369.898] (-367.674) -- 0:00:35
402000 -- (-365.519) (-365.363) [-366.782] (-365.779) * (-366.223) (-369.756) (-367.371) [-367.256] -- 0:00:35
402500 -- [-367.151] (-365.190) (-369.055) (-365.622) * (-367.507) [-367.127] (-366.447) (-365.616) -- 0:00:35
403000 -- (-368.543) (-368.988) (-368.494) [-365.726] * (-367.756) (-366.254) (-366.260) [-364.732] -- 0:00:35
403500 -- (-366.035) (-366.122) (-367.588) [-367.754] * [-368.725] (-365.380) (-365.908) (-365.180) -- 0:00:35
404000 -- [-365.997] (-367.345) (-367.959) (-366.364) * (-365.865) [-368.628] (-365.611) (-366.945) -- 0:00:35
404500 -- (-366.765) (-368.501) [-366.799] (-364.960) * [-366.685] (-366.998) (-366.751) (-366.849) -- 0:00:35
405000 -- [-365.976] (-367.682) (-369.148) (-368.266) * (-365.402) (-366.707) (-365.853) [-367.445] -- 0:00:35
Average standard deviation of split frequencies: 0.014070
405500 -- (-365.239) (-368.921) [-368.736] (-370.117) * (-368.328) (-366.364) [-368.037] (-365.989) -- 0:00:35
406000 -- (-370.158) (-368.769) (-367.697) [-366.929] * [-365.863] (-365.595) (-370.132) (-364.903) -- 0:00:35
406500 -- (-369.089) (-367.317) (-365.881) [-367.732] * [-365.589] (-366.908) (-367.919) (-364.637) -- 0:00:35
407000 -- [-365.655] (-369.556) (-369.465) (-366.184) * (-365.798) (-366.699) (-365.237) [-369.163] -- 0:00:34
407500 -- (-369.131) [-370.213] (-366.960) (-368.672) * [-365.299] (-368.605) (-366.124) (-367.501) -- 0:00:34
408000 -- (-365.846) (-365.249) (-367.012) [-368.754] * (-365.011) (-364.541) [-366.576] (-365.399) -- 0:00:34
408500 -- (-366.778) (-365.351) (-365.567) [-365.793] * (-365.181) (-372.003) [-369.437] (-364.741) -- 0:00:34
409000 -- (-369.089) [-366.998] (-364.690) (-368.176) * [-367.324] (-369.856) (-366.151) (-366.453) -- 0:00:36
409500 -- [-366.220] (-365.462) (-364.605) (-365.970) * (-366.640) (-365.157) [-367.329] (-365.861) -- 0:00:36
410000 -- (-368.043) (-365.741) (-369.764) [-369.645] * (-369.330) (-368.482) [-367.261] (-366.207) -- 0:00:35
Average standard deviation of split frequencies: 0.014788
410500 -- (-368.860) [-365.401] (-368.882) (-367.702) * (-370.383) [-366.567] (-365.775) (-366.106) -- 0:00:35
411000 -- (-368.533) (-366.319) [-365.806] (-369.363) * (-368.658) [-364.790] (-366.896) (-365.532) -- 0:00:35
411500 -- (-366.017) [-365.749] (-368.272) (-365.164) * (-365.369) [-365.486] (-366.846) (-369.846) -- 0:00:35
412000 -- (-365.940) (-364.436) [-369.989] (-365.495) * [-365.489] (-367.134) (-365.420) (-367.866) -- 0:00:35
412500 -- (-364.944) [-365.316] (-365.153) (-368.068) * [-367.697] (-375.612) (-369.409) (-367.395) -- 0:00:35
413000 -- (-364.439) [-364.883] (-366.946) (-365.183) * (-368.907) (-369.860) [-366.655] (-367.086) -- 0:00:35
413500 -- (-365.371) (-366.303) (-365.954) [-365.251] * (-365.755) (-367.576) (-365.078) [-365.804] -- 0:00:35
414000 -- (-371.668) (-365.565) [-368.308] (-368.959) * (-368.377) (-365.677) (-364.807) [-366.341] -- 0:00:35
414500 -- (-367.826) (-367.235) (-365.498) [-371.990] * [-367.263] (-366.651) (-365.652) (-366.774) -- 0:00:35
415000 -- (-368.014) [-367.800] (-365.549) (-365.159) * [-368.307] (-365.983) (-367.149) (-369.637) -- 0:00:35
Average standard deviation of split frequencies: 0.015265
415500 -- [-367.733] (-368.989) (-365.725) (-368.948) * (-369.388) [-366.738] (-367.612) (-369.280) -- 0:00:35
416000 -- [-365.657] (-366.557) (-367.276) (-366.717) * (-367.113) (-368.308) (-368.311) [-366.146] -- 0:00:35
416500 -- (-365.568) (-366.749) (-368.505) [-366.997] * (-368.372) (-368.513) [-365.769] (-370.751) -- 0:00:35
417000 -- (-366.606) [-366.179] (-366.937) (-366.075) * (-367.089) (-367.226) [-366.783] (-367.710) -- 0:00:34
417500 -- (-367.919) (-365.830) [-365.251] (-366.387) * [-366.317] (-367.323) (-365.713) (-367.598) -- 0:00:34
418000 -- (-366.585) (-365.170) [-370.870] (-368.206) * (-366.201) [-367.480] (-369.749) (-366.568) -- 0:00:34
418500 -- [-365.575] (-366.628) (-367.546) (-366.323) * (-369.475) (-366.962) [-368.013] (-366.175) -- 0:00:34
419000 -- (-369.244) [-366.708] (-365.244) (-365.408) * (-365.560) (-370.077) [-366.168] (-367.604) -- 0:00:34
419500 -- (-366.410) [-367.036] (-366.249) (-367.070) * (-365.267) (-366.139) [-366.289] (-367.894) -- 0:00:34
420000 -- (-368.044) [-366.472] (-367.153) (-368.824) * (-365.363) (-368.520) [-367.480] (-367.185) -- 0:00:34
Average standard deviation of split frequencies: 0.015359
420500 -- [-365.790] (-367.508) (-367.683) (-371.106) * (-365.955) (-365.662) [-364.569] (-368.234) -- 0:00:34
421000 -- (-367.127) [-366.491] (-366.873) (-365.701) * (-366.475) [-366.249] (-368.844) (-364.797) -- 0:00:34
421500 -- (-366.375) [-364.740] (-366.847) (-368.947) * [-367.164] (-365.014) (-366.439) (-365.932) -- 0:00:34
422000 -- (-367.542) (-365.567) (-368.397) [-367.482] * (-365.731) [-364.925] (-367.330) (-366.973) -- 0:00:34
422500 -- (-367.463) (-369.371) [-368.182] (-369.737) * (-368.181) (-365.759) (-365.493) [-369.738] -- 0:00:34
423000 -- (-368.403) [-365.441] (-364.535) (-367.057) * (-369.722) [-366.324] (-365.687) (-365.062) -- 0:00:34
423500 -- (-365.858) (-365.012) (-370.718) [-364.913] * (-365.376) (-368.389) (-366.622) [-367.025] -- 0:00:34
424000 -- (-372.595) (-364.747) [-366.993] (-365.945) * (-365.376) (-367.021) [-365.540] (-365.341) -- 0:00:33
424500 -- (-366.632) (-365.123) (-369.192) [-367.939] * (-365.913) (-366.046) (-367.554) [-364.818] -- 0:00:33
425000 -- (-368.564) (-369.574) (-369.984) [-366.244] * (-365.335) (-367.279) [-367.613] (-366.863) -- 0:00:33
Average standard deviation of split frequencies: 0.014509
425500 -- [-368.323] (-365.974) (-366.120) (-364.792) * (-367.576) (-365.959) (-370.119) [-366.387] -- 0:00:33
426000 -- (-366.579) (-370.440) (-365.304) [-366.883] * (-366.089) (-365.421) [-369.966] (-364.908) -- 0:00:35
426500 -- (-365.934) (-371.533) [-365.123] (-367.614) * (-371.902) [-366.077] (-366.185) (-365.846) -- 0:00:34
427000 -- (-365.849) (-364.558) (-365.991) [-366.194] * (-369.346) (-368.583) (-366.141) [-367.418] -- 0:00:34
427500 -- [-365.729] (-367.436) (-368.724) (-367.928) * (-369.999) [-365.280] (-365.732) (-366.089) -- 0:00:34
428000 -- (-368.578) (-366.189) [-366.321] (-367.497) * (-367.816) [-366.336] (-365.045) (-365.001) -- 0:00:34
428500 -- (-366.343) (-366.167) (-366.830) [-366.233] * (-366.715) (-367.302) [-364.597] (-365.661) -- 0:00:34
429000 -- (-368.692) (-365.870) (-369.730) [-367.177] * [-367.274] (-365.449) (-366.050) (-366.301) -- 0:00:34
429500 -- (-366.961) (-367.891) [-366.310] (-370.783) * (-366.762) (-367.419) (-372.312) [-364.437] -- 0:00:34
430000 -- (-373.752) (-364.845) [-366.876] (-369.441) * (-368.004) [-370.480] (-367.170) (-364.911) -- 0:00:34
Average standard deviation of split frequencies: 0.013682
430500 -- (-370.375) (-364.663) (-367.505) [-366.221] * (-369.894) [-365.279] (-368.130) (-366.253) -- 0:00:34
431000 -- (-365.329) (-365.301) [-367.360] (-367.380) * [-365.988] (-365.059) (-370.575) (-366.040) -- 0:00:34
431500 -- [-366.034] (-366.059) (-368.907) (-365.534) * [-368.054] (-366.749) (-368.453) (-367.812) -- 0:00:34
432000 -- (-366.959) (-367.158) [-365.278] (-366.598) * (-367.638) (-366.556) (-364.982) [-365.899] -- 0:00:34
432500 -- (-367.208) (-366.703) (-365.502) [-365.770] * (-365.432) [-366.935] (-373.569) (-366.361) -- 0:00:34
433000 -- (-368.882) [-367.050] (-366.126) (-365.337) * (-368.674) [-365.860] (-368.199) (-368.286) -- 0:00:34
433500 -- (-367.121) (-367.483) (-364.833) [-365.887] * (-366.183) (-369.513) [-368.723] (-365.532) -- 0:00:33
434000 -- (-366.089) (-367.489) (-365.113) [-367.742] * (-365.402) [-368.688] (-366.084) (-364.937) -- 0:00:33
434500 -- (-370.657) (-367.863) [-366.131] (-367.886) * (-366.625) (-366.992) [-364.780] (-366.593) -- 0:00:33
435000 -- (-370.101) (-366.679) (-364.743) [-364.865] * [-364.711] (-368.113) (-367.643) (-365.012) -- 0:00:33
Average standard deviation of split frequencies: 0.012974
435500 -- (-369.699) (-373.436) [-368.307] (-371.586) * (-364.645) [-365.620] (-366.735) (-365.289) -- 0:00:33
436000 -- (-364.872) (-367.548) (-365.829) [-366.608] * (-367.555) [-365.554] (-367.904) (-368.579) -- 0:00:33
436500 -- [-364.855] (-366.089) (-365.992) (-365.652) * (-365.689) [-366.506] (-367.950) (-365.826) -- 0:00:33
437000 -- [-365.478] (-367.520) (-366.524) (-366.824) * [-367.057] (-365.808) (-366.675) (-365.954) -- 0:00:33
437500 -- (-368.400) [-365.717] (-367.545) (-367.416) * (-365.735) (-367.100) (-365.584) [-365.862] -- 0:00:33
438000 -- (-366.272) [-366.563] (-364.717) (-367.362) * (-365.773) (-365.958) (-366.946) [-366.979] -- 0:00:33
438500 -- [-367.660] (-365.431) (-366.452) (-365.217) * (-367.371) (-366.249) (-368.985) [-365.772] -- 0:00:33
439000 -- [-364.781] (-366.185) (-367.805) (-367.367) * (-368.690) (-365.808) [-365.475] (-366.135) -- 0:00:33
439500 -- [-367.140] (-366.102) (-365.711) (-365.257) * [-365.121] (-366.059) (-368.570) (-364.944) -- 0:00:33
440000 -- [-367.446] (-367.777) (-367.290) (-367.034) * (-364.458) (-365.685) (-368.294) [-366.413] -- 0:00:33
Average standard deviation of split frequencies: 0.013655
440500 -- (-367.768) (-369.042) [-366.687] (-365.111) * (-369.843) (-364.322) (-366.083) [-366.266] -- 0:00:33
441000 -- (-366.477) (-367.334) [-366.266] (-366.953) * (-367.848) (-366.819) (-366.361) [-366.243] -- 0:00:32
441500 -- (-365.697) (-366.461) [-367.184] (-365.585) * (-367.670) [-367.842] (-368.752) (-370.023) -- 0:00:32
442000 -- (-369.792) [-367.445] (-365.261) (-365.181) * (-365.872) (-371.443) (-366.676) [-367.428] -- 0:00:32
442500 -- [-367.458] (-368.650) (-367.465) (-365.567) * (-366.775) (-365.844) (-366.094) [-366.845] -- 0:00:32
443000 -- (-365.990) (-366.794) (-366.338) [-365.635] * (-364.856) [-365.749] (-367.749) (-367.306) -- 0:00:32
443500 -- (-367.122) (-369.791) [-365.795] (-370.025) * (-367.498) (-366.600) (-365.180) [-367.214] -- 0:00:33
444000 -- (-370.454) (-368.940) (-368.669) [-366.820] * (-368.716) (-368.715) [-365.870] (-365.164) -- 0:00:33
444500 -- (-366.410) (-367.391) (-365.354) [-365.772] * (-366.891) (-365.608) (-366.992) [-365.311] -- 0:00:33
445000 -- (-365.528) (-368.418) (-365.143) [-366.027] * (-365.237) (-365.640) [-367.145] (-366.978) -- 0:00:33
Average standard deviation of split frequencies: 0.013506
445500 -- [-365.099] (-365.290) (-364.711) (-367.525) * (-365.202) (-367.725) (-367.085) [-366.811] -- 0:00:33
446000 -- (-366.041) [-369.359] (-366.774) (-368.757) * [-366.788] (-368.101) (-366.356) (-366.588) -- 0:00:33
446500 -- (-366.689) [-366.632] (-365.604) (-366.035) * (-366.289) (-366.676) [-367.431] (-369.151) -- 0:00:33
447000 -- [-370.630] (-367.862) (-365.646) (-366.425) * (-364.893) (-364.619) (-367.770) [-365.262] -- 0:00:33
447500 -- (-370.158) (-365.730) [-365.855] (-366.552) * [-367.866] (-368.627) (-366.539) (-365.951) -- 0:00:33
448000 -- [-365.900] (-365.172) (-365.045) (-367.927) * (-367.127) (-366.940) (-365.946) [-366.741] -- 0:00:33
448500 -- (-365.380) (-367.810) (-365.256) [-369.798] * [-365.694] (-368.346) (-368.823) (-366.110) -- 0:00:33
449000 -- (-367.363) (-369.814) [-369.225] (-366.587) * (-366.123) (-370.799) [-366.481] (-369.399) -- 0:00:33
449500 -- [-365.532] (-366.530) (-366.401) (-366.807) * (-365.902) (-368.890) [-366.515] (-367.382) -- 0:00:33
450000 -- (-365.853) (-366.632) (-365.738) [-365.244] * (-368.727) [-368.243] (-366.339) (-370.243) -- 0:00:33
Average standard deviation of split frequencies: 0.015383
450500 -- [-366.870] (-366.546) (-367.819) (-372.605) * (-367.445) (-367.310) [-368.298] (-370.744) -- 0:00:32
451000 -- (-367.390) (-367.343) [-367.902] (-369.419) * [-367.236] (-368.187) (-369.163) (-366.083) -- 0:00:32
451500 -- (-368.470) (-366.797) [-367.715] (-365.764) * (-367.108) (-365.178) [-369.132] (-364.767) -- 0:00:32
452000 -- (-365.250) (-367.868) (-365.318) [-368.192] * (-366.494) (-367.975) [-367.295] (-366.395) -- 0:00:32
452500 -- (-366.010) [-367.010] (-368.599) (-365.063) * (-366.209) [-365.313] (-369.134) (-367.614) -- 0:00:32
453000 -- (-366.423) (-365.743) (-367.498) [-365.248] * (-366.808) [-364.970] (-364.693) (-370.392) -- 0:00:32
453500 -- [-372.237] (-366.434) (-365.049) (-367.667) * (-365.801) (-367.870) [-365.853] (-368.618) -- 0:00:32
454000 -- (-366.729) (-370.058) [-365.845] (-370.386) * (-365.419) (-367.285) [-367.404] (-364.739) -- 0:00:32
454500 -- [-367.558] (-370.023) (-365.827) (-368.436) * (-366.236) (-367.556) [-366.442] (-366.393) -- 0:00:32
455000 -- (-364.890) [-368.325] (-366.321) (-365.228) * (-376.042) [-368.329] (-366.878) (-367.336) -- 0:00:32
Average standard deviation of split frequencies: 0.015263
455500 -- (-366.927) [-365.880] (-366.734) (-366.081) * (-368.741) (-367.062) [-367.861] (-365.968) -- 0:00:32
456000 -- (-368.318) [-365.895] (-367.383) (-368.307) * (-367.316) [-365.942] (-373.549) (-367.404) -- 0:00:32
456500 -- (-368.587) [-368.603] (-367.020) (-367.502) * (-369.445) (-366.744) (-370.828) [-365.681] -- 0:00:32
457000 -- [-364.657] (-364.602) (-368.726) (-365.846) * (-366.303) [-367.393] (-367.851) (-365.871) -- 0:00:32
457500 -- (-368.522) (-367.488) (-366.224) [-366.308] * (-366.153) (-365.182) [-365.240] (-368.408) -- 0:00:32
458000 -- (-365.831) [-365.990] (-365.411) (-366.999) * (-366.801) (-370.464) [-365.888] (-366.820) -- 0:00:31
458500 -- (-365.058) (-368.677) (-367.720) [-365.844] * (-367.708) [-365.594] (-370.423) (-368.113) -- 0:00:31
459000 -- [-366.381] (-367.155) (-373.997) (-369.172) * (-369.774) (-365.704) (-366.791) [-366.366] -- 0:00:31
459500 -- (-368.914) (-369.110) [-364.853] (-366.324) * [-366.829] (-364.624) (-367.171) (-367.300) -- 0:00:31
460000 -- [-365.982] (-367.447) (-367.442) (-365.452) * (-365.944) (-365.221) [-365.335] (-365.993) -- 0:00:31
Average standard deviation of split frequencies: 0.015222
460500 -- (-366.896) [-368.870] (-364.864) (-372.752) * (-367.470) (-367.231) [-365.396] (-367.918) -- 0:00:32
461000 -- [-365.780] (-367.101) (-367.276) (-369.070) * (-365.930) (-364.954) [-365.757] (-366.478) -- 0:00:32
461500 -- [-366.134] (-368.236) (-367.912) (-368.903) * [-365.742] (-364.437) (-367.659) (-366.279) -- 0:00:32
462000 -- (-370.815) [-369.624] (-365.397) (-367.053) * (-367.788) (-364.814) [-367.412] (-365.931) -- 0:00:32
462500 -- (-367.099) (-367.536) [-364.751] (-368.354) * [-365.594] (-367.335) (-365.540) (-365.916) -- 0:00:32
463000 -- [-368.690] (-370.302) (-368.637) (-366.488) * (-365.965) (-366.468) (-367.624) [-367.173] -- 0:00:32
463500 -- (-364.890) [-365.121] (-368.981) (-364.682) * (-368.105) [-365.107] (-365.541) (-370.211) -- 0:00:32
464000 -- (-366.206) (-367.624) (-372.766) [-366.795] * (-369.209) [-367.292] (-368.489) (-366.543) -- 0:00:32
464500 -- (-367.788) (-364.531) [-365.576] (-367.355) * (-372.132) (-366.992) [-368.297] (-366.083) -- 0:00:32
465000 -- (-369.556) [-365.555] (-365.533) (-366.387) * (-366.428) (-365.796) [-367.537] (-367.019) -- 0:00:32
Average standard deviation of split frequencies: 0.015230
465500 -- (-367.462) (-368.726) (-365.641) [-365.503] * [-365.759] (-367.187) (-367.400) (-366.365) -- 0:00:32
466000 -- (-365.957) (-366.364) [-366.617] (-366.660) * (-367.577) [-365.025] (-366.769) (-367.516) -- 0:00:32
466500 -- (-371.371) [-366.925] (-367.870) (-366.014) * (-371.958) (-366.521) [-365.658] (-366.198) -- 0:00:32
467000 -- (-366.372) (-366.702) (-365.271) [-365.945] * (-376.390) (-367.098) [-366.481] (-368.913) -- 0:00:31
467500 -- (-365.207) [-366.344] (-365.067) (-367.051) * (-371.992) (-366.173) (-367.472) [-365.019] -- 0:00:31
468000 -- [-367.173] (-365.862) (-367.513) (-366.614) * (-367.374) [-367.624] (-364.647) (-365.493) -- 0:00:31
468500 -- (-374.073) (-365.285) (-365.094) [-365.043] * [-366.715] (-367.787) (-366.045) (-365.728) -- 0:00:31
469000 -- (-367.108) [-365.457] (-365.767) (-367.893) * (-367.124) (-365.614) [-366.719] (-370.073) -- 0:00:31
469500 -- (-365.729) [-364.509] (-366.530) (-365.802) * [-364.880] (-370.553) (-369.724) (-370.060) -- 0:00:31
470000 -- (-364.945) (-365.496) (-365.818) [-365.940] * (-366.109) (-365.839) [-365.843] (-367.902) -- 0:00:31
Average standard deviation of split frequencies: 0.014912
470500 -- (-367.046) [-369.200] (-367.548) (-365.412) * [-366.959] (-366.023) (-367.167) (-367.290) -- 0:00:31
471000 -- (-369.133) (-367.153) [-366.302] (-367.649) * [-366.606] (-371.859) (-367.032) (-369.365) -- 0:00:31
471500 -- (-366.899) (-368.213) [-365.124] (-368.096) * (-368.287) (-367.156) (-364.687) [-367.741] -- 0:00:31
472000 -- (-368.543) (-366.856) (-366.775) [-365.422] * (-366.946) (-365.987) [-365.074] (-373.180) -- 0:00:31
472500 -- (-367.587) (-366.678) [-364.763] (-366.094) * (-366.667) [-365.415] (-366.552) (-370.292) -- 0:00:31
473000 -- (-367.735) (-365.456) [-364.983] (-367.892) * (-367.211) (-369.613) [-368.243] (-369.085) -- 0:00:31
473500 -- [-365.057] (-367.135) (-367.478) (-365.247) * (-369.807) (-366.643) [-369.181] (-369.231) -- 0:00:31
474000 -- (-364.805) (-366.628) (-366.924) [-366.401] * [-367.478] (-365.295) (-366.925) (-365.724) -- 0:00:31
474500 -- (-367.955) [-367.643] (-369.748) (-366.128) * (-364.551) [-369.010] (-365.501) (-365.254) -- 0:00:31
475000 -- (-373.347) [-367.957] (-368.628) (-366.308) * (-368.635) [-364.515] (-366.243) (-365.836) -- 0:00:30
Average standard deviation of split frequencies: 0.014910
475500 -- (-366.513) (-369.913) (-365.645) [-365.603] * (-366.859) (-366.274) (-365.234) [-366.300] -- 0:00:30
476000 -- (-368.610) (-367.154) [-365.016] (-365.585) * (-369.353) (-367.125) (-367.167) [-366.513] -- 0:00:30
476500 -- (-366.832) (-367.707) [-365.928] (-368.481) * (-365.937) (-365.053) (-366.566) [-365.729] -- 0:00:30
477000 -- (-368.539) (-365.820) (-371.148) [-366.748] * (-367.291) [-364.749] (-366.208) (-366.017) -- 0:00:30
477500 -- (-370.104) [-365.097] (-367.289) (-365.939) * (-364.481) (-370.065) (-365.689) [-367.946] -- 0:00:30
478000 -- (-367.708) [-365.299] (-368.682) (-366.264) * (-368.951) [-366.687] (-366.336) (-365.670) -- 0:00:31
478500 -- (-367.168) (-365.894) [-367.250] (-365.908) * [-365.796] (-367.251) (-365.353) (-367.387) -- 0:00:31
479000 -- (-366.234) (-368.126) [-364.781] (-365.528) * (-366.735) (-370.304) (-365.199) [-367.905] -- 0:00:31
479500 -- (-367.481) (-367.164) (-367.211) [-365.267] * (-364.789) (-372.297) [-365.060] (-366.742) -- 0:00:31
480000 -- (-368.922) (-366.199) [-367.085] (-366.749) * [-366.823] (-372.708) (-366.166) (-365.147) -- 0:00:31
Average standard deviation of split frequencies: 0.014076
480500 -- [-365.823] (-365.094) (-365.423) (-366.364) * (-364.696) (-367.565) [-367.276] (-371.270) -- 0:00:31
481000 -- (-366.122) [-364.539] (-366.789) (-370.097) * (-368.501) (-365.785) (-365.717) [-365.807] -- 0:00:31
481500 -- [-366.751] (-365.251) (-366.962) (-364.682) * (-364.787) [-367.517] (-365.662) (-366.173) -- 0:00:31
482000 -- [-366.896] (-365.842) (-371.518) (-365.842) * [-366.651] (-367.184) (-365.182) (-364.717) -- 0:00:31
482500 -- [-367.788] (-366.664) (-367.872) (-366.865) * (-369.254) (-367.374) (-365.222) [-365.362] -- 0:00:31
483000 -- (-370.593) (-368.026) [-367.403] (-367.738) * [-368.928] (-366.504) (-365.133) (-364.885) -- 0:00:31
483500 -- [-372.596] (-364.847) (-367.607) (-365.828) * (-370.574) [-365.373] (-365.710) (-365.004) -- 0:00:30
484000 -- (-366.267) [-365.916] (-366.181) (-371.258) * (-366.497) (-365.559) (-367.162) [-366.031] -- 0:00:30
484500 -- (-368.238) [-368.387] (-368.009) (-366.526) * (-368.518) [-372.269] (-365.596) (-369.755) -- 0:00:30
485000 -- (-373.441) (-367.583) (-365.939) [-365.404] * (-370.046) [-367.177] (-369.109) (-368.497) -- 0:00:30
Average standard deviation of split frequencies: 0.013222
485500 -- (-366.508) [-369.268] (-366.303) (-365.739) * (-366.481) [-367.351] (-368.778) (-365.461) -- 0:00:30
486000 -- (-365.531) [-364.458] (-366.027) (-366.854) * [-369.969] (-369.923) (-367.536) (-368.793) -- 0:00:30
486500 -- [-367.462] (-365.561) (-368.864) (-365.270) * (-367.430) (-368.742) [-366.509] (-367.534) -- 0:00:30
487000 -- (-366.700) (-370.357) (-369.386) [-368.659] * (-368.653) (-365.773) (-369.025) [-368.051] -- 0:00:30
487500 -- [-365.441] (-371.502) (-367.938) (-367.680) * (-367.150) (-369.477) [-366.672] (-368.857) -- 0:00:30
488000 -- (-367.139) (-370.898) [-368.883] (-367.208) * [-367.278] (-365.682) (-369.808) (-369.511) -- 0:00:30
488500 -- (-368.342) [-367.870] (-369.265) (-365.519) * [-366.414] (-367.633) (-369.000) (-365.714) -- 0:00:30
489000 -- [-367.576] (-368.067) (-367.583) (-366.985) * (-365.162) (-365.574) (-369.019) [-368.627] -- 0:00:30
489500 -- (-371.376) (-366.736) [-367.657] (-365.487) * [-367.895] (-366.284) (-365.450) (-368.848) -- 0:00:30
490000 -- (-367.655) (-369.092) [-367.819] (-365.567) * (-367.017) (-366.077) [-367.579] (-370.930) -- 0:00:30
Average standard deviation of split frequencies: 0.013400
490500 -- (-365.753) (-372.903) [-366.579] (-365.276) * (-368.282) (-366.871) (-372.842) [-368.932] -- 0:00:30
491000 -- [-367.263] (-366.394) (-368.258) (-367.245) * (-368.785) (-369.485) [-365.902] (-368.100) -- 0:00:30
491500 -- (-367.683) [-367.903] (-365.893) (-365.021) * (-366.526) [-365.622] (-368.049) (-368.256) -- 0:00:30
492000 -- (-365.798) (-371.487) [-366.192] (-366.537) * (-367.315) (-367.056) (-366.127) [-366.760] -- 0:00:29
492500 -- (-367.431) (-368.766) (-369.911) [-369.032] * (-368.649) [-366.670] (-365.255) (-367.051) -- 0:00:29
493000 -- [-366.770] (-365.305) (-365.093) (-368.521) * (-365.854) [-366.122] (-364.949) (-365.784) -- 0:00:29
493500 -- [-366.580] (-365.388) (-369.993) (-367.306) * [-369.620] (-370.211) (-370.532) (-368.972) -- 0:00:29
494000 -- [-365.570] (-365.775) (-369.589) (-366.925) * (-372.751) (-365.119) (-368.545) [-365.262] -- 0:00:29
494500 -- (-365.006) (-365.231) (-367.021) [-365.256] * [-369.833] (-365.735) (-368.719) (-366.506) -- 0:00:29
495000 -- (-365.135) (-365.732) (-366.710) [-364.984] * (-369.247) (-367.742) (-365.695) [-367.514] -- 0:00:30
Average standard deviation of split frequencies: 0.012672
495500 -- (-373.143) (-368.269) [-370.760] (-366.518) * (-366.958) (-369.833) (-365.739) [-366.937] -- 0:00:30
496000 -- [-366.666] (-369.083) (-371.340) (-367.455) * (-365.666) [-365.041] (-368.268) (-366.382) -- 0:00:30
496500 -- (-365.439) (-366.304) [-373.355] (-367.943) * (-370.617) (-366.839) [-364.546] (-367.178) -- 0:00:30
497000 -- (-365.625) [-366.536] (-366.308) (-366.814) * (-371.121) [-373.433] (-366.913) (-367.562) -- 0:00:30
497500 -- (-366.387) [-365.835] (-366.645) (-366.219) * [-367.187] (-366.592) (-366.833) (-367.424) -- 0:00:30
498000 -- [-365.349] (-366.825) (-365.232) (-367.005) * (-367.054) (-365.952) [-368.770] (-365.344) -- 0:00:30
498500 -- (-367.594) (-365.240) [-369.588] (-368.364) * (-369.680) (-365.357) (-369.827) [-365.872] -- 0:00:30
499000 -- (-364.566) [-365.087] (-366.561) (-366.537) * (-366.292) [-365.509] (-366.537) (-369.131) -- 0:00:30
499500 -- (-366.051) [-364.955] (-367.091) (-365.323) * [-366.158] (-368.103) (-365.585) (-369.538) -- 0:00:30
500000 -- (-366.027) (-366.768) [-368.617] (-366.779) * [-367.845] (-368.402) (-367.264) (-367.967) -- 0:00:30
Average standard deviation of split frequencies: 0.013132
500500 -- [-365.077] (-366.600) (-365.903) (-365.948) * (-367.557) (-368.906) (-367.782) [-367.869] -- 0:00:29
501000 -- [-368.340] (-367.729) (-365.763) (-367.975) * (-367.235) (-368.257) [-364.866] (-365.998) -- 0:00:29
501500 -- (-367.641) (-367.599) (-366.435) [-366.514] * (-371.450) (-368.049) (-366.814) [-364.696] -- 0:00:29
502000 -- (-370.359) (-365.542) (-372.283) [-365.958] * (-369.387) (-369.251) [-366.527] (-366.286) -- 0:00:29
502500 -- [-365.209] (-365.648) (-370.511) (-366.567) * (-369.662) [-365.297] (-366.755) (-368.648) -- 0:00:29
503000 -- [-369.226] (-364.954) (-367.526) (-365.378) * (-365.649) (-365.156) (-368.425) [-366.509] -- 0:00:29
503500 -- (-366.111) [-365.441] (-366.583) (-366.330) * (-364.824) (-365.088) [-370.486] (-367.289) -- 0:00:29
504000 -- (-367.850) (-365.701) [-370.293] (-365.202) * (-365.326) (-365.923) [-366.266] (-367.885) -- 0:00:29
504500 -- [-366.909] (-366.211) (-365.021) (-365.536) * (-365.719) [-371.367] (-368.497) (-367.169) -- 0:00:29
505000 -- (-367.682) [-365.249] (-365.319) (-366.918) * (-366.396) [-365.406] (-366.266) (-366.271) -- 0:00:29
Average standard deviation of split frequencies: 0.013386
505500 -- (-368.040) (-366.375) [-364.984] (-366.932) * (-365.005) (-364.704) (-366.251) [-368.898] -- 0:00:29
506000 -- (-365.817) [-365.192] (-365.870) (-365.256) * [-370.126] (-366.106) (-368.368) (-373.753) -- 0:00:29
506500 -- [-365.495] (-366.037) (-364.921) (-368.078) * (-366.097) (-368.999) (-365.332) [-368.302] -- 0:00:29
507000 -- (-365.362) (-365.538) (-373.006) [-367.037] * (-366.704) [-366.915] (-366.914) (-369.591) -- 0:00:29
507500 -- (-366.577) (-367.436) [-365.992] (-365.148) * (-367.374) (-365.643) (-367.982) [-365.405] -- 0:00:29
508000 -- [-369.878] (-367.626) (-369.694) (-367.469) * [-369.309] (-365.816) (-365.999) (-365.072) -- 0:00:29
508500 -- [-367.388] (-368.318) (-368.134) (-369.598) * [-372.798] (-365.561) (-365.297) (-367.878) -- 0:00:28
509000 -- [-366.269] (-371.869) (-368.831) (-366.718) * (-368.747) (-365.950) (-365.812) [-365.312] -- 0:00:28
509500 -- (-367.510) [-366.974] (-366.115) (-370.753) * (-365.159) (-364.849) (-367.024) [-364.980] -- 0:00:28
510000 -- (-365.220) (-364.799) [-365.598] (-369.760) * (-367.151) [-364.498] (-365.854) (-367.049) -- 0:00:28
Average standard deviation of split frequencies: 0.013458
510500 -- [-367.085] (-365.872) (-365.972) (-367.265) * (-364.959) (-370.070) [-366.811] (-369.112) -- 0:00:28
511000 -- (-365.840) (-370.409) (-367.843) [-364.786] * [-368.914] (-365.791) (-366.733) (-366.026) -- 0:00:28
511500 -- [-366.539] (-369.725) (-367.973) (-365.419) * (-366.747) (-366.124) [-365.843] (-366.782) -- 0:00:28
512000 -- (-366.694) (-367.537) [-366.510] (-365.837) * (-369.283) (-365.171) [-366.608] (-366.100) -- 0:00:29
512500 -- (-366.393) (-365.046) [-371.659] (-366.856) * [-366.031] (-371.932) (-369.565) (-365.421) -- 0:00:29
513000 -- [-369.263] (-369.619) (-365.466) (-373.377) * [-367.644] (-366.106) (-366.936) (-365.838) -- 0:00:29
513500 -- (-370.273) (-369.482) (-364.882) [-370.688] * (-372.332) [-365.047] (-365.491) (-365.660) -- 0:00:29
514000 -- [-367.015] (-365.331) (-365.484) (-368.246) * (-367.561) (-365.455) (-370.930) [-369.227] -- 0:00:29
514500 -- (-365.550) (-369.959) (-370.625) [-364.813] * (-365.400) (-368.116) (-369.920) [-367.065] -- 0:00:29
515000 -- (-367.265) (-368.018) (-367.981) [-366.255] * (-366.157) [-367.101] (-368.829) (-365.291) -- 0:00:29
Average standard deviation of split frequencies: 0.013319
515500 -- (-367.924) (-367.808) (-366.578) [-365.227] * (-367.450) (-368.334) [-366.184] (-367.173) -- 0:00:29
516000 -- (-367.205) (-365.261) [-366.133] (-366.628) * [-367.225] (-367.490) (-367.094) (-365.474) -- 0:00:29
516500 -- (-365.874) [-364.721] (-368.466) (-366.288) * (-366.290) [-365.800] (-366.204) (-366.985) -- 0:00:29
517000 -- (-373.654) [-366.425] (-367.180) (-364.370) * (-367.741) [-366.637] (-366.128) (-365.746) -- 0:00:28
517500 -- [-365.182] (-366.293) (-366.208) (-372.838) * (-366.328) (-369.170) (-365.709) [-367.829] -- 0:00:28
518000 -- [-365.373] (-367.796) (-366.802) (-366.172) * [-366.214] (-366.333) (-365.337) (-369.660) -- 0:00:28
518500 -- [-366.486] (-365.618) (-365.035) (-367.806) * (-369.246) (-365.318) [-365.570] (-367.930) -- 0:00:28
519000 -- [-366.185] (-365.248) (-367.052) (-365.626) * (-365.203) (-368.450) [-368.827] (-367.210) -- 0:00:28
519500 -- (-366.957) (-367.599) [-367.476] (-366.401) * (-366.414) (-371.919) [-365.901] (-366.845) -- 0:00:28
520000 -- [-371.648] (-369.987) (-366.993) (-365.947) * (-369.940) (-366.937) (-367.723) [-366.386] -- 0:00:28
Average standard deviation of split frequencies: 0.013247
520500 -- (-366.461) (-373.983) (-367.931) [-365.743] * (-367.606) [-366.682] (-366.679) (-365.736) -- 0:00:28
521000 -- (-367.897) [-365.652] (-368.247) (-371.500) * [-366.223] (-365.399) (-365.583) (-370.662) -- 0:00:28
521500 -- (-367.659) (-367.032) (-369.386) [-368.431] * (-367.901) (-367.114) (-366.898) [-365.664] -- 0:00:28
522000 -- [-369.858] (-366.052) (-366.283) (-365.700) * [-365.762] (-368.170) (-368.112) (-366.562) -- 0:00:28
522500 -- [-367.710] (-369.701) (-369.532) (-369.882) * (-368.865) (-368.118) (-366.778) [-366.605] -- 0:00:28
523000 -- (-368.613) (-370.698) [-364.914] (-366.259) * (-366.244) (-370.146) (-368.149) [-366.906] -- 0:00:28
523500 -- (-367.511) (-367.079) [-365.727] (-367.293) * (-368.005) (-367.138) [-367.189] (-367.776) -- 0:00:28
524000 -- (-365.241) (-366.068) [-365.838] (-366.134) * (-371.288) [-365.417] (-369.913) (-366.044) -- 0:00:28
524500 -- [-365.743] (-367.337) (-371.565) (-365.572) * (-371.297) [-367.392] (-369.871) (-369.492) -- 0:00:28
525000 -- (-366.683) (-367.510) [-367.124] (-364.992) * (-368.928) [-366.634] (-367.860) (-368.033) -- 0:00:28
Average standard deviation of split frequencies: 0.014056
525500 -- (-368.009) (-369.102) [-366.068] (-369.651) * (-369.125) (-370.254) (-367.501) [-365.516] -- 0:00:27
526000 -- [-370.615] (-366.922) (-369.549) (-371.516) * (-367.236) (-366.710) (-366.507) [-365.636] -- 0:00:27
526500 -- (-373.231) [-368.007] (-366.124) (-367.677) * (-368.133) (-364.992) (-368.550) [-365.459] -- 0:00:27
527000 -- (-368.196) (-365.066) [-366.938] (-367.184) * (-369.642) (-365.166) (-368.703) [-365.691] -- 0:00:27
527500 -- [-369.763] (-366.005) (-366.225) (-368.191) * (-366.290) (-376.181) [-366.682] (-366.373) -- 0:00:27
528000 -- (-368.195) [-365.868] (-365.054) (-368.384) * (-378.310) (-368.329) (-367.590) [-368.214] -- 0:00:27
528500 -- [-368.782] (-366.221) (-366.145) (-369.097) * [-365.334] (-365.256) (-364.536) (-367.103) -- 0:00:27
529000 -- [-365.168] (-366.071) (-365.084) (-366.442) * (-365.450) (-371.571) (-365.326) [-366.784] -- 0:00:27
529500 -- (-365.768) [-373.268] (-367.543) (-365.809) * [-365.979] (-369.181) (-366.500) (-365.558) -- 0:00:28
530000 -- [-368.353] (-366.581) (-372.262) (-365.083) * (-365.788) (-365.108) [-364.796] (-366.260) -- 0:00:28
Average standard deviation of split frequencies: 0.014868
530500 -- (-366.035) (-365.217) [-366.139] (-366.568) * (-366.239) (-365.213) (-365.927) [-368.425] -- 0:00:28
531000 -- (-365.375) (-365.105) (-366.483) [-370.503] * (-366.218) (-365.130) (-367.013) [-367.852] -- 0:00:28
531500 -- (-369.042) (-373.565) [-364.953] (-368.144) * (-367.061) (-365.447) [-368.078] (-366.942) -- 0:00:28
532000 -- (-364.711) (-365.286) [-366.865] (-368.073) * (-365.840) (-367.239) [-367.671] (-367.434) -- 0:00:28
532500 -- (-367.668) (-366.286) (-366.385) [-373.396] * [-367.183] (-368.321) (-365.815) (-364.814) -- 0:00:28
533000 -- [-366.681] (-365.873) (-365.365) (-368.884) * (-365.121) (-366.725) [-364.924] (-365.296) -- 0:00:28
533500 -- (-366.997) (-365.118) [-366.413] (-367.543) * (-365.606) (-365.469) [-366.506] (-365.488) -- 0:00:27
534000 -- [-369.004] (-366.537) (-367.233) (-366.589) * (-364.818) (-369.895) (-373.346) [-367.443] -- 0:00:27
534500 -- (-366.026) (-364.685) (-366.777) [-366.790] * [-365.591] (-367.403) (-368.306) (-365.977) -- 0:00:27
535000 -- (-366.853) (-365.427) [-366.922] (-367.796) * (-365.540) (-368.307) (-366.618) [-366.618] -- 0:00:27
Average standard deviation of split frequencies: 0.014766
535500 -- [-366.296] (-368.337) (-366.573) (-366.543) * (-370.443) (-369.014) [-370.216] (-365.742) -- 0:00:27
536000 -- (-367.702) (-368.185) (-366.521) [-365.348] * [-369.575] (-365.902) (-367.500) (-365.109) -- 0:00:27
536500 -- (-369.743) (-365.193) [-365.107] (-365.097) * (-365.173) (-367.361) [-365.841] (-366.938) -- 0:00:27
537000 -- [-367.850] (-365.971) (-369.572) (-365.194) * (-366.216) [-366.557] (-370.277) (-369.904) -- 0:00:27
537500 -- (-367.274) (-365.148) [-364.830] (-365.274) * (-366.587) [-369.958] (-365.452) (-367.275) -- 0:00:27
538000 -- (-366.500) (-367.032) [-364.838] (-366.116) * (-366.974) (-367.080) [-365.457] (-365.743) -- 0:00:27
538500 -- [-364.916] (-365.729) (-365.055) (-367.157) * (-371.271) (-365.476) [-365.202] (-365.524) -- 0:00:27
539000 -- (-366.798) (-366.050) [-368.204] (-365.269) * (-365.054) (-368.495) [-365.205] (-364.583) -- 0:00:27
539500 -- (-370.059) [-367.793] (-366.281) (-365.798) * (-365.656) (-367.039) [-365.678] (-364.975) -- 0:00:27
540000 -- (-365.470) [-365.134] (-367.914) (-365.599) * (-365.209) [-367.919] (-368.979) (-368.005) -- 0:00:27
Average standard deviation of split frequencies: 0.014338
540500 -- (-366.962) (-365.446) (-368.699) [-365.322] * (-368.796) (-370.556) (-364.627) [-365.590] -- 0:00:27
541000 -- (-368.032) (-365.828) [-369.153] (-367.244) * (-366.517) [-370.816] (-366.946) (-366.212) -- 0:00:27
541500 -- (-367.801) [-365.132] (-365.802) (-365.266) * (-365.729) [-365.255] (-364.943) (-365.085) -- 0:00:27
542000 -- [-368.053] (-367.550) (-367.675) (-365.537) * (-365.503) [-365.942] (-365.202) (-367.512) -- 0:00:27
542500 -- (-369.862) [-366.256] (-371.288) (-367.792) * (-370.431) (-366.111) (-366.336) [-367.403] -- 0:00:26
543000 -- (-370.851) (-366.026) (-368.654) [-367.189] * (-365.672) (-366.970) (-366.530) [-365.048] -- 0:00:26
543500 -- (-369.656) (-365.118) (-367.017) [-366.803] * (-366.115) (-369.782) (-368.513) [-366.222] -- 0:00:26
544000 -- (-366.397) (-366.935) (-370.446) [-368.183] * (-368.383) (-372.232) (-366.203) [-365.988] -- 0:00:26
544500 -- (-366.495) [-366.707] (-366.921) (-371.320) * [-365.902] (-368.673) (-366.323) (-366.043) -- 0:00:26
545000 -- (-365.754) (-366.638) (-365.654) [-367.852] * (-366.707) (-369.571) (-367.347) [-367.220] -- 0:00:26
Average standard deviation of split frequencies: 0.014390
545500 -- (-367.081) (-368.057) (-367.139) [-364.960] * (-366.315) (-369.526) (-370.087) [-364.868] -- 0:00:26
546000 -- (-365.951) (-372.334) [-365.923] (-367.754) * (-365.384) (-367.369) (-366.186) [-369.399] -- 0:00:26
546500 -- [-367.099] (-369.792) (-370.717) (-365.151) * (-367.095) (-368.003) (-367.116) [-366.418] -- 0:00:27
547000 -- (-368.445) (-366.596) (-368.339) [-365.512] * (-368.423) (-366.016) (-369.807) [-365.683] -- 0:00:27
547500 -- [-365.853] (-367.933) (-366.507) (-365.652) * [-367.671] (-370.305) (-368.051) (-365.223) -- 0:00:27
548000 -- (-365.063) (-366.123) [-366.461] (-368.579) * [-367.769] (-366.948) (-368.886) (-366.576) -- 0:00:27
548500 -- (-367.800) [-365.326] (-369.066) (-366.872) * (-369.714) [-367.010] (-365.681) (-366.231) -- 0:00:27
549000 -- (-366.433) (-365.932) [-364.954] (-369.120) * (-369.034) [-367.180] (-367.134) (-367.756) -- 0:00:27
549500 -- [-368.322] (-366.253) (-366.390) (-366.288) * (-368.264) (-366.302) [-367.892] (-368.035) -- 0:00:27
550000 -- (-365.469) [-366.953] (-369.121) (-369.915) * (-368.428) (-366.009) (-365.829) [-366.214] -- 0:00:27
Average standard deviation of split frequencies: 0.014643
550500 -- (-365.099) (-365.888) (-369.792) [-365.017] * (-369.794) (-371.055) [-364.806] (-367.472) -- 0:00:26
551000 -- [-367.012] (-365.740) (-366.029) (-365.626) * [-368.175] (-370.018) (-366.919) (-370.748) -- 0:00:26
551500 -- (-369.890) [-366.292] (-366.149) (-366.098) * (-369.759) [-365.833] (-366.379) (-365.683) -- 0:00:26
552000 -- (-368.791) (-367.799) (-365.984) [-366.433] * (-368.840) (-368.060) [-365.686] (-367.310) -- 0:00:26
552500 -- [-368.538] (-366.021) (-367.446) (-367.817) * (-366.285) (-370.272) (-368.805) [-367.739] -- 0:00:26
553000 -- (-367.352) (-365.873) (-369.389) [-366.302] * [-365.879] (-365.805) (-364.994) (-368.284) -- 0:00:26
553500 -- (-367.621) (-368.390) (-369.655) [-364.610] * (-365.547) (-366.174) [-365.839] (-366.103) -- 0:00:26
554000 -- (-365.172) (-367.213) [-367.463] (-366.740) * (-366.786) (-375.305) [-366.102] (-366.525) -- 0:00:26
554500 -- [-364.719] (-366.126) (-370.087) (-368.671) * [-366.400] (-371.660) (-366.149) (-365.333) -- 0:00:26
555000 -- [-366.440] (-368.080) (-366.254) (-364.638) * (-366.218) [-367.479] (-365.889) (-365.415) -- 0:00:26
Average standard deviation of split frequencies: 0.014726
555500 -- [-365.622] (-371.886) (-366.881) (-369.776) * (-366.798) [-365.893] (-366.877) (-367.176) -- 0:00:26
556000 -- [-365.112] (-364.919) (-364.914) (-365.612) * [-367.969] (-366.119) (-365.769) (-365.794) -- 0:00:26
556500 -- [-366.057] (-368.266) (-368.246) (-367.253) * [-367.810] (-364.897) (-367.268) (-366.662) -- 0:00:26
557000 -- (-365.707) (-372.097) [-368.862] (-371.135) * (-368.908) (-366.174) (-364.863) [-365.824] -- 0:00:26
557500 -- (-366.845) [-368.717] (-369.234) (-371.376) * (-367.046) (-366.870) (-366.944) [-371.584] -- 0:00:26
558000 -- [-367.079] (-364.866) (-365.504) (-365.570) * [-364.856] (-370.111) (-367.282) (-369.111) -- 0:00:26
558500 -- [-366.859] (-366.680) (-364.753) (-365.196) * (-364.696) [-367.893] (-365.223) (-366.481) -- 0:00:26
559000 -- (-367.507) (-366.066) (-364.951) [-364.852] * [-365.098] (-366.044) (-368.353) (-369.651) -- 0:00:26
559500 -- (-369.933) (-368.613) (-367.265) [-367.423] * (-365.878) [-364.922] (-367.973) (-366.897) -- 0:00:25
560000 -- (-367.175) (-375.117) [-365.753] (-369.706) * (-368.129) [-366.318] (-370.069) (-366.298) -- 0:00:25
Average standard deviation of split frequencies: 0.014249
560500 -- [-365.774] (-367.738) (-366.766) (-367.220) * (-365.215) (-365.127) (-366.351) [-365.556] -- 0:00:25
561000 -- (-365.375) (-369.734) (-371.404) [-365.206] * (-367.879) (-366.824) [-367.887] (-366.453) -- 0:00:25
561500 -- (-365.583) (-367.193) (-364.506) [-368.389] * (-369.783) (-365.472) (-365.653) [-366.310] -- 0:00:25
562000 -- (-366.733) (-369.487) (-366.814) [-365.275] * [-367.935] (-366.155) (-368.107) (-368.523) -- 0:00:25
562500 -- (-364.862) (-365.718) [-366.195] (-366.701) * (-366.879) (-367.360) [-366.837] (-369.427) -- 0:00:25
563000 -- (-366.817) [-365.768] (-365.293) (-367.044) * [-367.155] (-366.180) (-364.651) (-369.423) -- 0:00:25
563500 -- (-364.840) (-366.692) (-364.420) [-365.865] * (-369.516) [-365.355] (-367.419) (-365.416) -- 0:00:25
564000 -- [-367.642] (-367.669) (-365.174) (-367.770) * (-368.137) [-367.287] (-368.653) (-367.715) -- 0:00:26
564500 -- [-368.239] (-371.238) (-365.387) (-364.922) * (-365.709) (-368.485) [-365.245] (-366.162) -- 0:00:26
565000 -- (-367.932) (-367.154) (-366.521) [-366.025] * (-368.112) (-367.745) [-366.763] (-370.090) -- 0:00:26
Average standard deviation of split frequencies: 0.014203
565500 -- (-365.840) [-366.399] (-365.239) (-365.797) * (-365.003) (-367.950) [-365.693] (-371.187) -- 0:00:26
566000 -- (-366.673) (-366.354) (-366.796) [-366.720] * (-366.511) [-366.913] (-369.810) (-370.139) -- 0:00:26
566500 -- (-368.325) (-366.259) [-369.049] (-365.334) * (-366.885) [-371.130] (-364.694) (-368.075) -- 0:00:26
567000 -- [-365.979] (-367.863) (-366.490) (-366.814) * [-365.688] (-369.283) (-364.927) (-365.961) -- 0:00:25
567500 -- [-369.902] (-366.985) (-365.977) (-367.340) * (-364.967) (-365.637) (-368.328) [-366.248] -- 0:00:25
568000 -- [-364.577] (-366.988) (-366.534) (-367.819) * [-365.052] (-366.125) (-366.070) (-368.312) -- 0:00:25
568500 -- (-365.255) [-366.883] (-370.594) (-364.825) * (-365.870) (-368.001) [-365.573] (-365.038) -- 0:00:25
569000 -- (-365.069) (-369.234) [-366.826] (-367.494) * [-366.635] (-365.841) (-366.562) (-365.304) -- 0:00:25
569500 -- [-365.169] (-366.842) (-365.731) (-366.790) * (-367.123) (-365.466) [-365.613] (-366.986) -- 0:00:25
570000 -- (-365.914) [-365.236] (-370.706) (-368.780) * (-368.546) (-369.106) [-367.823] (-365.550) -- 0:00:25
Average standard deviation of split frequencies: 0.013739
570500 -- (-368.355) [-365.657] (-368.805) (-366.899) * (-370.009) (-370.218) (-367.900) [-366.515] -- 0:00:25
571000 -- (-367.087) (-367.579) [-371.409] (-366.616) * (-368.804) (-368.726) [-366.406] (-364.494) -- 0:00:25
571500 -- (-369.732) (-366.641) (-368.273) [-364.790] * (-367.717) [-364.687] (-366.779) (-365.061) -- 0:00:25
572000 -- [-365.225] (-365.214) (-365.843) (-366.042) * (-368.162) (-366.280) [-365.431] (-365.350) -- 0:00:25
572500 -- [-365.280] (-371.001) (-366.688) (-366.363) * [-366.426] (-368.229) (-371.065) (-366.317) -- 0:00:25
573000 -- [-365.552] (-367.432) (-370.674) (-367.209) * (-365.432) (-371.136) [-365.944] (-366.720) -- 0:00:25
573500 -- (-365.100) (-365.070) [-366.790] (-367.318) * (-368.055) (-365.289) (-366.315) [-367.635] -- 0:00:25
574000 -- (-368.008) (-373.648) [-365.463] (-367.345) * (-364.972) (-366.556) [-366.580] (-371.921) -- 0:00:25
574500 -- (-371.210) (-367.641) [-364.933] (-366.226) * (-366.656) (-368.171) [-365.957] (-369.806) -- 0:00:25
575000 -- (-368.804) [-367.950] (-367.491) (-367.147) * (-367.605) (-366.117) [-365.950] (-372.871) -- 0:00:25
Average standard deviation of split frequencies: 0.013353
575500 -- (-368.411) (-366.859) (-367.552) [-365.799] * (-364.576) [-365.354] (-365.620) (-367.609) -- 0:00:25
576000 -- (-369.168) (-366.489) (-365.638) [-366.500] * [-365.570] (-366.847) (-367.663) (-365.718) -- 0:00:25
576500 -- (-366.693) [-366.236] (-368.091) (-369.092) * (-365.805) (-364.972) [-366.557] (-365.573) -- 0:00:24
577000 -- (-367.273) [-370.384] (-369.124) (-375.628) * [-364.559] (-367.179) (-369.940) (-365.933) -- 0:00:24
577500 -- (-366.071) (-368.156) (-367.390) [-367.513] * (-365.204) (-370.107) (-366.428) [-366.593] -- 0:00:24
578000 -- (-373.618) [-367.147] (-367.835) (-365.697) * (-365.890) (-369.937) (-368.195) [-366.789] -- 0:00:24
578500 -- (-369.875) [-365.651] (-368.729) (-364.873) * (-367.803) (-365.270) (-367.370) [-365.267] -- 0:00:24
579000 -- (-366.434) [-367.198] (-368.896) (-367.864) * [-365.923] (-365.640) (-370.400) (-366.190) -- 0:00:24
579500 -- [-366.570] (-366.841) (-368.921) (-368.074) * (-365.829) (-368.262) [-367.279] (-367.242) -- 0:00:24
580000 -- (-365.739) (-368.237) (-366.763) [-364.981] * (-366.992) (-365.967) (-368.267) [-366.630] -- 0:00:24
Average standard deviation of split frequencies: 0.012605
580500 -- (-366.785) (-368.363) (-366.999) [-368.374] * (-367.714) [-366.809] (-365.612) (-367.344) -- 0:00:24
581000 -- (-369.711) (-370.577) [-367.470] (-365.581) * (-368.825) (-367.406) [-366.111] (-365.441) -- 0:00:25
581500 -- (-365.041) (-366.207) [-366.714] (-366.582) * (-368.031) (-368.178) (-367.034) [-368.190] -- 0:00:25
582000 -- (-366.079) (-365.441) [-367.666] (-367.956) * (-365.795) (-370.469) (-367.098) [-369.481] -- 0:00:25
582500 -- (-366.186) (-366.153) [-365.636] (-365.410) * (-366.175) (-365.294) (-369.796) [-366.157] -- 0:00:25
583000 -- (-368.354) [-366.973] (-367.001) (-367.981) * (-367.672) (-366.655) (-375.382) [-365.617] -- 0:00:25
583500 -- (-367.417) (-366.667) [-367.175] (-366.191) * (-366.961) (-367.045) [-367.172] (-365.495) -- 0:00:24
584000 -- [-365.328] (-368.164) (-369.223) (-366.285) * (-366.204) (-371.024) [-366.186] (-367.514) -- 0:00:24
584500 -- (-366.331) (-365.468) (-368.829) [-368.422] * (-366.745) [-368.229] (-367.538) (-365.165) -- 0:00:24
585000 -- (-368.578) [-365.573] (-365.690) (-367.355) * (-368.251) (-366.184) (-367.549) [-367.147] -- 0:00:24
Average standard deviation of split frequencies: 0.012321
585500 -- (-367.436) (-367.180) [-365.330] (-369.534) * [-365.358] (-369.830) (-366.555) (-367.023) -- 0:00:24
586000 -- [-367.117] (-366.829) (-365.313) (-369.961) * [-364.996] (-368.044) (-367.342) (-366.548) -- 0:00:24
586500 -- (-366.384) [-367.701] (-365.095) (-366.385) * (-366.724) (-368.889) (-366.000) [-366.172] -- 0:00:24
587000 -- (-366.708) (-365.103) [-368.580] (-365.339) * (-366.832) (-369.054) [-367.579] (-366.913) -- 0:00:24
587500 -- (-365.234) (-366.193) [-365.763] (-368.134) * [-368.916] (-365.210) (-370.869) (-365.809) -- 0:00:24
588000 -- (-364.777) [-365.689] (-370.398) (-366.153) * (-368.121) (-365.693) [-367.141] (-367.500) -- 0:00:24
588500 -- (-365.446) [-366.735] (-369.591) (-372.534) * (-365.334) (-366.083) [-366.839] (-367.392) -- 0:00:24
589000 -- (-366.526) (-367.825) (-370.679) [-372.312] * (-367.161) [-365.991] (-366.967) (-369.907) -- 0:00:24
589500 -- (-367.118) [-365.662] (-368.421) (-365.618) * (-370.070) [-367.085] (-365.511) (-364.521) -- 0:00:24
590000 -- (-365.790) [-366.827] (-370.715) (-369.488) * (-371.239) (-366.606) [-365.084] (-367.186) -- 0:00:24
Average standard deviation of split frequencies: 0.012592
590500 -- [-365.603] (-370.193) (-366.426) (-371.509) * (-371.115) (-365.091) (-365.242) [-367.394] -- 0:00:24
591000 -- (-367.093) (-366.757) (-365.711) [-365.730] * [-366.130] (-365.745) (-366.483) (-365.568) -- 0:00:24
591500 -- (-369.258) [-371.429] (-366.007) (-367.964) * (-366.450) [-365.007] (-367.739) (-367.087) -- 0:00:24
592000 -- (-369.317) (-366.978) (-365.200) [-367.162] * [-365.538] (-365.325) (-367.825) (-369.663) -- 0:00:24
592500 -- [-368.565] (-366.876) (-373.170) (-364.727) * [-367.523] (-367.029) (-366.410) (-370.332) -- 0:00:24
593000 -- (-366.416) (-370.250) (-368.862) [-364.643] * [-365.211] (-368.403) (-368.260) (-373.731) -- 0:00:24
593500 -- (-369.654) (-369.083) [-367.520] (-366.949) * [-365.106] (-366.911) (-370.156) (-371.038) -- 0:00:23
594000 -- (-368.505) [-365.280] (-369.688) (-368.342) * (-364.877) (-365.342) (-369.426) [-366.719] -- 0:00:23
594500 -- (-368.183) (-365.460) (-367.717) [-370.355] * (-364.769) [-366.118] (-365.869) (-366.728) -- 0:00:23
595000 -- (-373.039) (-364.907) (-368.428) [-365.705] * (-365.994) (-367.054) (-366.718) [-367.904] -- 0:00:23
Average standard deviation of split frequencies: 0.012702
595500 -- [-367.484] (-364.564) (-368.462) (-368.615) * (-368.331) (-368.010) [-367.248] (-364.641) -- 0:00:23
596000 -- (-367.491) (-366.198) (-365.092) [-368.543] * (-369.008) (-370.235) (-366.758) [-364.814] -- 0:00:23
596500 -- (-364.826) (-365.684) (-366.507) [-368.171] * (-371.453) (-367.800) (-367.855) [-371.013] -- 0:00:23
597000 -- (-365.423) (-365.534) [-366.084] (-364.959) * (-367.568) [-368.607] (-366.338) (-366.108) -- 0:00:23
597500 -- (-365.927) [-365.820] (-366.017) (-367.666) * (-366.305) (-365.156) [-367.001] (-367.484) -- 0:00:23
598000 -- (-367.545) (-365.363) [-365.553] (-365.519) * (-369.767) (-368.534) [-367.365] (-368.939) -- 0:00:24
598500 -- (-367.399) [-369.300] (-367.888) (-368.241) * [-365.766] (-367.326) (-366.142) (-366.484) -- 0:00:24
599000 -- (-367.392) (-371.807) (-366.606) [-372.864] * [-364.693] (-366.939) (-369.922) (-365.896) -- 0:00:24
599500 -- [-368.578] (-369.720) (-368.363) (-370.825) * (-365.531) (-366.155) [-367.497] (-365.803) -- 0:00:24
600000 -- (-368.271) [-365.793] (-365.723) (-365.154) * (-369.514) (-366.806) [-367.545] (-366.068) -- 0:00:24
Average standard deviation of split frequencies: 0.013111
600500 -- (-365.198) (-367.130) [-366.870] (-367.058) * (-366.208) (-369.260) (-365.730) [-366.165] -- 0:00:23
601000 -- (-367.798) (-367.193) (-365.836) [-368.493] * (-367.896) [-368.725] (-368.648) (-370.355) -- 0:00:23
601500 -- (-365.110) (-367.038) (-370.036) [-364.574] * (-365.251) [-367.142] (-366.789) (-367.742) -- 0:00:23
602000 -- (-366.884) (-366.777) (-366.316) [-368.429] * (-365.505) (-369.203) (-366.221) [-371.582] -- 0:00:23
602500 -- (-366.665) (-369.467) [-365.780] (-366.264) * (-368.242) (-367.969) [-365.359] (-368.347) -- 0:00:23
603000 -- (-365.561) (-367.381) [-367.584] (-366.259) * [-367.210] (-365.828) (-365.152) (-371.104) -- 0:00:23
603500 -- [-367.362] (-365.437) (-365.434) (-365.780) * (-366.271) (-365.605) [-367.881] (-369.217) -- 0:00:23
604000 -- [-366.344] (-367.752) (-365.911) (-365.069) * [-365.530] (-365.060) (-369.795) (-366.085) -- 0:00:23
604500 -- (-367.596) (-368.492) (-367.821) [-365.295] * [-365.899] (-367.853) (-374.483) (-366.663) -- 0:00:23
605000 -- (-366.474) (-369.586) [-366.481] (-365.559) * (-369.520) (-370.861) (-369.786) [-366.470] -- 0:00:23
Average standard deviation of split frequencies: 0.013270
605500 -- [-366.263] (-370.841) (-370.853) (-365.559) * (-369.230) (-365.744) [-364.944] (-366.386) -- 0:00:23
606000 -- (-372.961) (-369.604) (-366.503) [-366.525] * [-369.233] (-364.962) (-365.478) (-365.847) -- 0:00:23
606500 -- (-368.628) (-365.935) (-368.825) [-366.141] * (-367.278) (-366.871) (-369.814) [-364.820] -- 0:00:23
607000 -- (-366.887) [-365.545] (-367.399) (-368.020) * (-365.979) [-365.501] (-366.043) (-366.911) -- 0:00:23
607500 -- (-368.794) (-369.316) [-365.630] (-368.471) * (-368.432) [-365.516] (-365.208) (-366.841) -- 0:00:23
608000 -- (-366.662) (-366.905) [-370.262] (-369.795) * (-365.826) (-366.754) (-369.256) [-366.084] -- 0:00:23
608500 -- (-366.184) [-366.372] (-367.993) (-366.158) * (-368.137) (-364.683) (-369.668) [-365.787] -- 0:00:23
609000 -- (-369.700) (-366.127) (-371.768) [-366.313] * (-364.908) (-365.821) (-367.762) [-365.544] -- 0:00:23
609500 -- (-365.086) (-366.586) (-368.017) [-367.240] * [-365.408] (-372.001) (-369.428) (-366.373) -- 0:00:23
610000 -- [-368.174] (-365.604) (-365.077) (-368.759) * (-365.492) (-366.145) (-365.805) [-366.241] -- 0:00:23
Average standard deviation of split frequencies: 0.012624
610500 -- (-367.735) (-368.015) (-366.410) [-367.521] * (-365.019) (-366.517) [-366.423] (-368.371) -- 0:00:22
611000 -- [-369.549] (-369.995) (-369.004) (-367.855) * [-364.950] (-371.458) (-365.193) (-364.615) -- 0:00:22
611500 -- (-364.992) [-365.812] (-369.832) (-366.497) * (-367.290) (-372.095) [-364.501] (-364.807) -- 0:00:22
612000 -- (-366.310) (-365.910) (-365.934) [-367.064] * (-365.984) (-367.329) (-365.522) [-366.055] -- 0:00:22
612500 -- (-364.797) (-366.688) (-367.326) [-364.685] * (-366.297) (-365.676) (-364.910) [-369.498] -- 0:00:22
613000 -- (-365.679) [-366.516] (-371.242) (-368.839) * (-365.574) (-366.006) [-365.246] (-368.466) -- 0:00:22
613500 -- [-365.822] (-364.612) (-369.145) (-366.032) * (-365.098) (-367.419) (-368.162) [-365.021] -- 0:00:22
614000 -- [-367.324] (-367.282) (-365.752) (-365.543) * (-366.770) (-367.370) [-369.333] (-366.449) -- 0:00:22
614500 -- (-366.995) [-365.871] (-365.256) (-376.050) * (-367.288) [-368.490] (-369.292) (-373.125) -- 0:00:22
615000 -- [-365.730] (-366.767) (-365.141) (-366.760) * (-366.379) [-365.935] (-370.513) (-366.389) -- 0:00:22
Average standard deviation of split frequencies: 0.013105
615500 -- [-368.993] (-364.921) (-365.997) (-367.342) * [-366.017] (-366.462) (-373.106) (-366.291) -- 0:00:23
616000 -- [-365.250] (-371.210) (-365.727) (-370.651) * (-365.862) (-367.119) (-367.607) [-368.522] -- 0:00:23
616500 -- (-366.394) (-365.556) (-367.719) [-368.713] * (-366.423) (-373.319) (-366.400) [-366.001] -- 0:00:23
617000 -- (-365.646) (-365.772) (-366.874) [-368.436] * (-366.839) (-365.571) [-367.086] (-365.156) -- 0:00:22
617500 -- (-366.093) (-365.865) (-367.995) [-365.671] * (-365.204) (-366.756) [-369.401] (-366.265) -- 0:00:22
618000 -- (-365.742) (-367.544) (-365.204) [-366.288] * (-369.706) (-367.840) (-370.151) [-372.425] -- 0:00:22
618500 -- [-366.294] (-366.626) (-365.161) (-364.941) * (-368.294) (-367.792) [-366.092] (-366.663) -- 0:00:22
619000 -- (-365.598) [-365.929] (-367.994) (-368.943) * (-368.295) (-366.350) [-367.584] (-366.064) -- 0:00:22
619500 -- (-366.096) (-369.089) [-367.242] (-367.258) * (-364.703) [-367.024] (-368.521) (-370.057) -- 0:00:22
620000 -- (-369.301) [-367.236] (-365.927) (-373.476) * (-366.454) (-367.737) [-369.731] (-369.121) -- 0:00:22
Average standard deviation of split frequencies: 0.012376
620500 -- [-365.890] (-366.684) (-368.398) (-365.946) * (-365.702) [-364.921] (-370.396) (-366.678) -- 0:00:22
621000 -- (-366.360) (-368.328) [-365.445] (-369.006) * (-365.483) [-367.458] (-366.920) (-371.957) -- 0:00:22
621500 -- (-368.522) [-367.177] (-365.308) (-369.307) * (-367.083) [-366.309] (-369.091) (-369.739) -- 0:00:22
622000 -- [-367.519] (-371.067) (-368.962) (-367.239) * (-368.671) [-365.516] (-370.960) (-368.441) -- 0:00:22
622500 -- (-365.458) [-366.561] (-372.627) (-366.564) * (-368.416) (-368.826) [-367.014] (-366.388) -- 0:00:22
623000 -- [-367.416] (-364.670) (-367.433) (-367.802) * [-366.390] (-366.861) (-367.315) (-368.488) -- 0:00:22
623500 -- (-369.666) (-365.839) (-368.122) [-367.478] * (-365.343) [-368.999] (-365.791) (-369.947) -- 0:00:22
624000 -- (-366.318) (-366.137) [-370.886] (-366.502) * [-365.245] (-367.527) (-367.688) (-365.306) -- 0:00:22
624500 -- [-365.313] (-366.257) (-368.946) (-367.963) * (-365.837) [-367.272] (-371.891) (-370.300) -- 0:00:22
625000 -- [-364.992] (-365.478) (-367.437) (-366.467) * (-364.912) (-365.972) (-367.521) [-371.988] -- 0:00:22
Average standard deviation of split frequencies: 0.012580
625500 -- (-365.645) (-367.296) [-367.146] (-371.325) * (-365.462) (-367.549) [-368.890] (-368.980) -- 0:00:22
626000 -- (-365.549) (-367.804) [-367.543] (-371.131) * [-364.732] (-367.739) (-367.491) (-365.880) -- 0:00:22
626500 -- (-369.181) (-370.135) [-364.731] (-368.167) * (-366.234) (-368.251) (-367.195) [-366.073] -- 0:00:22
627000 -- [-365.735] (-365.783) (-367.360) (-367.403) * (-373.985) [-364.791] (-368.638) (-367.606) -- 0:00:22
627500 -- (-366.600) (-366.220) [-366.115] (-364.882) * (-369.435) (-366.132) (-367.573) [-367.339] -- 0:00:21
628000 -- [-367.055] (-367.041) (-366.602) (-368.325) * (-365.176) (-367.656) (-367.097) [-367.249] -- 0:00:21
628500 -- (-368.606) (-369.831) [-364.368] (-366.232) * (-365.085) (-367.214) [-365.612] (-366.093) -- 0:00:21
629000 -- [-366.426] (-367.359) (-366.739) (-367.632) * (-368.249) (-367.935) (-367.364) [-367.512] -- 0:00:21
629500 -- [-365.364] (-365.511) (-366.479) (-365.581) * (-365.530) (-368.869) (-365.627) [-367.433] -- 0:00:21
630000 -- (-365.622) [-364.676] (-365.619) (-366.291) * [-366.642] (-367.348) (-365.284) (-365.063) -- 0:00:21
Average standard deviation of split frequencies: 0.012707
630500 -- (-372.553) [-364.861] (-367.853) (-372.140) * (-366.112) (-365.715) (-366.736) [-367.526] -- 0:00:21
631000 -- (-365.944) [-366.701] (-368.759) (-366.067) * (-365.124) [-366.808] (-364.469) (-367.413) -- 0:00:21
631500 -- (-365.984) (-365.869) (-368.082) [-365.353] * (-365.471) (-370.597) [-365.825] (-365.329) -- 0:00:21
632000 -- (-366.170) [-365.690] (-365.148) (-368.924) * [-365.459] (-368.930) (-367.988) (-372.408) -- 0:00:21
632500 -- [-364.940] (-366.014) (-368.034) (-370.405) * [-365.887] (-365.205) (-368.160) (-365.112) -- 0:00:22
633000 -- [-364.596] (-366.943) (-370.290) (-366.237) * (-366.749) (-368.183) (-366.422) [-367.135] -- 0:00:22
633500 -- (-371.026) [-369.432] (-371.840) (-369.581) * (-366.702) (-367.949) (-364.942) [-369.222] -- 0:00:21
634000 -- (-365.186) [-365.285] (-373.017) (-370.202) * [-368.383] (-367.035) (-370.038) (-369.061) -- 0:00:21
634500 -- (-365.168) (-365.932) (-367.735) [-366.838] * (-365.806) (-368.171) [-367.045] (-365.778) -- 0:00:21
635000 -- (-367.397) (-367.080) (-365.775) [-365.879] * (-366.890) (-369.525) [-368.236] (-370.171) -- 0:00:21
Average standard deviation of split frequencies: 0.012862
635500 -- (-366.860) [-366.532] (-368.213) (-365.651) * [-367.159] (-366.837) (-368.980) (-368.585) -- 0:00:21
636000 -- (-368.174) (-368.869) (-365.717) [-366.846] * [-367.671] (-365.196) (-367.006) (-371.448) -- 0:00:21
636500 -- (-373.944) (-370.219) (-369.823) [-367.475] * (-365.046) (-364.859) (-367.970) [-365.522] -- 0:00:21
637000 -- (-369.207) [-365.336] (-368.588) (-365.865) * (-369.352) [-367.305] (-369.253) (-366.191) -- 0:00:21
637500 -- (-370.251) (-367.432) (-369.637) [-365.566] * (-367.830) [-367.407] (-366.098) (-368.822) -- 0:00:21
638000 -- (-366.560) (-367.813) (-371.704) [-369.849] * [-365.548] (-368.961) (-365.746) (-366.715) -- 0:00:21
638500 -- (-365.465) [-366.281] (-368.615) (-365.776) * (-365.877) (-365.175) [-367.287] (-367.417) -- 0:00:21
639000 -- (-366.508) [-365.467] (-368.577) (-369.580) * (-369.300) (-366.028) [-365.696] (-366.238) -- 0:00:21
639500 -- (-372.335) (-370.330) [-367.924] (-366.375) * (-370.492) (-371.024) (-367.520) [-367.146] -- 0:00:21
640000 -- [-365.307] (-369.002) (-367.180) (-368.271) * (-364.647) (-367.213) (-367.369) [-368.337] -- 0:00:21
Average standard deviation of split frequencies: 0.012249
640500 -- (-369.483) (-368.273) [-366.845] (-368.565) * (-364.792) (-366.508) (-368.474) [-365.097] -- 0:00:21
641000 -- (-368.726) [-368.355] (-366.698) (-368.233) * (-367.269) [-367.638] (-366.550) (-365.846) -- 0:00:21
641500 -- (-367.694) (-366.223) [-368.174] (-366.527) * (-365.330) (-367.386) [-368.052] (-365.767) -- 0:00:21
642000 -- (-364.600) (-366.772) (-369.621) [-365.685] * (-367.526) [-366.170] (-365.554) (-366.938) -- 0:00:21
642500 -- (-364.697) [-367.454] (-368.741) (-368.224) * (-366.499) [-366.306] (-366.566) (-365.282) -- 0:00:21
643000 -- (-367.653) (-372.335) (-368.513) [-368.149] * [-366.498] (-370.581) (-365.232) (-365.608) -- 0:00:21
643500 -- [-366.820] (-369.381) (-369.420) (-371.242) * (-366.753) (-366.366) (-366.729) [-365.369] -- 0:00:21
644000 -- (-368.171) (-369.585) [-367.622] (-366.714) * (-367.411) (-365.416) [-366.220] (-369.562) -- 0:00:21
644500 -- (-366.482) [-365.903] (-366.865) (-367.351) * [-369.081] (-368.157) (-364.542) (-367.307) -- 0:00:20
645000 -- (-366.851) (-366.298) [-365.130] (-369.122) * (-372.478) (-368.369) (-365.689) [-366.391] -- 0:00:20
Average standard deviation of split frequencies: 0.011847
645500 -- [-367.204] (-366.293) (-369.372) (-367.698) * (-367.849) (-370.882) (-366.576) [-366.157] -- 0:00:20
646000 -- [-368.440] (-368.028) (-368.202) (-366.936) * (-365.763) [-367.391] (-365.428) (-365.775) -- 0:00:20
646500 -- (-366.313) (-367.972) [-366.294] (-370.868) * (-365.099) (-367.031) [-367.385] (-366.475) -- 0:00:20
647000 -- (-368.461) [-365.920] (-366.167) (-366.665) * (-370.364) (-366.154) [-368.470] (-366.866) -- 0:00:20
647500 -- (-367.211) (-365.292) (-368.334) [-364.842] * (-366.457) (-364.909) (-366.503) [-366.120] -- 0:00:20
648000 -- [-367.802] (-369.132) (-366.114) (-366.143) * (-366.204) [-365.931] (-368.055) (-366.720) -- 0:00:20
648500 -- (-366.692) (-369.659) [-367.426] (-367.165) * (-372.530) (-367.874) (-366.479) [-366.616] -- 0:00:20
649000 -- (-366.963) [-366.526] (-367.315) (-367.766) * (-366.105) [-366.188] (-366.923) (-369.419) -- 0:00:20
649500 -- (-369.608) (-370.243) [-367.264] (-367.117) * (-369.736) (-366.739) [-366.489] (-367.982) -- 0:00:21
650000 -- [-368.857] (-366.224) (-367.330) (-365.232) * (-365.177) (-367.084) [-367.510] (-365.364) -- 0:00:21
Average standard deviation of split frequencies: 0.011677
650500 -- (-366.104) (-367.093) [-371.138] (-365.978) * [-366.305] (-368.953) (-366.988) (-365.979) -- 0:00:20
651000 -- (-367.241) [-367.804] (-368.640) (-365.469) * (-364.684) (-367.686) [-366.639] (-364.609) -- 0:00:20
651500 -- (-366.080) [-366.822] (-368.583) (-365.609) * (-369.166) (-370.504) [-368.195] (-368.959) -- 0:00:20
652000 -- (-366.084) (-366.578) (-367.944) [-366.766] * [-365.477] (-366.038) (-369.477) (-367.307) -- 0:00:20
652500 -- (-366.737) [-365.600] (-367.161) (-365.783) * (-365.486) (-365.180) (-370.408) [-364.723] -- 0:00:20
653000 -- (-367.809) (-367.070) (-366.957) [-365.765] * (-365.148) (-368.247) [-366.258] (-368.472) -- 0:00:20
653500 -- (-368.500) (-367.248) [-366.767] (-364.953) * [-366.113] (-370.364) (-368.482) (-365.520) -- 0:00:20
654000 -- (-367.823) [-365.925] (-368.017) (-365.537) * [-367.348] (-366.494) (-368.012) (-366.211) -- 0:00:20
654500 -- [-365.874] (-368.050) (-368.520) (-365.214) * (-369.552) (-366.035) [-365.554] (-367.415) -- 0:00:20
655000 -- (-368.470) (-367.033) (-368.088) [-365.626] * [-367.108] (-372.914) (-365.512) (-369.357) -- 0:00:20
Average standard deviation of split frequencies: 0.011540
655500 -- (-367.061) (-366.483) (-366.074) [-366.638] * [-368.144] (-366.923) (-365.405) (-365.474) -- 0:00:20
656000 -- (-368.360) (-364.797) (-367.789) [-366.220] * (-365.983) [-367.529] (-365.539) (-365.004) -- 0:00:20
656500 -- (-367.678) (-365.897) (-368.187) [-366.165] * (-364.814) (-366.631) [-366.352] (-367.000) -- 0:00:20
657000 -- [-371.362] (-365.526) (-367.826) (-365.377) * (-365.637) [-367.028] (-365.669) (-369.032) -- 0:00:20
657500 -- (-366.869) (-365.645) (-366.853) [-366.065] * (-365.501) (-365.480) (-367.335) [-365.571] -- 0:00:20
658000 -- (-368.582) [-367.768] (-364.839) (-368.609) * (-368.136) (-366.504) (-366.552) [-367.014] -- 0:00:20
658500 -- [-366.145] (-367.168) (-365.918) (-366.347) * (-367.837) (-366.396) (-366.145) [-367.036] -- 0:00:20
659000 -- [-364.916] (-366.375) (-367.392) (-366.298) * (-368.763) (-364.765) [-364.825] (-368.190) -- 0:00:20
659500 -- (-367.892) (-369.423) [-365.278] (-364.571) * [-368.541] (-367.175) (-365.503) (-365.941) -- 0:00:20
660000 -- (-367.145) [-373.285] (-365.549) (-366.394) * (-367.195) (-369.919) [-364.899] (-366.850) -- 0:00:20
Average standard deviation of split frequencies: 0.012130
660500 -- (-366.867) (-366.254) [-366.161] (-369.326) * [-370.159] (-370.502) (-367.051) (-370.119) -- 0:00:20
661000 -- (-367.046) (-364.515) [-365.843] (-366.064) * [-365.668] (-369.188) (-364.648) (-369.860) -- 0:00:20
661500 -- [-367.723] (-364.750) (-369.054) (-367.750) * (-366.910) [-366.271] (-365.650) (-364.733) -- 0:00:19
662000 -- [-366.086] (-367.405) (-369.292) (-367.522) * (-366.956) [-367.148] (-366.800) (-365.477) -- 0:00:19
662500 -- (-367.423) (-366.060) (-368.593) [-367.333] * [-369.077] (-365.794) (-365.147) (-364.993) -- 0:00:19
663000 -- (-365.205) [-365.780] (-369.346) (-365.157) * (-365.407) (-365.564) [-365.746] (-366.584) -- 0:00:19
663500 -- (-365.462) (-366.215) [-368.250] (-367.600) * (-367.674) (-365.341) (-365.552) [-366.768] -- 0:00:19
664000 -- [-365.869] (-373.055) (-366.497) (-366.615) * (-368.723) [-365.142] (-368.874) (-367.233) -- 0:00:19
664500 -- [-368.716] (-369.521) (-367.544) (-369.155) * [-367.511] (-369.488) (-365.737) (-366.159) -- 0:00:19
665000 -- (-367.160) [-367.836] (-365.143) (-368.148) * (-368.347) (-366.756) [-365.028] (-366.123) -- 0:00:19
Average standard deviation of split frequencies: 0.012324
665500 -- (-368.841) (-369.298) (-365.180) [-367.669] * [-366.531] (-366.904) (-366.130) (-366.905) -- 0:00:19
666000 -- [-364.768] (-366.295) (-365.279) (-366.637) * (-369.779) [-366.468] (-369.269) (-366.536) -- 0:00:19
666500 -- (-366.622) (-365.654) [-367.046] (-367.500) * (-367.457) [-367.393] (-365.391) (-366.447) -- 0:00:20
667000 -- [-366.739] (-367.572) (-366.532) (-367.396) * (-367.011) (-367.420) (-366.464) [-365.692] -- 0:00:19
667500 -- (-369.467) [-370.087] (-366.207) (-367.649) * (-368.252) (-367.458) (-365.456) [-366.151] -- 0:00:19
668000 -- [-365.377] (-368.428) (-365.687) (-367.693) * (-369.722) [-367.798] (-367.494) (-367.130) -- 0:00:19
668500 -- [-369.881] (-366.617) (-367.616) (-368.400) * (-365.749) [-368.080] (-366.196) (-366.294) -- 0:00:19
669000 -- [-366.417] (-366.330) (-365.480) (-367.627) * (-366.990) (-365.003) [-364.853] (-365.671) -- 0:00:19
669500 -- [-366.593] (-367.421) (-368.171) (-368.090) * [-366.467] (-366.290) (-365.421) (-365.725) -- 0:00:19
670000 -- (-368.465) (-370.825) [-366.431] (-369.275) * (-365.383) (-368.402) (-365.382) [-366.628] -- 0:00:19
Average standard deviation of split frequencies: 0.012652
670500 -- [-368.792] (-365.361) (-365.610) (-365.662) * (-366.007) (-365.581) [-365.993] (-365.286) -- 0:00:19
671000 -- [-366.804] (-366.077) (-369.891) (-366.285) * (-367.099) (-366.554) (-367.057) [-364.883] -- 0:00:19
671500 -- (-371.425) (-369.901) (-367.801) [-365.668] * (-371.388) [-366.914] (-369.037) (-373.839) -- 0:00:19
672000 -- (-371.767) [-367.035] (-365.826) (-366.331) * (-366.147) (-367.196) [-367.885] (-365.050) -- 0:00:19
672500 -- (-373.678) (-365.650) [-365.070] (-366.513) * [-365.238] (-366.073) (-366.758) (-365.524) -- 0:00:19
673000 -- (-369.559) [-365.963] (-367.634) (-365.513) * (-366.564) (-366.033) (-364.879) [-365.907] -- 0:00:19
673500 -- (-370.056) (-367.262) [-368.711] (-369.444) * (-368.788) (-365.031) (-364.982) [-365.174] -- 0:00:19
674000 -- (-368.821) (-367.708) [-365.655] (-369.171) * (-365.194) (-369.218) (-367.074) [-365.825] -- 0:00:19
674500 -- [-365.245] (-365.731) (-367.293) (-368.391) * (-367.520) [-372.500] (-365.299) (-369.287) -- 0:00:19
675000 -- (-366.288) (-368.058) [-364.830] (-365.949) * (-365.275) (-366.482) [-364.724] (-367.125) -- 0:00:19
Average standard deviation of split frequencies: 0.012429
675500 -- (-367.580) (-366.647) [-368.430] (-368.243) * (-366.466) [-369.154] (-366.324) (-367.489) -- 0:00:19
676000 -- [-368.739] (-367.295) (-364.566) (-368.125) * (-365.058) [-367.047] (-365.833) (-365.455) -- 0:00:19
676500 -- (-366.733) (-368.811) (-367.440) [-366.020] * (-364.542) [-368.727] (-365.511) (-365.889) -- 0:00:19
677000 -- [-367.619] (-365.065) (-368.357) (-365.616) * (-366.401) (-368.634) [-366.901] (-365.308) -- 0:00:19
677500 -- (-367.601) (-365.168) [-367.918] (-368.034) * (-365.002) (-368.465) [-367.957] (-367.405) -- 0:00:19
678000 -- [-365.192] (-368.770) (-367.594) (-365.264) * (-365.045) (-366.341) (-366.223) [-366.713] -- 0:00:18
678500 -- (-366.559) [-366.410] (-366.619) (-368.675) * [-364.886] (-366.049) (-368.171) (-366.122) -- 0:00:18
679000 -- [-366.244] (-365.721) (-367.852) (-368.159) * (-368.547) [-366.486] (-366.148) (-366.309) -- 0:00:18
679500 -- (-366.359) [-366.172] (-367.287) (-365.112) * (-367.848) (-367.915) (-370.933) [-366.513] -- 0:00:18
680000 -- (-368.072) (-367.007) (-366.421) [-365.638] * (-367.165) [-365.112] (-372.054) (-369.065) -- 0:00:18
Average standard deviation of split frequencies: 0.012385
680500 -- (-367.280) (-365.556) (-365.480) [-367.041] * [-366.965] (-366.854) (-367.869) (-368.276) -- 0:00:18
681000 -- (-368.792) (-365.810) (-366.682) [-365.593] * [-371.981] (-366.208) (-371.421) (-368.011) -- 0:00:18
681500 -- (-365.213) (-366.094) [-365.953] (-373.646) * [-367.426] (-367.604) (-370.632) (-369.030) -- 0:00:18
682000 -- (-370.900) (-368.410) [-367.499] (-369.700) * (-365.724) [-365.224] (-370.744) (-368.729) -- 0:00:18
682500 -- (-369.990) (-364.892) [-367.681] (-366.617) * (-367.063) (-367.525) (-369.173) [-367.420] -- 0:00:18
683000 -- (-366.178) [-367.456] (-366.284) (-367.808) * (-366.723) [-367.756] (-367.775) (-366.505) -- 0:00:18
683500 -- (-368.573) (-366.617) [-367.492] (-367.687) * [-366.494] (-366.575) (-364.891) (-366.753) -- 0:00:18
684000 -- (-371.160) (-364.720) [-369.191] (-367.489) * (-369.424) [-366.906] (-369.986) (-367.197) -- 0:00:18
684500 -- (-365.520) [-365.057] (-367.268) (-367.790) * (-369.649) (-367.782) (-366.733) [-367.191] -- 0:00:18
685000 -- (-369.032) (-366.652) [-368.166] (-367.855) * (-366.467) (-366.262) [-364.822] (-366.922) -- 0:00:18
Average standard deviation of split frequencies: 0.012652
685500 -- (-368.762) [-366.248] (-365.188) (-366.768) * (-371.911) [-366.838] (-365.657) (-371.678) -- 0:00:18
686000 -- (-372.832) (-368.198) [-367.255] (-367.098) * (-370.054) (-373.965) (-368.572) [-367.067] -- 0:00:18
686500 -- [-367.543] (-366.147) (-369.538) (-365.363) * (-371.832) [-366.513] (-371.381) (-366.766) -- 0:00:18
687000 -- (-368.839) (-366.634) [-367.953] (-365.363) * (-365.230) (-370.828) (-365.932) [-365.925] -- 0:00:18
687500 -- [-367.334] (-366.217) (-369.733) (-364.975) * (-369.405) (-365.932) [-364.531] (-366.110) -- 0:00:18
688000 -- (-367.046) [-364.559] (-371.019) (-371.315) * (-367.173) [-366.478] (-366.630) (-367.878) -- 0:00:18
688500 -- (-365.846) (-365.150) [-365.831] (-368.236) * [-367.751] (-372.078) (-364.725) (-366.199) -- 0:00:18
689000 -- (-365.344) (-365.214) (-365.585) [-365.497] * (-368.094) (-366.810) (-365.974) [-366.356] -- 0:00:18
689500 -- (-365.561) (-368.818) (-368.926) [-365.328] * [-365.528] (-366.450) (-366.113) (-367.296) -- 0:00:18
690000 -- (-367.475) [-365.946] (-368.046) (-365.081) * (-367.112) [-365.539] (-368.662) (-366.871) -- 0:00:18
Average standard deviation of split frequencies: 0.012366
690500 -- (-366.491) [-368.699] (-367.558) (-366.180) * (-364.961) [-364.914] (-365.419) (-369.291) -- 0:00:18
691000 -- [-365.556] (-366.050) (-367.729) (-364.707) * (-365.451) (-365.694) (-371.325) [-367.331] -- 0:00:18
691500 -- [-365.865] (-365.343) (-368.757) (-365.507) * (-368.118) [-364.495] (-368.670) (-364.643) -- 0:00:18
692000 -- (-365.232) (-367.309) [-366.871] (-368.082) * [-367.834] (-365.900) (-370.554) (-365.165) -- 0:00:18
692500 -- (-366.868) (-367.734) [-366.230] (-368.906) * (-365.851) (-366.541) [-366.662] (-366.674) -- 0:00:18
693000 -- (-366.050) (-366.647) (-367.371) [-370.896] * (-366.500) (-367.136) (-365.820) [-367.739] -- 0:00:18
693500 -- (-366.984) (-366.170) (-365.988) [-365.337] * (-366.675) [-369.175] (-369.270) (-368.854) -- 0:00:18
694000 -- [-369.863] (-369.072) (-365.939) (-367.309) * (-367.134) (-366.003) [-366.762] (-368.564) -- 0:00:18
694500 -- (-367.137) [-367.930] (-367.299) (-365.378) * (-365.218) [-365.628] (-373.997) (-366.454) -- 0:00:18
695000 -- (-365.215) [-365.066] (-365.786) (-368.076) * (-364.938) (-368.076) (-371.803) [-368.522] -- 0:00:17
Average standard deviation of split frequencies: 0.012568
695500 -- [-366.327] (-365.994) (-366.119) (-365.059) * [-365.590] (-368.478) (-369.752) (-368.592) -- 0:00:17
696000 -- (-367.554) (-367.045) [-365.579] (-366.195) * [-365.525] (-368.268) (-372.061) (-367.698) -- 0:00:17
696500 -- (-368.189) [-368.622] (-366.138) (-367.887) * [-366.349] (-365.485) (-372.971) (-365.179) -- 0:00:17
697000 -- (-369.939) [-367.763] (-365.251) (-366.831) * (-366.151) (-365.550) [-370.056] (-365.234) -- 0:00:17
697500 -- (-366.114) (-368.906) (-367.240) [-366.050] * (-371.658) (-364.484) (-369.810) [-366.569] -- 0:00:17
698000 -- (-364.839) (-368.785) (-367.429) [-366.450] * [-367.375] (-366.103) (-366.178) (-365.158) -- 0:00:17
698500 -- [-370.963] (-365.006) (-366.167) (-367.413) * (-366.990) (-366.769) [-364.996] (-366.565) -- 0:00:17
699000 -- (-366.140) [-365.641] (-366.050) (-367.570) * [-366.792] (-366.121) (-367.124) (-367.779) -- 0:00:17
699500 -- (-365.658) (-366.017) (-369.091) [-367.832] * (-365.400) (-368.577) (-366.622) [-365.681] -- 0:00:17
700000 -- (-366.107) (-366.266) [-365.791] (-369.503) * (-367.010) (-365.564) (-371.740) [-368.720] -- 0:00:17
Average standard deviation of split frequencies: 0.012372
700500 -- (-370.482) [-366.902] (-368.653) (-368.021) * [-364.686] (-364.984) (-368.285) (-365.887) -- 0:00:17
701000 -- (-370.771) (-368.028) [-368.192] (-365.537) * [-365.983] (-364.791) (-368.972) (-370.812) -- 0:00:17
701500 -- (-369.870) [-365.798] (-366.926) (-367.365) * (-365.814) (-369.446) (-368.505) [-366.747] -- 0:00:17
702000 -- (-367.075) (-370.116) [-366.107] (-366.419) * (-366.135) (-368.150) [-370.178] (-366.450) -- 0:00:17
702500 -- (-366.468) (-368.964) [-366.350] (-372.045) * (-364.797) (-366.096) (-373.073) [-365.388] -- 0:00:17
703000 -- [-365.286] (-368.290) (-365.735) (-370.985) * (-365.855) (-366.160) (-368.295) [-365.524] -- 0:00:17
703500 -- (-364.911) (-368.880) [-367.192] (-366.140) * [-364.596] (-366.295) (-365.274) (-366.443) -- 0:00:17
704000 -- (-364.557) (-366.660) (-369.094) [-364.622] * (-367.133) (-365.647) (-366.952) [-365.635] -- 0:00:17
704500 -- (-369.487) (-367.310) (-369.133) [-365.012] * (-366.383) [-365.311] (-366.497) (-368.146) -- 0:00:17
705000 -- (-364.820) [-369.384] (-365.146) (-365.176) * [-367.750] (-365.302) (-366.148) (-366.975) -- 0:00:17
Average standard deviation of split frequencies: 0.012909
705500 -- (-365.213) (-368.564) [-364.787] (-366.007) * [-366.262] (-365.797) (-366.127) (-366.429) -- 0:00:17
706000 -- (-365.602) (-367.226) (-368.481) [-370.063] * (-366.815) (-367.590) [-365.869] (-366.951) -- 0:00:17
706500 -- [-366.076] (-369.095) (-364.773) (-365.790) * (-365.747) (-364.969) [-366.366] (-369.086) -- 0:00:17
707000 -- (-366.185) (-367.231) [-367.000] (-368.371) * (-368.386) (-367.374) (-367.615) [-368.782] -- 0:00:17
707500 -- (-365.701) (-368.931) [-365.411] (-367.614) * (-365.523) (-365.094) (-368.669) [-368.008] -- 0:00:17
708000 -- (-368.426) (-366.283) (-367.476) [-366.031] * (-367.540) [-366.827] (-368.658) (-371.253) -- 0:00:17
708500 -- (-368.528) [-365.434] (-367.821) (-369.913) * (-366.466) (-365.295) [-367.259] (-367.547) -- 0:00:17
709000 -- [-367.975] (-366.157) (-366.469) (-368.877) * (-367.148) (-366.553) [-366.388] (-367.401) -- 0:00:17
709500 -- (-370.863) (-371.314) [-367.429] (-367.671) * [-365.797] (-365.744) (-367.509) (-368.496) -- 0:00:17
710000 -- (-365.774) (-370.644) (-365.717) [-365.534] * [-365.707] (-368.630) (-366.477) (-366.306) -- 0:00:17
Average standard deviation of split frequencies: 0.012493
710500 -- (-367.389) (-365.050) (-366.009) [-365.813] * (-365.828) (-369.246) (-366.797) [-365.930] -- 0:00:17
711000 -- [-365.921] (-367.055) (-369.141) (-365.317) * (-370.259) (-369.287) [-364.957] (-366.134) -- 0:00:17
711500 -- [-365.334] (-366.617) (-369.017) (-368.505) * (-369.275) (-365.677) [-365.016] (-366.833) -- 0:00:17
712000 -- [-370.136] (-366.891) (-376.105) (-370.342) * (-367.308) [-365.547] (-370.004) (-366.683) -- 0:00:16
712500 -- (-372.051) (-365.534) [-367.182] (-366.805) * [-370.199] (-365.415) (-368.011) (-368.817) -- 0:00:16
713000 -- (-371.484) (-366.051) (-367.154) [-364.839] * (-366.589) (-365.613) (-364.761) [-365.709] -- 0:00:16
713500 -- (-368.332) (-371.308) (-364.953) [-364.990] * [-366.042] (-365.060) (-366.024) (-365.713) -- 0:00:16
714000 -- (-368.697) (-370.949) (-367.435) [-368.018] * (-367.259) [-366.070] (-366.334) (-366.143) -- 0:00:16
714500 -- (-368.478) (-369.966) [-367.068] (-370.313) * (-367.571) (-365.486) [-372.396] (-365.917) -- 0:00:16
715000 -- (-366.107) (-367.778) [-366.456] (-366.886) * [-366.230] (-368.421) (-377.697) (-367.673) -- 0:00:16
Average standard deviation of split frequencies: 0.012070
715500 -- (-365.847) [-366.712] (-367.535) (-367.775) * (-370.767) [-366.566] (-366.017) (-366.873) -- 0:00:16
716000 -- (-365.852) [-367.945] (-366.017) (-370.148) * (-368.281) (-364.915) (-366.877) [-365.757] -- 0:00:16
716500 -- (-366.291) (-366.786) [-369.221] (-366.579) * (-365.836) (-366.485) (-369.718) [-367.188] -- 0:00:16
717000 -- [-366.089] (-365.571) (-364.640) (-366.683) * [-366.077] (-367.644) (-366.199) (-367.335) -- 0:00:16
717500 -- (-368.716) [-367.255] (-365.199) (-365.340) * [-366.203] (-366.341) (-367.456) (-366.876) -- 0:00:16
718000 -- [-369.408] (-366.246) (-367.081) (-366.704) * [-366.771] (-366.406) (-366.241) (-371.091) -- 0:00:16
718500 -- [-370.159] (-366.849) (-367.150) (-366.741) * (-365.510) (-367.287) (-365.858) [-368.806] -- 0:00:16
719000 -- (-365.803) (-369.094) (-371.034) [-367.315] * (-366.355) (-366.568) [-365.302] (-368.999) -- 0:00:16
719500 -- (-365.915) (-366.685) [-365.772] (-366.553) * (-366.023) [-367.200] (-369.353) (-365.040) -- 0:00:16
720000 -- (-368.101) (-370.209) [-366.938] (-368.039) * (-366.281) (-365.633) [-370.199] (-367.044) -- 0:00:16
Average standard deviation of split frequencies: 0.012390
720500 -- (-368.781) (-367.722) [-364.951] (-368.664) * [-368.061] (-366.963) (-366.875) (-369.687) -- 0:00:16
721000 -- [-367.520] (-367.456) (-368.550) (-366.691) * (-366.445) (-367.048) (-366.045) [-366.516] -- 0:00:16
721500 -- (-366.028) [-366.793] (-368.706) (-367.162) * (-369.227) (-368.160) (-366.636) [-368.280] -- 0:00:16
722000 -- (-369.133) (-366.072) [-367.087] (-366.700) * [-366.617] (-365.996) (-367.747) (-367.298) -- 0:00:16
722500 -- (-366.143) [-365.554] (-368.377) (-367.343) * [-365.612] (-368.519) (-367.601) (-368.137) -- 0:00:16
723000 -- (-368.429) (-371.421) [-367.272] (-365.550) * (-365.967) (-369.438) [-367.519] (-367.544) -- 0:00:16
723500 -- [-366.308] (-366.701) (-366.042) (-366.774) * [-364.661] (-368.668) (-365.606) (-368.401) -- 0:00:16
724000 -- (-365.026) [-368.942] (-364.974) (-368.107) * (-366.307) (-366.175) [-369.606] (-367.324) -- 0:00:16
724500 -- [-365.685] (-365.070) (-366.990) (-366.769) * [-364.856] (-367.189) (-371.248) (-365.866) -- 0:00:16
725000 -- (-366.563) (-368.121) (-367.321) [-366.785] * (-369.475) (-368.495) [-365.686] (-364.947) -- 0:00:16
Average standard deviation of split frequencies: 0.011940
725500 -- (-368.461) (-366.634) (-366.491) [-366.774] * (-369.004) [-365.418] (-365.445) (-365.019) -- 0:00:16
726000 -- (-368.287) (-369.871) [-368.188] (-366.833) * (-368.055) (-365.859) [-367.077] (-366.560) -- 0:00:16
726500 -- (-367.386) (-370.598) [-368.457] (-366.371) * [-366.343] (-370.859) (-365.593) (-370.886) -- 0:00:16
727000 -- (-365.807) (-366.804) (-368.729) [-365.117] * (-370.120) (-369.222) (-366.103) [-366.633] -- 0:00:16
727500 -- [-365.379] (-367.273) (-367.470) (-369.088) * (-371.095) [-366.801] (-365.164) (-366.163) -- 0:00:16
728000 -- (-369.202) (-370.280) [-365.640] (-369.167) * (-368.997) [-368.887] (-365.371) (-366.254) -- 0:00:16
728500 -- (-364.860) (-371.380) [-365.824] (-370.659) * (-366.644) [-367.663] (-368.344) (-370.819) -- 0:00:16
729000 -- (-365.560) (-371.878) [-365.273] (-367.681) * (-367.774) (-369.258) [-365.517] (-366.410) -- 0:00:15
729500 -- [-369.468] (-371.221) (-366.501) (-365.856) * [-371.629] (-377.160) (-365.913) (-367.672) -- 0:00:15
730000 -- (-364.776) (-368.512) [-365.230] (-373.777) * [-368.624] (-368.758) (-365.433) (-364.999) -- 0:00:15
Average standard deviation of split frequencies: 0.012258
730500 -- (-369.782) (-368.839) (-367.579) [-366.074] * (-366.083) [-365.455] (-371.289) (-368.193) -- 0:00:15
731000 -- (-378.894) (-367.494) [-366.199] (-367.323) * (-365.796) [-365.762] (-374.749) (-368.853) -- 0:00:15
731500 -- (-367.930) (-364.974) [-365.746] (-365.925) * (-369.797) (-366.626) (-372.382) [-369.170] -- 0:00:15
732000 -- [-366.175] (-367.013) (-365.171) (-365.792) * [-366.665] (-365.709) (-368.657) (-366.389) -- 0:00:15
732500 -- (-367.153) (-368.029) (-368.199) [-365.012] * (-366.861) (-370.047) (-366.469) [-367.461] -- 0:00:15
733000 -- (-365.917) [-368.015] (-370.717) (-366.257) * (-366.185) (-372.052) [-365.607] (-368.317) -- 0:00:15
733500 -- [-365.253] (-367.894) (-368.373) (-369.679) * [-365.226] (-368.149) (-369.125) (-366.431) -- 0:00:15
734000 -- (-366.605) (-368.502) [-370.436] (-367.368) * (-365.907) (-367.983) [-367.000] (-367.859) -- 0:00:15
734500 -- [-366.357] (-367.553) (-367.101) (-367.670) * (-366.132) [-367.848] (-368.779) (-367.948) -- 0:00:15
735000 -- (-365.169) (-367.010) [-366.123] (-370.697) * (-369.159) [-367.928] (-365.053) (-364.714) -- 0:00:15
Average standard deviation of split frequencies: 0.011169
735500 -- (-366.556) (-367.934) (-369.150) [-367.577] * [-365.308] (-366.467) (-366.271) (-366.431) -- 0:00:15
736000 -- [-365.201] (-367.613) (-365.549) (-364.694) * (-369.995) (-366.849) (-367.972) [-365.118] -- 0:00:15
736500 -- [-367.541] (-365.092) (-367.207) (-367.114) * (-366.034) (-367.100) [-366.465] (-364.918) -- 0:00:15
737000 -- (-365.421) [-368.568] (-368.118) (-367.481) * (-365.622) (-365.132) [-365.532] (-365.938) -- 0:00:15
737500 -- (-366.211) (-366.810) [-367.580] (-368.705) * (-366.842) (-370.267) (-367.849) [-365.685] -- 0:00:15
738000 -- [-365.049] (-367.470) (-366.413) (-365.329) * (-366.582) [-366.177] (-368.581) (-368.375) -- 0:00:15
738500 -- (-370.184) (-366.116) (-367.595) [-369.239] * (-368.594) (-365.185) (-366.864) [-365.723] -- 0:00:15
739000 -- (-366.482) (-366.973) [-365.403] (-367.689) * (-366.997) (-366.478) (-367.616) [-366.800] -- 0:00:15
739500 -- (-366.051) (-369.902) [-365.248] (-366.996) * (-366.284) (-369.165) [-365.453] (-367.785) -- 0:00:15
740000 -- (-367.389) (-366.779) [-365.859] (-366.761) * (-365.824) (-368.879) [-367.225] (-365.133) -- 0:00:15
Average standard deviation of split frequencies: 0.011615
740500 -- [-365.690] (-366.417) (-366.319) (-370.875) * (-364.843) (-369.033) (-368.689) [-366.187] -- 0:00:15
741000 -- (-370.309) [-366.368] (-367.119) (-365.479) * (-364.833) (-367.116) [-365.499] (-369.020) -- 0:00:15
741500 -- (-368.417) (-364.374) [-367.535] (-366.961) * (-366.398) [-366.785] (-369.958) (-366.954) -- 0:00:15
742000 -- (-366.752) (-365.702) (-368.452) [-372.113] * (-365.452) [-365.412] (-365.737) (-366.839) -- 0:00:15
742500 -- [-365.109] (-367.662) (-365.783) (-364.900) * (-368.590) (-366.016) [-365.254] (-365.655) -- 0:00:15
743000 -- (-369.171) (-365.239) [-365.096] (-368.628) * [-367.354] (-369.706) (-364.770) (-367.448) -- 0:00:15
743500 -- (-369.961) (-364.539) (-365.909) [-365.706] * (-366.018) (-365.560) (-366.390) [-366.046] -- 0:00:15
744000 -- (-367.162) (-365.890) (-365.282) [-366.389] * (-367.978) [-365.198] (-370.245) (-367.841) -- 0:00:15
744500 -- (-368.374) (-366.276) [-366.311] (-368.055) * (-366.825) (-366.689) [-366.774] (-370.250) -- 0:00:15
745000 -- (-371.680) [-365.936] (-370.285) (-365.710) * [-364.740] (-365.126) (-365.576) (-364.608) -- 0:00:15
Average standard deviation of split frequencies: 0.011523
745500 -- (-366.065) [-365.501] (-369.704) (-370.147) * (-368.784) (-367.986) (-366.118) [-367.966] -- 0:00:15
746000 -- [-366.272] (-366.506) (-370.458) (-370.300) * (-366.550) [-368.083] (-365.852) (-364.815) -- 0:00:14
746500 -- [-368.941] (-365.413) (-372.967) (-367.745) * (-369.197) [-365.399] (-365.835) (-364.671) -- 0:00:14
747000 -- (-366.063) (-365.956) (-370.663) [-365.096] * (-366.528) (-373.503) (-365.936) [-366.006] -- 0:00:14
747500 -- (-366.199) (-366.364) (-368.813) [-365.186] * (-366.306) (-366.252) (-368.381) [-367.891] -- 0:00:14
748000 -- (-366.725) (-366.068) (-367.646) [-368.607] * (-365.806) (-366.928) (-368.711) [-365.866] -- 0:00:14
748500 -- (-367.367) (-365.028) [-366.799] (-364.551) * (-366.002) [-370.472] (-369.327) (-371.401) -- 0:00:14
749000 -- [-368.412] (-366.518) (-364.979) (-365.251) * (-366.998) (-366.801) [-365.541] (-367.987) -- 0:00:14
749500 -- (-368.073) (-368.986) (-371.466) [-366.392] * (-367.110) (-366.970) (-365.116) [-366.185] -- 0:00:14
750000 -- [-365.025] (-367.141) (-365.607) (-365.507) * (-370.903) (-365.572) (-370.347) [-366.946] -- 0:00:14
Average standard deviation of split frequencies: 0.012225
750500 -- (-364.996) [-366.779] (-365.272) (-366.094) * (-367.581) (-365.618) [-365.940] (-368.113) -- 0:00:14
751000 -- (-368.188) [-368.155] (-369.322) (-366.641) * (-365.993) (-365.134) (-369.063) [-367.523] -- 0:00:14
751500 -- (-364.902) [-365.546] (-368.071) (-368.117) * (-365.756) (-366.777) [-371.441] (-373.971) -- 0:00:14
752000 -- [-366.646] (-366.797) (-366.331) (-371.078) * (-366.577) [-366.909] (-368.346) (-366.564) -- 0:00:14
752500 -- (-368.332) [-365.206] (-369.132) (-370.737) * [-367.173] (-372.044) (-371.713) (-367.541) -- 0:00:14
753000 -- (-367.302) (-369.466) [-369.640] (-367.222) * [-367.237] (-368.949) (-367.517) (-367.320) -- 0:00:14
753500 -- (-365.809) (-368.792) (-366.030) [-364.715] * (-366.862) [-364.835] (-365.868) (-366.342) -- 0:00:14
754000 -- (-365.000) (-370.248) [-369.551] (-365.604) * (-366.264) (-367.317) [-365.135] (-370.324) -- 0:00:14
754500 -- (-366.743) [-365.334] (-374.836) (-369.479) * (-366.612) (-368.763) (-368.882) [-365.836] -- 0:00:14
755000 -- [-366.961] (-369.179) (-366.688) (-365.168) * [-369.978] (-365.557) (-368.985) (-365.004) -- 0:00:14
Average standard deviation of split frequencies: 0.011536
755500 -- (-372.613) [-367.274] (-369.710) (-368.019) * (-371.015) (-367.773) [-366.946] (-368.825) -- 0:00:14
756000 -- (-367.747) [-365.708] (-367.144) (-365.967) * (-378.196) (-367.509) [-368.602] (-368.434) -- 0:00:14
756500 -- (-367.428) (-367.773) [-367.196] (-366.374) * (-369.183) [-365.295] (-365.362) (-369.096) -- 0:00:14
757000 -- (-368.046) (-367.874) [-365.542] (-370.000) * (-365.525) (-365.993) (-365.688) [-367.016] -- 0:00:14
757500 -- (-367.550) (-365.806) [-365.041] (-368.222) * (-365.483) [-365.842] (-366.047) (-367.294) -- 0:00:14
758000 -- [-366.889] (-370.627) (-365.737) (-365.518) * [-365.353] (-367.628) (-366.710) (-365.145) -- 0:00:14
758500 -- [-366.150] (-365.912) (-368.100) (-367.566) * [-367.520] (-367.150) (-365.022) (-364.793) -- 0:00:14
759000 -- (-365.015) (-367.595) (-369.111) [-368.753] * [-367.000] (-366.794) (-369.280) (-365.553) -- 0:00:14
759500 -- [-367.100] (-368.913) (-373.256) (-368.447) * (-367.038) (-366.672) [-368.692] (-369.776) -- 0:00:14
760000 -- [-365.580] (-370.399) (-370.470) (-365.454) * (-365.308) (-371.145) [-366.224] (-367.308) -- 0:00:14
Average standard deviation of split frequencies: 0.011082
760500 -- (-368.498) (-369.515) [-365.958] (-373.011) * (-366.954) (-367.088) (-373.722) [-367.959] -- 0:00:14
761000 -- (-367.287) (-371.987) [-365.543] (-367.765) * [-366.604] (-369.292) (-367.632) (-367.428) -- 0:00:14
761500 -- (-367.315) (-366.342) (-365.668) [-368.181] * (-366.598) (-372.438) (-370.886) [-368.914] -- 0:00:14
762000 -- (-368.860) [-369.437] (-365.657) (-366.763) * (-369.127) [-368.867] (-368.501) (-370.872) -- 0:00:14
762500 -- (-370.109) (-368.896) [-364.737] (-369.581) * (-367.160) (-368.318) [-364.435] (-367.562) -- 0:00:14
763000 -- (-374.201) (-364.744) [-366.839] (-371.627) * (-366.803) [-369.116] (-366.932) (-368.087) -- 0:00:13
763500 -- (-370.710) [-365.793] (-376.261) (-366.852) * [-366.888] (-368.058) (-366.343) (-368.593) -- 0:00:13
764000 -- [-369.448] (-367.189) (-368.402) (-364.779) * [-365.801] (-366.287) (-367.822) (-368.849) -- 0:00:13
764500 -- (-366.833) (-368.007) (-370.030) [-364.951] * (-365.837) [-367.768] (-368.100) (-370.549) -- 0:00:13
765000 -- (-366.505) (-365.594) [-366.303] (-370.212) * (-372.521) (-369.704) [-367.075] (-365.939) -- 0:00:13
Average standard deviation of split frequencies: 0.010896
765500 -- (-370.116) (-365.812) [-365.765] (-366.563) * (-367.851) (-369.586) [-367.191] (-365.744) -- 0:00:13
766000 -- (-366.614) (-368.578) [-365.432] (-366.128) * (-366.233) (-367.247) (-366.968) [-366.393] -- 0:00:13
766500 -- (-368.311) (-367.672) (-368.571) [-366.690] * [-367.796] (-368.620) (-370.522) (-366.937) -- 0:00:13
767000 -- (-366.586) (-366.713) (-368.444) [-367.543] * (-364.974) (-370.511) (-369.313) [-367.063] -- 0:00:13
767500 -- (-364.825) [-366.592] (-366.331) (-366.165) * [-365.109] (-367.695) (-366.184) (-369.595) -- 0:00:13
768000 -- (-366.733) (-369.183) (-368.131) [-365.054] * (-365.173) (-367.640) (-368.223) [-371.943] -- 0:00:13
768500 -- (-365.510) (-367.821) [-367.087] (-366.253) * (-367.171) [-370.195] (-366.977) (-368.918) -- 0:00:13
769000 -- (-369.667) (-372.971) [-364.751] (-367.547) * (-366.192) (-369.358) [-368.138] (-368.841) -- 0:00:13
769500 -- [-367.857] (-370.975) (-366.530) (-370.967) * [-365.120] (-366.377) (-366.275) (-366.752) -- 0:00:13
770000 -- [-367.165] (-366.214) (-365.679) (-371.911) * [-368.558] (-369.622) (-367.298) (-368.418) -- 0:00:13
Average standard deviation of split frequencies: 0.011226
770500 -- (-367.100) (-366.197) [-369.231] (-367.712) * (-367.159) (-365.549) (-369.712) [-368.392] -- 0:00:13
771000 -- (-366.343) [-367.946] (-366.749) (-366.290) * [-366.162] (-367.894) (-368.310) (-365.489) -- 0:00:13
771500 -- [-364.876] (-369.087) (-365.793) (-365.685) * (-364.646) (-367.808) [-367.180] (-365.927) -- 0:00:13
772000 -- (-365.603) (-366.232) [-365.280] (-366.006) * (-369.027) (-367.883) (-365.094) [-369.823] -- 0:00:13
772500 -- (-366.538) (-365.013) (-367.144) [-366.470] * [-368.555] (-368.311) (-364.717) (-367.198) -- 0:00:13
773000 -- (-365.704) [-365.380] (-365.067) (-367.893) * [-366.241] (-366.132) (-365.471) (-367.069) -- 0:00:13
773500 -- (-366.469) [-366.865] (-365.262) (-367.137) * (-367.572) (-367.641) [-366.679] (-365.017) -- 0:00:13
774000 -- (-365.712) (-366.297) [-367.280] (-367.577) * (-366.384) [-365.784] (-366.133) (-369.767) -- 0:00:13
774500 -- (-365.944) (-365.653) (-365.239) [-367.346] * (-365.984) (-366.492) [-368.338] (-366.103) -- 0:00:13
775000 -- [-367.224] (-367.010) (-365.756) (-366.999) * (-366.427) [-366.430] (-366.494) (-368.126) -- 0:00:13
Average standard deviation of split frequencies: 0.011328
775500 -- (-366.711) (-367.651) (-366.525) [-367.460] * (-365.710) (-367.508) (-367.220) [-368.137] -- 0:00:13
776000 -- (-365.122) (-365.830) [-366.202] (-369.382) * (-366.364) (-365.331) (-365.667) [-367.229] -- 0:00:13
776500 -- (-365.727) [-367.302] (-365.830) (-364.950) * (-370.080) (-366.313) (-368.918) [-369.562] -- 0:00:13
777000 -- (-367.628) (-366.633) [-366.664] (-368.657) * [-368.683] (-368.991) (-367.899) (-367.329) -- 0:00:13
777500 -- (-368.955) (-367.600) (-366.940) [-369.301] * (-369.596) (-365.821) (-371.418) [-369.978] -- 0:00:13
778000 -- (-365.594) [-366.556] (-371.106) (-366.247) * (-374.870) (-367.709) (-368.144) [-366.036] -- 0:00:13
778500 -- (-366.927) [-365.924] (-367.069) (-365.034) * (-366.386) (-368.178) (-366.873) [-368.317] -- 0:00:13
779000 -- (-365.848) (-367.544) (-364.863) [-366.486] * (-367.098) [-367.837] (-365.384) (-366.341) -- 0:00:13
779500 -- [-366.653] (-367.046) (-366.424) (-365.382) * (-369.932) (-366.289) (-364.912) [-365.352] -- 0:00:13
780000 -- (-367.550) (-366.805) [-367.213] (-366.062) * (-365.458) (-367.470) [-365.078] (-364.971) -- 0:00:12
Average standard deviation of split frequencies: 0.011284
780500 -- (-367.224) [-365.778] (-370.688) (-366.097) * (-366.272) (-370.485) (-367.136) [-365.244] -- 0:00:12
781000 -- [-365.743] (-365.872) (-370.681) (-365.461) * (-365.704) (-369.514) (-369.971) [-365.687] -- 0:00:12
781500 -- (-366.867) [-365.412] (-369.935) (-366.362) * [-366.135] (-367.165) (-368.621) (-366.681) -- 0:00:12
782000 -- [-367.879] (-366.527) (-368.071) (-364.959) * (-365.982) (-368.873) (-369.554) [-368.218] -- 0:00:12
782500 -- (-366.230) (-366.669) [-371.310] (-368.865) * [-365.581] (-367.292) (-366.156) (-365.357) -- 0:00:12
783000 -- (-364.707) (-365.696) [-366.524] (-372.003) * (-368.287) (-368.432) [-367.009] (-367.100) -- 0:00:12
783500 -- (-367.142) (-366.367) [-368.790] (-367.698) * [-368.408] (-370.697) (-368.697) (-367.361) -- 0:00:12
784000 -- (-366.474) [-365.305] (-367.141) (-367.056) * (-366.931) (-366.245) [-367.118] (-366.127) -- 0:00:12
784500 -- (-369.678) (-365.873) [-368.429] (-366.384) * (-369.248) (-369.610) [-368.825] (-366.453) -- 0:00:12
785000 -- (-368.415) [-365.708] (-368.938) (-367.943) * (-365.701) [-365.627] (-367.933) (-365.596) -- 0:00:12
Average standard deviation of split frequencies: 0.011678
785500 -- (-368.438) (-368.988) [-368.260] (-370.330) * (-366.294) (-365.985) (-367.059) [-368.957] -- 0:00:12
786000 -- (-368.271) (-365.986) (-364.722) [-371.074] * (-367.808) [-365.592] (-365.768) (-365.504) -- 0:00:12
786500 -- (-365.642) [-368.454] (-365.243) (-368.642) * (-368.368) [-366.128] (-366.940) (-368.464) -- 0:00:12
787000 -- (-365.148) (-365.909) [-367.137] (-368.300) * (-367.183) [-367.433] (-367.291) (-365.807) -- 0:00:12
787500 -- [-368.260] (-364.805) (-366.370) (-364.925) * (-367.205) (-367.827) (-366.333) [-366.541] -- 0:00:12
788000 -- [-366.054] (-365.597) (-368.142) (-367.466) * (-366.419) (-366.717) (-369.222) [-365.989] -- 0:00:12
788500 -- [-365.347] (-365.795) (-365.540) (-365.484) * [-365.336] (-367.906) (-369.587) (-369.027) -- 0:00:12
789000 -- (-368.813) (-365.044) (-367.964) [-366.206] * (-366.808) (-365.538) (-365.857) [-367.539] -- 0:00:12
789500 -- [-364.832] (-365.011) (-370.320) (-364.930) * (-365.711) (-365.552) [-366.561] (-368.698) -- 0:00:12
790000 -- (-365.422) [-365.664] (-368.008) (-365.845) * (-365.937) [-366.944] (-364.478) (-365.483) -- 0:00:12
Average standard deviation of split frequencies: 0.011959
790500 -- [-367.789] (-366.760) (-368.540) (-367.130) * (-365.442) [-366.213] (-366.488) (-367.911) -- 0:00:12
791000 -- (-370.301) (-365.929) [-368.498] (-368.795) * (-369.351) (-366.361) (-365.242) [-366.853] -- 0:00:12
791500 -- (-368.169) [-368.842] (-364.997) (-368.233) * (-365.416) [-368.842] (-366.872) (-370.579) -- 0:00:12
792000 -- (-366.658) (-367.403) (-364.863) [-367.445] * [-367.732] (-371.711) (-366.167) (-370.724) -- 0:00:12
792500 -- [-367.455] (-369.956) (-366.449) (-378.774) * [-369.942] (-368.871) (-371.410) (-367.836) -- 0:00:12
793000 -- (-366.598) (-367.162) (-371.597) [-366.126] * [-366.852] (-365.788) (-367.565) (-365.746) -- 0:00:12
793500 -- (-368.368) (-373.004) (-369.831) [-365.421] * (-368.219) [-372.470] (-366.211) (-364.574) -- 0:00:12
794000 -- (-369.848) (-365.598) [-370.400] (-365.472) * (-366.788) (-367.297) (-365.863) [-366.548] -- 0:00:12
794500 -- (-369.681) (-369.729) (-369.898) [-366.741] * (-366.759) (-367.676) [-367.299] (-371.058) -- 0:00:12
795000 -- (-370.117) [-365.238] (-366.436) (-368.357) * (-365.515) [-368.843] (-365.515) (-365.303) -- 0:00:12
Average standard deviation of split frequencies: 0.012053
795500 -- (-367.944) [-367.074] (-365.351) (-366.771) * [-364.781] (-369.691) (-366.487) (-365.911) -- 0:00:12
796000 -- (-367.093) [-367.992] (-366.875) (-368.717) * [-365.178] (-365.623) (-366.883) (-368.124) -- 0:00:12
796500 -- (-368.905) (-369.118) (-367.064) [-367.443] * (-364.886) (-366.968) (-366.831) [-368.089] -- 0:00:12
797000 -- (-370.577) (-369.762) [-366.491] (-368.583) * (-366.084) (-366.128) (-372.260) [-366.408] -- 0:00:11
797500 -- (-367.803) (-370.812) [-364.819] (-365.119) * (-366.338) (-365.462) (-370.159) [-365.342] -- 0:00:11
798000 -- (-368.180) (-370.579) [-364.833] (-365.766) * [-367.723] (-365.662) (-366.881) (-364.877) -- 0:00:11
798500 -- [-367.419] (-367.486) (-365.931) (-366.981) * (-366.678) (-365.997) (-366.999) [-366.519] -- 0:00:11
799000 -- (-369.031) (-367.801) (-368.197) [-369.915] * [-364.813] (-366.953) (-366.182) (-368.705) -- 0:00:11
799500 -- [-365.542] (-366.111) (-366.678) (-364.418) * (-365.266) [-367.441] (-366.465) (-366.893) -- 0:00:11
800000 -- (-369.043) (-364.757) [-367.344] (-365.584) * [-367.724] (-369.139) (-368.591) (-366.286) -- 0:00:11
Average standard deviation of split frequencies: 0.012329
800500 -- (-367.191) (-364.995) [-369.497] (-364.723) * (-367.016) (-366.099) [-368.489] (-367.564) -- 0:00:11
801000 -- (-364.739) (-366.794) (-365.725) [-365.721] * (-366.717) (-364.572) (-367.315) [-365.358] -- 0:00:11
801500 -- (-365.711) (-367.532) [-367.004] (-375.421) * (-366.750) (-367.853) (-368.236) [-366.903] -- 0:00:11
802000 -- (-368.471) (-366.307) [-366.727] (-369.496) * (-367.475) (-366.073) (-365.969) [-366.209] -- 0:00:11
802500 -- (-368.767) (-366.406) (-367.855) [-367.637] * (-367.315) (-369.790) (-370.749) [-368.587] -- 0:00:11
803000 -- (-367.046) (-368.761) [-367.001] (-368.725) * (-366.941) (-366.182) (-368.051) [-364.791] -- 0:00:11
803500 -- (-370.000) [-370.002] (-369.698) (-369.769) * (-367.132) (-368.864) (-366.116) [-365.952] -- 0:00:11
804000 -- (-370.260) [-367.328] (-367.826) (-365.167) * [-366.477] (-365.570) (-365.987) (-367.274) -- 0:00:11
804500 -- (-364.947) (-367.708) (-369.429) [-368.371] * [-366.839] (-365.956) (-368.614) (-370.052) -- 0:00:11
805000 -- [-366.557] (-364.830) (-365.376) (-367.771) * [-364.676] (-367.253) (-365.587) (-364.857) -- 0:00:11
Average standard deviation of split frequencies: 0.012902
805500 -- [-365.759] (-367.665) (-369.818) (-367.984) * (-366.406) (-368.963) (-365.188) [-366.616] -- 0:00:11
806000 -- (-371.593) [-367.667] (-372.062) (-373.336) * (-368.132) (-368.357) (-365.714) [-365.094] -- 0:00:11
806500 -- [-369.054] (-366.254) (-366.448) (-368.281) * (-366.445) [-366.097] (-370.445) (-367.879) -- 0:00:11
807000 -- (-366.540) (-364.855) (-366.150) [-368.747] * (-365.185) [-367.946] (-368.143) (-365.846) -- 0:00:11
807500 -- [-366.270] (-366.072) (-366.955) (-366.104) * (-365.839) (-364.769) [-365.763] (-366.059) -- 0:00:11
808000 -- [-368.993] (-368.984) (-366.317) (-367.098) * [-369.864] (-366.818) (-364.943) (-364.551) -- 0:00:11
808500 -- (-367.592) (-372.175) (-369.214) [-369.815] * (-364.848) (-367.124) (-366.940) [-367.044] -- 0:00:11
809000 -- (-370.148) (-367.677) (-367.369) [-368.188] * [-365.165] (-369.563) (-365.177) (-366.800) -- 0:00:11
809500 -- (-369.396) (-366.315) (-365.483) [-365.125] * (-367.051) [-371.155] (-366.559) (-366.271) -- 0:00:11
810000 -- (-370.980) (-366.702) [-368.930] (-365.127) * (-368.377) [-366.570] (-367.314) (-368.819) -- 0:00:11
Average standard deviation of split frequencies: 0.013340
810500 -- (-366.102) [-365.529] (-367.210) (-366.234) * (-364.582) [-365.383] (-366.886) (-366.970) -- 0:00:11
811000 -- [-367.187] (-365.178) (-367.649) (-371.986) * (-366.281) (-366.627) (-368.633) [-367.017] -- 0:00:11
811500 -- (-368.108) (-366.157) (-367.036) [-364.649] * [-365.245] (-368.493) (-368.072) (-375.017) -- 0:00:11
812000 -- (-367.455) (-367.401) (-364.808) [-364.915] * (-365.437) (-366.188) [-366.975] (-368.005) -- 0:00:11
812500 -- (-366.569) [-367.658] (-366.239) (-368.263) * (-372.377) (-365.685) [-368.651] (-367.587) -- 0:00:11
813000 -- (-366.470) [-366.357] (-368.594) (-365.340) * (-369.842) (-367.222) (-365.831) [-366.527] -- 0:00:11
813500 -- (-369.069) (-365.858) [-367.112] (-369.273) * [-371.088] (-364.894) (-367.449) (-366.333) -- 0:00:11
814000 -- (-370.061) (-370.279) (-368.589) [-365.847] * (-368.532) (-365.422) [-366.093] (-366.189) -- 0:00:10
814500 -- (-374.120) [-370.834] (-367.104) (-369.819) * (-365.840) [-369.141] (-370.646) (-365.093) -- 0:00:10
815000 -- (-371.228) (-366.194) (-368.731) [-370.666] * (-369.707) [-365.631] (-369.868) (-366.702) -- 0:00:10
Average standard deviation of split frequencies: 0.013185
815500 -- (-366.459) (-365.238) [-366.451] (-367.451) * [-365.721] (-368.563) (-368.651) (-366.886) -- 0:00:10
816000 -- (-371.022) (-367.714) [-366.467] (-366.755) * (-364.980) (-371.448) [-366.443] (-366.707) -- 0:00:10
816500 -- (-368.614) [-366.916] (-366.117) (-367.079) * (-366.136) (-366.586) [-368.007] (-371.317) -- 0:00:10
817000 -- (-367.216) (-370.156) (-369.415) [-367.993] * [-369.063] (-367.724) (-370.803) (-365.548) -- 0:00:10
817500 -- (-373.086) (-365.133) [-366.902] (-366.478) * (-365.517) [-369.398] (-367.699) (-365.569) -- 0:00:10
818000 -- [-368.839] (-366.124) (-365.236) (-368.948) * (-366.050) [-367.513] (-366.133) (-366.241) -- 0:00:10
818500 -- [-365.787] (-365.715) (-365.266) (-367.062) * [-365.564] (-364.851) (-364.450) (-367.178) -- 0:00:10
819000 -- (-365.699) [-368.116] (-366.157) (-367.953) * (-366.298) (-365.537) (-366.653) [-368.076] -- 0:00:10
819500 -- (-367.519) (-366.317) (-364.941) [-368.053] * [-366.553] (-365.568) (-368.111) (-370.368) -- 0:00:10
820000 -- (-366.110) (-367.695) (-367.586) [-370.093] * (-364.980) (-366.299) (-369.069) [-368.994] -- 0:00:10
Average standard deviation of split frequencies: 0.013144
820500 -- [-365.487] (-366.361) (-365.287) (-368.333) * [-365.456] (-366.538) (-367.003) (-367.101) -- 0:00:10
821000 -- (-365.032) (-365.776) (-365.572) [-368.478] * (-365.730) [-367.446] (-367.770) (-372.279) -- 0:00:10
821500 -- (-367.549) [-365.935] (-367.147) (-368.543) * (-364.574) (-367.772) [-369.796] (-368.527) -- 0:00:10
822000 -- (-366.497) (-365.097) [-366.403] (-367.855) * (-368.568) (-365.663) [-365.896] (-370.361) -- 0:00:10
822500 -- (-368.077) [-367.223] (-367.008) (-369.601) * (-366.454) (-366.668) [-365.218] (-370.519) -- 0:00:10
823000 -- (-371.276) [-367.093] (-365.985) (-367.998) * (-364.704) (-368.144) (-365.458) [-365.931] -- 0:00:10
823500 -- (-367.747) (-366.997) (-367.693) [-365.515] * (-365.888) (-369.351) [-367.882] (-367.483) -- 0:00:10
824000 -- [-367.583] (-371.761) (-366.178) (-366.941) * (-369.413) (-371.810) (-369.165) [-367.307] -- 0:00:10
824500 -- (-369.478) (-370.661) [-368.657] (-366.661) * (-365.427) [-366.742] (-366.118) (-367.256) -- 0:00:10
825000 -- (-369.951) [-369.152] (-367.754) (-368.519) * [-365.891] (-370.114) (-365.287) (-367.277) -- 0:00:10
Average standard deviation of split frequencies: 0.013529
825500 -- [-365.429] (-370.340) (-364.502) (-365.894) * (-372.490) (-365.667) (-367.252) [-368.243] -- 0:00:10
826000 -- (-366.142) (-365.934) (-368.679) [-367.540] * (-365.925) (-367.129) [-365.444] (-366.641) -- 0:00:10
826500 -- (-366.578) [-369.522] (-366.325) (-365.518) * [-365.795] (-369.071) (-367.795) (-366.102) -- 0:00:10
827000 -- [-367.069] (-365.921) (-367.177) (-365.501) * (-366.073) [-368.351] (-365.016) (-367.831) -- 0:00:10
827500 -- (-367.028) (-365.625) [-366.141] (-366.015) * [-365.942] (-369.021) (-367.714) (-367.332) -- 0:00:10
828000 -- (-366.558) [-365.131] (-368.823) (-366.318) * [-366.999] (-368.811) (-365.351) (-367.982) -- 0:00:10
828500 -- (-367.774) [-365.377] (-365.361) (-368.453) * (-364.715) (-369.498) [-364.840] (-368.116) -- 0:00:10
829000 -- (-367.308) (-365.472) [-365.931] (-366.932) * (-364.715) [-370.695] (-365.319) (-366.266) -- 0:00:10
829500 -- (-366.882) (-368.046) (-367.491) [-366.520] * [-374.882] (-370.427) (-366.678) (-366.687) -- 0:00:10
830000 -- (-367.076) (-367.894) [-367.679] (-365.620) * (-364.659) (-365.727) [-366.664] (-369.878) -- 0:00:10
Average standard deviation of split frequencies: 0.013086
830500 -- (-365.531) (-369.878) (-367.978) [-365.981] * (-365.732) [-365.369] (-366.290) (-372.313) -- 0:00:10
831000 -- (-366.783) (-366.040) (-370.592) [-367.015] * (-366.595) (-365.002) (-365.591) [-370.578] -- 0:00:09
831500 -- [-366.677] (-374.153) (-366.158) (-365.664) * (-368.802) (-365.123) (-365.176) [-367.198] -- 0:00:09
832000 -- (-365.717) (-367.969) (-368.123) [-365.776] * (-366.656) (-365.891) (-367.747) [-367.845] -- 0:00:09
832500 -- (-366.487) (-364.866) (-369.817) [-367.674] * [-365.949] (-365.722) (-366.625) (-368.084) -- 0:00:09
833000 -- [-367.518] (-364.680) (-365.677) (-366.918) * (-368.507) [-367.588] (-367.770) (-366.054) -- 0:00:09
833500 -- [-373.198] (-365.516) (-366.820) (-365.378) * [-366.360] (-367.130) (-368.799) (-366.958) -- 0:00:09
834000 -- (-367.982) (-365.843) [-367.114] (-365.372) * (-374.183) (-366.921) [-365.442] (-367.884) -- 0:00:09
834500 -- (-367.161) (-368.706) [-367.960] (-366.863) * (-368.378) (-366.781) (-365.169) [-366.746] -- 0:00:09
835000 -- (-364.752) (-367.679) (-366.224) [-365.918] * (-366.986) [-366.781] (-366.505) (-366.956) -- 0:00:09
Average standard deviation of split frequencies: 0.013002
835500 -- (-367.343) [-368.926] (-367.488) (-370.438) * (-367.874) [-367.173] (-369.126) (-365.967) -- 0:00:09
836000 -- (-366.425) [-365.160] (-365.244) (-366.557) * (-366.420) (-366.878) (-365.238) [-366.198] -- 0:00:09
836500 -- [-367.588] (-366.640) (-365.827) (-368.559) * (-366.897) (-367.885) (-370.124) [-373.360] -- 0:00:09
837000 -- (-367.604) (-364.552) [-368.450] (-365.272) * (-364.958) (-367.146) (-372.315) [-367.967] -- 0:00:09
837500 -- (-370.929) (-367.334) (-366.990) [-366.001] * (-364.785) (-367.999) [-366.758] (-366.704) -- 0:00:09
838000 -- (-364.801) (-365.888) [-370.770] (-366.714) * (-365.985) [-367.198] (-367.047) (-369.126) -- 0:00:09
838500 -- (-366.072) (-368.766) (-371.206) [-365.331] * (-370.095) (-366.508) (-366.810) [-367.128] -- 0:00:09
839000 -- (-367.482) [-365.539] (-367.753) (-365.177) * (-367.187) (-366.191) [-367.821] (-366.947) -- 0:00:09
839500 -- (-367.110) [-367.008] (-368.076) (-364.450) * (-366.642) [-373.659] (-366.440) (-367.470) -- 0:00:09
840000 -- (-369.855) [-365.636] (-367.566) (-366.613) * (-366.829) [-369.284] (-366.666) (-366.582) -- 0:00:09
Average standard deviation of split frequencies: 0.013128
840500 -- (-366.164) (-367.908) (-367.526) [-366.498] * (-366.279) (-368.571) (-368.302) [-367.008] -- 0:00:09
841000 -- (-365.315) (-368.278) (-365.955) [-367.355] * (-366.174) [-365.187] (-369.299) (-368.668) -- 0:00:09
841500 -- (-366.579) (-369.766) (-368.342) [-368.241] * (-368.344) [-366.255] (-369.096) (-365.129) -- 0:00:09
842000 -- (-368.590) [-366.978] (-366.086) (-369.819) * (-366.819) (-369.923) (-367.125) [-365.534] -- 0:00:09
842500 -- [-367.726] (-369.780) (-366.937) (-375.321) * (-365.971) (-367.717) (-369.786) [-367.446] -- 0:00:09
843000 -- (-368.869) (-366.666) [-364.666] (-370.857) * (-366.985) [-366.272] (-367.101) (-366.423) -- 0:00:09
843500 -- [-366.940] (-369.132) (-364.721) (-367.136) * (-368.393) (-369.009) (-366.273) [-370.018] -- 0:00:09
844000 -- (-369.017) [-364.983] (-365.577) (-372.535) * (-368.688) [-369.044] (-366.004) (-367.262) -- 0:00:09
844500 -- [-369.184] (-366.631) (-367.052) (-365.700) * [-368.483] (-371.863) (-377.034) (-373.056) -- 0:00:09
845000 -- (-366.162) (-365.728) [-368.252] (-366.688) * (-366.997) (-370.042) (-376.166) [-367.641] -- 0:00:09
Average standard deviation of split frequencies: 0.012882
845500 -- [-366.123] (-365.602) (-366.907) (-365.908) * (-367.220) [-366.899] (-376.302) (-375.866) -- 0:00:09
846000 -- [-367.554] (-368.840) (-372.272) (-366.419) * (-365.591) [-366.705] (-367.782) (-368.150) -- 0:00:09
846500 -- (-366.304) [-365.108] (-365.810) (-366.645) * [-366.598] (-367.098) (-366.157) (-365.507) -- 0:00:09
847000 -- (-366.462) (-365.111) (-365.590) [-366.710] * [-373.413] (-366.643) (-365.368) (-368.736) -- 0:00:09
847500 -- [-367.898] (-364.656) (-365.151) (-367.706) * (-368.303) (-367.292) [-366.468] (-369.702) -- 0:00:08
848000 -- [-365.766] (-366.459) (-366.589) (-369.571) * (-368.788) (-367.685) [-364.607] (-366.971) -- 0:00:08
848500 -- (-372.824) (-367.340) (-364.877) [-367.545] * (-369.881) [-365.686] (-367.860) (-368.880) -- 0:00:08
849000 -- [-365.269] (-367.212) (-364.836) (-365.910) * [-367.810] (-370.349) (-365.480) (-366.552) -- 0:00:08
849500 -- (-365.439) [-365.877] (-371.691) (-367.444) * [-366.582] (-365.727) (-366.639) (-367.007) -- 0:00:08
850000 -- (-367.358) (-367.327) (-367.209) [-367.197] * (-370.211) [-365.814] (-366.553) (-367.196) -- 0:00:08
Average standard deviation of split frequencies: 0.012843
850500 -- [-369.769] (-367.260) (-368.577) (-366.159) * (-366.590) (-367.051) (-368.080) [-365.703] -- 0:00:08
851000 -- (-371.706) (-369.022) [-367.713] (-369.863) * (-366.621) (-366.347) (-366.676) [-369.629] -- 0:00:08
851500 -- (-370.644) (-365.701) [-366.776] (-370.131) * (-366.158) (-364.757) [-365.988] (-364.705) -- 0:00:08
852000 -- (-366.161) (-365.940) (-365.965) [-369.732] * (-367.738) (-365.768) (-367.711) [-365.884] -- 0:00:08
852500 -- (-366.423) [-365.145] (-368.910) (-369.512) * (-368.910) (-368.680) [-369.244] (-369.243) -- 0:00:08
853000 -- (-366.819) (-365.964) [-368.249] (-368.604) * (-373.284) [-365.861] (-369.952) (-370.081) -- 0:00:08
853500 -- [-367.409] (-367.725) (-368.815) (-370.161) * [-367.679] (-366.129) (-373.318) (-365.758) -- 0:00:08
854000 -- [-367.481] (-364.584) (-371.178) (-367.821) * [-369.497] (-365.485) (-366.800) (-367.024) -- 0:00:08
854500 -- (-368.169) (-364.654) [-368.223] (-367.737) * [-366.810] (-365.820) (-368.088) (-367.150) -- 0:00:08
855000 -- (-367.604) [-365.161] (-366.813) (-367.243) * (-369.988) (-367.118) (-371.404) [-366.536] -- 0:00:08
Average standard deviation of split frequencies: 0.013120
855500 -- [-370.301] (-365.012) (-367.733) (-366.771) * [-366.885] (-369.454) (-365.666) (-367.567) -- 0:00:08
856000 -- (-371.690) (-364.616) [-364.741] (-366.767) * [-366.798] (-365.197) (-367.599) (-368.639) -- 0:00:08
856500 -- (-368.260) (-368.808) [-368.004] (-367.972) * (-365.021) [-368.444] (-366.830) (-369.114) -- 0:00:08
857000 -- (-366.139) (-365.496) [-369.125] (-367.910) * (-365.708) (-366.995) [-365.553] (-367.203) -- 0:00:08
857500 -- (-367.015) (-365.660) [-364.902] (-369.317) * [-367.049] (-367.490) (-366.451) (-364.644) -- 0:00:08
858000 -- (-364.924) (-368.897) [-366.553] (-366.169) * (-365.643) [-366.166] (-366.985) (-365.225) -- 0:00:08
858500 -- (-365.680) (-365.079) (-365.137) [-365.616] * (-366.639) (-365.291) [-371.820] (-365.235) -- 0:00:08
859000 -- (-365.602) (-368.252) [-365.840] (-366.684) * (-367.007) [-367.944] (-366.869) (-365.887) -- 0:00:08
859500 -- (-369.543) (-364.991) [-368.980] (-366.857) * (-370.206) [-366.312] (-367.909) (-364.621) -- 0:00:08
860000 -- (-366.605) [-364.838] (-374.211) (-368.987) * [-368.482] (-367.866) (-367.329) (-365.363) -- 0:00:08
Average standard deviation of split frequencies: 0.013113
860500 -- (-365.585) (-365.788) (-365.367) [-369.980] * [-368.398] (-367.355) (-367.214) (-365.899) -- 0:00:08
861000 -- (-365.576) (-365.611) [-365.637] (-371.912) * (-368.752) (-370.375) [-366.161] (-366.771) -- 0:00:08
861500 -- (-366.632) (-365.042) [-367.200] (-365.397) * (-367.054) (-367.956) (-369.334) [-366.000] -- 0:00:08
862000 -- (-369.296) (-368.552) (-366.904) [-365.967] * (-364.366) (-367.547) [-369.976] (-365.292) -- 0:00:08
862500 -- (-369.319) [-365.076] (-366.810) (-366.612) * [-366.645] (-368.310) (-368.663) (-366.538) -- 0:00:08
863000 -- [-368.261] (-365.097) (-369.672) (-369.886) * (-365.772) (-365.695) (-365.912) [-366.485] -- 0:00:08
863500 -- (-365.199) (-364.446) (-371.865) [-366.637] * (-366.316) (-368.604) [-368.713] (-368.070) -- 0:00:08
864000 -- [-364.714] (-365.345) (-365.425) (-370.103) * (-366.854) (-367.075) [-368.647] (-364.771) -- 0:00:08
864500 -- (-369.105) (-365.688) [-365.969] (-364.952) * (-367.405) (-368.330) [-368.287] (-365.793) -- 0:00:07
865000 -- [-367.787] (-365.007) (-368.437) (-366.445) * (-365.444) [-366.327] (-372.268) (-367.765) -- 0:00:07
Average standard deviation of split frequencies: 0.013000
865500 -- (-365.908) [-365.469] (-366.885) (-371.626) * (-366.271) (-366.934) (-367.496) [-364.996] -- 0:00:07
866000 -- [-365.127] (-368.074) (-367.934) (-368.579) * (-367.868) (-368.011) (-369.762) [-367.418] -- 0:00:07
866500 -- (-366.991) [-368.051] (-365.988) (-366.345) * (-368.504) (-368.823) [-367.756] (-364.826) -- 0:00:07
867000 -- (-369.199) [-365.348] (-365.991) (-366.842) * [-366.873] (-368.901) (-365.185) (-365.033) -- 0:00:07
867500 -- [-367.138] (-366.270) (-371.001) (-368.952) * [-370.722] (-365.665) (-368.129) (-369.492) -- 0:00:07
868000 -- [-366.821] (-365.580) (-370.558) (-371.195) * (-369.857) [-366.108] (-367.210) (-370.635) -- 0:00:07
868500 -- (-366.956) [-365.754] (-369.555) (-366.111) * [-366.469] (-365.123) (-364.947) (-365.902) -- 0:00:07
869000 -- (-368.881) [-365.361] (-368.381) (-369.499) * [-367.989] (-366.735) (-364.360) (-367.843) -- 0:00:07
869500 -- (-370.940) [-365.223] (-368.604) (-366.508) * [-368.068] (-366.986) (-365.938) (-366.539) -- 0:00:07
870000 -- (-365.743) (-364.742) [-366.786] (-367.678) * (-367.527) (-367.126) (-365.855) [-368.511] -- 0:00:07
Average standard deviation of split frequencies: 0.012899
870500 -- (-367.487) (-365.872) [-365.310] (-366.591) * (-366.606) [-368.863] (-366.449) (-366.924) -- 0:00:07
871000 -- [-367.444] (-364.596) (-365.094) (-369.241) * (-367.833) (-366.711) (-365.158) [-367.981] -- 0:00:07
871500 -- (-369.040) [-366.844] (-366.637) (-375.471) * (-366.141) [-367.308] (-366.646) (-367.778) -- 0:00:07
872000 -- (-369.429) (-374.242) (-367.380) [-368.764] * (-365.133) (-365.617) [-367.480] (-366.197) -- 0:00:07
872500 -- (-370.372) (-368.200) (-366.681) [-368.506] * [-368.038] (-365.300) (-365.911) (-367.785) -- 0:00:07
873000 -- [-367.226] (-366.853) (-367.340) (-366.131) * (-364.921) (-365.448) [-366.102] (-367.019) -- 0:00:07
873500 -- (-367.511) [-367.351] (-367.730) (-365.423) * (-365.921) (-365.538) [-366.233] (-365.736) -- 0:00:07
874000 -- [-366.988] (-370.997) (-368.007) (-367.044) * [-366.633] (-365.664) (-366.289) (-368.834) -- 0:00:07
874500 -- (-366.106) (-366.856) [-364.761] (-367.911) * (-370.705) (-367.554) [-365.993] (-369.765) -- 0:00:07
875000 -- (-365.113) (-366.022) [-365.091] (-367.090) * (-371.408) (-364.999) [-365.829] (-371.135) -- 0:00:07
Average standard deviation of split frequencies: 0.012567
875500 -- [-365.571] (-364.395) (-365.251) (-366.243) * (-366.373) [-365.066] (-369.348) (-365.832) -- 0:00:07
876000 -- (-367.680) (-364.731) [-365.838] (-365.321) * (-366.999) (-368.238) (-368.385) [-364.745] -- 0:00:07
876500 -- (-368.331) (-365.351) (-367.002) [-364.937] * (-365.965) (-367.917) (-366.982) [-364.691] -- 0:00:07
877000 -- [-365.820] (-368.327) (-366.743) (-367.228) * (-368.097) [-370.164] (-370.859) (-367.722) -- 0:00:07
877500 -- (-367.301) (-370.583) (-366.673) [-364.950] * (-369.647) (-365.832) (-366.181) [-365.895] -- 0:00:07
878000 -- (-368.246) (-368.241) [-366.134] (-365.705) * [-366.866] (-369.194) (-366.341) (-371.136) -- 0:00:07
878500 -- (-371.408) [-368.757] (-368.647) (-365.781) * [-366.871] (-366.848) (-369.910) (-366.416) -- 0:00:07
879000 -- [-374.706] (-369.125) (-369.678) (-367.109) * [-365.870] (-368.304) (-371.526) (-366.323) -- 0:00:07
879500 -- (-369.053) (-368.254) [-365.937] (-368.602) * [-368.437] (-364.707) (-368.592) (-366.209) -- 0:00:07
880000 -- [-367.841] (-371.711) (-370.422) (-365.853) * [-366.292] (-365.172) (-370.984) (-367.411) -- 0:00:07
Average standard deviation of split frequencies: 0.012091
880500 -- [-366.067] (-368.230) (-368.047) (-366.411) * [-365.159] (-365.191) (-369.866) (-368.110) -- 0:00:07
881000 -- (-366.340) (-366.964) [-366.658] (-365.978) * (-365.019) (-369.625) (-374.397) [-368.168] -- 0:00:07
881500 -- (-365.964) (-365.280) [-366.546] (-368.779) * (-374.591) (-366.161) [-365.750] (-368.787) -- 0:00:06
882000 -- (-365.958) (-365.497) [-367.845] (-367.663) * (-367.823) (-364.927) (-369.573) [-367.291] -- 0:00:06
882500 -- (-367.096) (-369.593) (-364.719) [-369.749] * (-367.434) (-364.927) (-365.297) [-368.416] -- 0:00:06
883000 -- [-371.580] (-366.153) (-368.874) (-367.424) * (-369.850) [-365.344] (-365.386) (-370.425) -- 0:00:06
883500 -- (-374.146) (-368.253) (-365.759) [-367.262] * (-367.450) (-366.158) (-368.364) [-371.899] -- 0:00:06
884000 -- (-366.406) [-367.584] (-365.726) (-370.956) * [-365.995] (-365.111) (-366.324) (-366.004) -- 0:00:06
884500 -- (-366.061) [-364.918] (-366.689) (-367.172) * [-364.933] (-370.607) (-365.276) (-365.372) -- 0:00:06
885000 -- (-368.577) (-366.766) (-371.195) [-366.476] * [-365.141] (-370.512) (-368.866) (-365.918) -- 0:00:06
Average standard deviation of split frequencies: 0.011830
885500 -- [-370.444] (-366.815) (-372.255) (-365.377) * [-365.300] (-367.629) (-373.277) (-370.039) -- 0:00:06
886000 -- (-367.529) (-367.771) [-372.437] (-366.982) * (-365.057) (-369.497) (-365.541) [-365.774] -- 0:00:06
886500 -- [-366.050] (-366.465) (-367.519) (-366.062) * (-373.577) [-368.381] (-365.158) (-367.867) -- 0:00:06
887000 -- (-366.422) (-368.855) (-365.675) [-365.484] * [-371.552] (-367.792) (-368.685) (-366.621) -- 0:00:06
887500 -- (-367.777) (-365.447) (-366.280) [-365.769] * (-366.729) (-367.898) [-365.418] (-371.607) -- 0:00:06
888000 -- (-366.818) (-365.498) (-366.186) [-367.113] * (-371.696) (-368.399) [-364.957] (-369.104) -- 0:00:06
888500 -- [-365.927] (-368.752) (-366.396) (-365.226) * (-366.724) (-367.191) (-366.980) [-365.373] -- 0:00:06
889000 -- (-369.478) (-365.557) (-364.391) [-364.956] * (-365.348) (-368.154) (-367.423) [-366.010] -- 0:00:06
889500 -- (-368.755) [-365.291] (-368.080) (-365.046) * (-366.603) (-368.447) [-365.910] (-369.055) -- 0:00:06
890000 -- (-368.860) [-367.106] (-367.928) (-367.622) * [-370.484] (-369.031) (-368.089) (-369.139) -- 0:00:06
Average standard deviation of split frequencies: 0.012329
890500 -- (-369.300) [-365.781] (-366.895) (-369.320) * (-368.273) (-369.045) (-367.718) [-367.776] -- 0:00:06
891000 -- (-368.776) (-365.286) (-365.222) [-369.848] * [-364.999] (-368.175) (-367.875) (-365.360) -- 0:00:06
891500 -- (-365.945) [-364.606] (-365.680) (-367.335) * [-367.856] (-369.810) (-366.141) (-366.762) -- 0:00:06
892000 -- (-366.419) [-366.374] (-367.106) (-373.483) * (-365.001) (-370.636) [-366.899] (-368.754) -- 0:00:06
892500 -- (-369.056) (-369.793) [-364.972] (-369.114) * (-367.052) (-371.440) (-365.168) [-366.052] -- 0:00:06
893000 -- (-366.158) (-365.646) [-366.217] (-371.972) * [-367.638] (-368.942) (-366.474) (-370.436) -- 0:00:06
893500 -- (-367.319) (-367.146) (-367.880) [-367.720] * (-366.989) [-366.579] (-366.577) (-365.699) -- 0:00:06
894000 -- [-365.700] (-366.227) (-366.082) (-366.838) * (-364.717) (-366.154) (-369.718) [-368.279] -- 0:00:06
894500 -- (-366.113) (-366.985) [-365.439] (-366.227) * (-371.747) [-366.354] (-367.135) (-367.362) -- 0:00:06
895000 -- (-367.389) [-366.215] (-366.663) (-365.589) * [-367.998] (-367.631) (-365.910) (-368.283) -- 0:00:06
Average standard deviation of split frequencies: 0.012441
895500 -- [-365.945] (-366.890) (-366.251) (-367.075) * [-366.727] (-370.950) (-366.855) (-367.308) -- 0:00:06
896000 -- (-367.824) (-368.259) [-364.539] (-367.083) * [-365.385] (-369.238) (-365.432) (-368.041) -- 0:00:06
896500 -- [-367.053] (-366.881) (-365.393) (-366.500) * [-368.514] (-366.251) (-366.370) (-366.830) -- 0:00:06
897000 -- (-365.322) (-366.346) (-367.063) [-366.986] * [-367.596] (-365.515) (-365.895) (-367.335) -- 0:00:06
897500 -- [-367.718] (-365.232) (-371.148) (-368.253) * [-367.020] (-367.848) (-364.526) (-369.697) -- 0:00:06
898000 -- (-366.711) (-365.511) [-368.738] (-367.890) * (-367.572) (-367.394) [-366.108] (-369.002) -- 0:00:06
898500 -- (-366.433) (-366.222) [-368.348] (-368.560) * [-364.693] (-370.209) (-365.756) (-367.174) -- 0:00:05
899000 -- (-365.636) (-369.035) [-365.445] (-368.353) * [-367.585] (-368.653) (-365.140) (-366.931) -- 0:00:05
899500 -- (-366.190) (-365.838) [-364.919] (-368.528) * [-366.107] (-364.640) (-369.637) (-367.500) -- 0:00:05
900000 -- [-366.775] (-366.718) (-367.918) (-365.989) * (-366.008) (-365.960) (-367.183) [-369.884] -- 0:00:05
Average standard deviation of split frequencies: 0.012284
900500 -- [-371.453] (-367.494) (-366.473) (-368.339) * (-368.626) (-369.128) [-368.173] (-366.722) -- 0:00:05
901000 -- (-366.387) [-368.603] (-365.568) (-366.454) * [-369.291] (-369.765) (-365.529) (-367.410) -- 0:00:05
901500 -- (-367.914) [-367.434] (-365.862) (-365.132) * [-366.415] (-370.108) (-368.917) (-365.856) -- 0:00:05
902000 -- (-368.924) [-365.639] (-367.123) (-366.888) * (-365.756) (-369.793) [-365.248] (-365.691) -- 0:00:05
902500 -- (-364.776) (-365.072) [-367.342] (-369.838) * [-369.497] (-366.933) (-366.018) (-371.954) -- 0:00:05
903000 -- (-366.581) [-367.409] (-367.089) (-365.164) * (-365.130) (-365.824) (-365.242) [-368.118] -- 0:00:05
903500 -- (-365.804) [-365.844] (-367.873) (-365.244) * (-365.348) (-366.293) [-365.848] (-365.278) -- 0:00:05
904000 -- (-366.118) [-368.501] (-366.961) (-364.743) * (-367.066) (-367.865) [-366.601] (-366.489) -- 0:00:05
904500 -- [-365.745] (-367.602) (-367.231) (-366.023) * (-365.758) [-367.589] (-364.933) (-368.981) -- 0:00:05
905000 -- (-366.361) (-365.632) [-366.562] (-367.965) * [-368.076] (-367.046) (-367.250) (-374.417) -- 0:00:05
Average standard deviation of split frequencies: 0.012059
905500 -- (-368.581) (-368.339) (-367.558) [-366.466] * [-368.532] (-370.484) (-368.377) (-366.317) -- 0:00:05
906000 -- (-366.930) (-367.973) [-367.899] (-369.049) * (-369.527) [-368.063] (-369.852) (-365.410) -- 0:00:05
906500 -- (-364.925) [-364.854] (-365.278) (-366.606) * (-367.925) [-368.397] (-369.898) (-366.006) -- 0:00:05
907000 -- (-368.190) [-366.177] (-367.899) (-367.511) * [-366.067] (-366.002) (-370.396) (-365.839) -- 0:00:05
907500 -- (-367.122) (-366.006) (-366.012) [-365.798] * (-367.916) (-366.605) [-368.323] (-366.416) -- 0:00:05
908000 -- (-364.422) [-367.364] (-367.079) (-366.024) * (-366.602) (-366.028) (-366.483) [-365.511] -- 0:00:05
908500 -- [-366.164] (-365.303) (-365.048) (-367.767) * (-367.953) (-366.233) (-366.114) [-365.816] -- 0:00:05
909000 -- (-367.973) (-366.406) [-364.961] (-370.899) * [-367.236] (-365.172) (-368.756) (-366.665) -- 0:00:05
909500 -- (-366.037) (-365.794) [-364.792] (-365.396) * (-368.845) [-365.817] (-367.687) (-367.389) -- 0:00:05
910000 -- [-366.119] (-369.928) (-367.882) (-367.232) * [-364.904] (-366.014) (-365.885) (-367.123) -- 0:00:05
Average standard deviation of split frequencies: 0.011874
910500 -- (-365.222) (-367.528) [-368.723] (-366.705) * [-364.486] (-365.546) (-365.038) (-365.988) -- 0:00:05
911000 -- (-365.536) (-366.369) [-365.441] (-366.851) * (-368.328) (-369.765) [-364.897] (-369.053) -- 0:00:05
911500 -- (-365.675) [-364.623] (-368.276) (-364.961) * (-375.204) (-365.978) [-364.979] (-366.156) -- 0:00:05
912000 -- (-366.510) (-366.316) (-366.879) [-372.002] * (-368.269) (-369.170) (-369.833) [-370.592] -- 0:00:05
912500 -- (-365.544) (-368.040) [-365.034] (-366.622) * (-367.173) [-366.871] (-370.021) (-367.302) -- 0:00:05
913000 -- (-366.312) (-369.189) (-365.835) [-369.264] * (-366.699) (-365.608) (-371.962) [-364.689] -- 0:00:05
913500 -- (-366.059) (-370.875) (-365.332) [-371.690] * (-365.023) (-366.622) (-366.351) [-366.530] -- 0:00:05
914000 -- (-365.361) (-365.314) [-370.665] (-366.621) * (-367.352) (-372.192) [-367.604] (-365.426) -- 0:00:05
914500 -- (-366.354) [-367.146] (-369.608) (-365.633) * (-366.810) (-366.660) (-366.957) [-365.785] -- 0:00:05
915000 -- [-368.215] (-365.433) (-372.014) (-366.132) * (-370.527) (-367.809) [-365.672] (-367.543) -- 0:00:05
Average standard deviation of split frequencies: 0.012321
915500 -- (-366.301) [-364.763] (-368.492) (-364.677) * (-368.831) (-367.934) (-367.785) [-365.371] -- 0:00:04
916000 -- (-366.473) (-364.955) [-365.887] (-366.239) * (-367.752) (-367.329) [-367.941] (-366.673) -- 0:00:04
916500 -- (-365.754) (-367.197) [-365.040] (-371.073) * (-369.491) (-368.450) (-366.387) [-366.368] -- 0:00:04
917000 -- [-364.846] (-367.686) (-368.518) (-366.921) * [-367.388] (-366.472) (-369.150) (-365.681) -- 0:00:04
917500 -- [-369.971] (-366.993) (-367.203) (-367.729) * [-370.527] (-366.085) (-367.607) (-366.318) -- 0:00:04
918000 -- [-367.393] (-365.030) (-370.598) (-367.499) * [-367.974] (-368.265) (-367.894) (-364.881) -- 0:00:04
918500 -- (-365.174) (-368.270) [-369.774] (-371.042) * (-368.425) (-370.171) [-367.830] (-367.277) -- 0:00:04
919000 -- (-366.349) [-368.351] (-368.879) (-367.066) * (-365.070) (-367.217) (-368.703) [-367.013] -- 0:00:04
919500 -- (-365.658) [-367.881] (-367.410) (-367.840) * [-366.076] (-367.608) (-365.021) (-365.591) -- 0:00:04
920000 -- (-367.044) (-365.777) [-366.373] (-372.962) * (-366.386) [-368.224] (-365.604) (-367.554) -- 0:00:04
Average standard deviation of split frequencies: 0.012319
920500 -- (-365.406) [-366.216] (-367.020) (-368.547) * (-370.121) (-367.178) [-366.910] (-367.186) -- 0:00:04
921000 -- (-367.484) (-369.029) (-369.214) [-366.933] * [-365.092] (-367.537) (-365.079) (-365.305) -- 0:00:04
921500 -- [-365.282] (-365.673) (-365.333) (-367.893) * (-366.394) (-368.326) (-365.185) [-367.547] -- 0:00:04
922000 -- (-365.003) [-367.665] (-368.270) (-368.531) * (-365.775) [-366.330] (-365.893) (-366.454) -- 0:00:04
922500 -- (-364.940) (-365.366) [-366.636] (-370.987) * (-365.833) (-370.397) [-367.889] (-366.196) -- 0:00:04
923000 -- (-365.828) (-365.525) [-365.486] (-369.808) * (-369.962) (-368.539) (-370.955) [-368.777] -- 0:00:04
923500 -- [-366.093] (-366.274) (-368.000) (-367.609) * (-367.841) (-370.234) (-367.834) [-367.835] -- 0:00:04
924000 -- [-368.420] (-368.624) (-365.112) (-367.081) * (-368.179) [-366.826] (-367.396) (-367.756) -- 0:00:04
924500 -- [-367.838] (-368.728) (-365.772) (-364.762) * [-367.434] (-367.545) (-367.391) (-366.221) -- 0:00:04
925000 -- (-370.915) (-367.785) (-367.073) [-364.776] * [-366.305] (-370.140) (-368.525) (-365.475) -- 0:00:04
Average standard deviation of split frequencies: 0.012158
925500 -- (-364.802) [-371.642] (-366.856) (-367.072) * (-365.268) (-366.248) (-368.584) [-364.907] -- 0:00:04
926000 -- [-364.698] (-367.705) (-369.348) (-365.129) * [-368.520] (-366.526) (-369.395) (-368.539) -- 0:00:04
926500 -- (-365.320) (-366.009) (-368.513) [-367.194] * [-365.691] (-366.508) (-368.063) (-365.554) -- 0:00:04
927000 -- (-366.634) [-371.303] (-366.682) (-366.073) * (-368.501) (-366.455) (-367.297) [-366.996] -- 0:00:04
927500 -- [-372.342] (-369.880) (-365.525) (-367.004) * (-365.123) (-365.693) (-367.256) [-368.684] -- 0:00:04
928000 -- [-365.673] (-369.152) (-364.518) (-365.612) * (-366.930) (-365.383) [-367.136] (-367.548) -- 0:00:04
928500 -- (-368.035) (-368.272) (-369.777) [-367.324] * (-367.366) (-372.063) (-366.640) [-368.046] -- 0:00:04
929000 -- (-368.394) [-365.916] (-368.196) (-366.493) * (-365.510) (-366.408) (-364.684) [-366.253] -- 0:00:04
929500 -- [-368.815] (-365.536) (-367.006) (-366.199) * (-366.226) (-366.131) [-364.610] (-365.664) -- 0:00:04
930000 -- [-366.481] (-365.051) (-364.682) (-366.782) * (-369.421) (-367.209) [-367.963] (-365.338) -- 0:00:04
Average standard deviation of split frequencies: 0.012306
930500 -- (-368.784) [-365.919] (-366.091) (-365.393) * [-367.574] (-365.341) (-366.403) (-365.618) -- 0:00:04
931000 -- (-367.411) (-366.561) [-364.960] (-366.770) * (-365.913) (-368.330) (-367.461) [-366.033] -- 0:00:04
931500 -- (-369.024) [-365.491] (-364.852) (-365.714) * (-370.942) (-366.228) (-367.226) [-366.022] -- 0:00:04
932000 -- (-367.156) [-366.109] (-366.122) (-372.789) * (-367.979) (-367.187) [-367.184] (-365.343) -- 0:00:04
932500 -- (-365.448) [-367.677] (-368.134) (-371.350) * [-366.792] (-366.770) (-365.088) (-368.647) -- 0:00:03
933000 -- [-364.581] (-366.506) (-366.374) (-367.826) * (-366.763) (-370.196) (-365.265) [-365.943] -- 0:00:03
933500 -- [-365.431] (-368.350) (-365.215) (-368.517) * (-367.740) (-369.053) (-365.178) [-365.516] -- 0:00:03
934000 -- (-368.487) (-366.378) [-366.985] (-365.153) * [-365.028] (-372.057) (-365.098) (-365.719) -- 0:00:03
934500 -- (-365.691) (-367.213) (-365.514) [-366.781] * (-365.028) [-367.232] (-366.817) (-368.497) -- 0:00:03
935000 -- (-366.174) (-366.340) (-365.561) [-367.607] * (-372.161) (-365.613) [-364.783] (-366.675) -- 0:00:03
Average standard deviation of split frequencies: 0.012235
935500 -- [-367.713] (-371.692) (-368.448) (-365.998) * (-365.140) (-365.356) [-365.022] (-364.763) -- 0:00:03
936000 -- (-367.436) [-367.947] (-366.711) (-366.563) * (-365.542) (-366.198) (-365.304) [-364.467] -- 0:00:03
936500 -- (-367.453) (-366.736) [-367.060] (-365.915) * (-367.827) [-372.334] (-365.545) (-364.942) -- 0:00:03
937000 -- [-367.105] (-368.389) (-365.973) (-368.513) * (-366.139) [-368.920] (-368.438) (-365.406) -- 0:00:03
937500 -- [-366.399] (-366.444) (-364.943) (-365.428) * (-368.775) (-366.921) [-370.308] (-365.595) -- 0:00:03
938000 -- [-367.241] (-365.713) (-364.537) (-365.437) * (-369.185) (-366.227) [-364.666] (-366.447) -- 0:00:03
938500 -- (-366.237) (-367.505) [-364.644] (-371.655) * [-367.691] (-366.611) (-368.408) (-368.444) -- 0:00:03
939000 -- (-365.614) (-367.309) [-368.259] (-366.483) * (-369.750) (-368.417) [-367.187] (-364.864) -- 0:00:03
939500 -- (-365.714) [-367.105] (-374.618) (-366.722) * [-368.469] (-366.160) (-364.762) (-366.772) -- 0:00:03
940000 -- [-368.780] (-365.434) (-369.622) (-366.039) * (-365.785) (-364.910) (-364.663) [-365.696] -- 0:00:03
Average standard deviation of split frequencies: 0.012499
940500 -- (-365.262) [-366.249] (-369.157) (-365.019) * (-365.437) (-364.902) [-367.266] (-368.292) -- 0:00:03
941000 -- (-365.073) (-365.610) (-367.747) [-366.754] * (-366.145) (-369.619) [-367.463] (-368.103) -- 0:00:03
941500 -- [-364.540] (-365.490) (-370.791) (-365.228) * (-366.367) (-367.165) (-365.991) [-368.228] -- 0:00:03
942000 -- (-366.506) (-368.106) [-371.733] (-366.858) * (-368.727) (-367.156) [-364.863] (-366.364) -- 0:00:03
942500 -- (-364.923) (-369.303) [-367.395] (-365.862) * (-365.842) (-365.904) [-371.417] (-365.835) -- 0:00:03
943000 -- (-366.453) [-366.794] (-371.117) (-365.115) * (-368.000) [-364.518] (-366.881) (-366.887) -- 0:00:03
943500 -- (-367.358) (-365.070) [-366.700] (-365.028) * (-368.329) [-367.639] (-367.357) (-367.066) -- 0:00:03
944000 -- (-369.716) (-366.438) (-368.785) [-365.478] * (-370.975) (-367.477) (-364.931) [-366.218] -- 0:00:03
944500 -- (-367.046) (-365.660) (-367.828) [-365.655] * (-367.490) (-369.530) [-365.288] (-365.620) -- 0:00:03
945000 -- (-367.212) [-364.999] (-368.593) (-366.416) * [-364.887] (-366.539) (-365.935) (-368.700) -- 0:00:03
Average standard deviation of split frequencies: 0.012604
945500 -- (-367.855) (-365.338) (-371.621) [-368.339] * (-367.039) (-366.861) (-365.952) [-369.846] -- 0:00:03
946000 -- [-365.027] (-368.172) (-366.522) (-366.086) * (-367.699) [-367.470] (-365.678) (-369.258) -- 0:00:03
946500 -- (-368.672) [-367.686] (-366.601) (-367.471) * [-367.949] (-366.988) (-369.274) (-366.942) -- 0:00:03
947000 -- (-368.451) (-365.999) (-368.555) [-367.230] * (-368.341) (-365.478) (-368.850) [-365.737] -- 0:00:03
947500 -- (-367.919) (-366.071) (-368.138) [-368.415] * (-368.217) [-365.601] (-365.367) (-367.242) -- 0:00:03
948000 -- [-366.603] (-371.727) (-369.398) (-366.268) * (-365.730) [-365.689] (-365.798) (-371.336) -- 0:00:03
948500 -- [-367.709] (-365.957) (-366.867) (-367.992) * (-369.345) (-366.760) (-366.292) [-365.762] -- 0:00:03
949000 -- [-370.238] (-364.570) (-369.023) (-368.233) * [-366.687] (-371.730) (-365.342) (-367.930) -- 0:00:03
949500 -- (-368.102) (-365.980) (-365.857) [-366.154] * (-367.893) [-369.422] (-365.643) (-369.786) -- 0:00:02
950000 -- (-366.846) (-367.851) (-371.387) [-366.349] * (-367.151) (-369.190) [-365.646] (-369.850) -- 0:00:02
Average standard deviation of split frequencies: 0.012805
950500 -- (-368.390) (-366.051) [-367.127] (-366.397) * [-368.373] (-367.136) (-371.384) (-368.683) -- 0:00:02
951000 -- (-367.548) (-365.332) (-364.965) [-369.103] * (-367.177) [-367.845] (-365.194) (-366.965) -- 0:00:02
951500 -- [-367.238] (-367.561) (-371.545) (-369.740) * (-367.231) (-367.202) (-365.201) [-365.477] -- 0:00:02
952000 -- (-365.994) [-370.596] (-366.997) (-366.657) * (-365.870) [-366.517] (-370.736) (-364.578) -- 0:00:02
952500 -- (-372.193) (-366.267) (-367.720) [-366.442] * (-370.148) (-370.707) (-369.331) [-364.991] -- 0:00:02
953000 -- (-365.004) (-365.000) [-367.691] (-367.757) * (-366.974) (-368.706) [-366.637] (-365.583) -- 0:00:02
953500 -- (-365.018) (-367.089) (-367.584) [-365.086] * (-367.553) [-364.917] (-365.428) (-366.554) -- 0:00:02
954000 -- [-365.681] (-368.131) (-366.042) (-367.637) * (-368.372) (-366.841) (-365.133) [-367.453] -- 0:00:02
954500 -- [-368.101] (-365.164) (-365.388) (-370.210) * (-366.348) [-370.209] (-364.394) (-370.506) -- 0:00:02
955000 -- (-369.276) [-365.614] (-369.257) (-367.398) * (-366.731) [-365.662] (-365.324) (-364.637) -- 0:00:02
Average standard deviation of split frequencies: 0.013369
955500 -- (-367.271) [-367.800] (-366.274) (-368.389) * (-365.611) (-366.129) [-365.945] (-368.854) -- 0:00:02
956000 -- (-370.111) (-365.649) [-366.462] (-366.652) * [-366.170] (-365.987) (-373.164) (-367.708) -- 0:00:02
956500 -- (-367.587) [-365.777] (-367.431) (-367.353) * [-364.869] (-367.741) (-365.328) (-367.495) -- 0:00:02
957000 -- [-365.287] (-365.232) (-366.369) (-367.111) * (-366.071) (-366.045) [-367.916] (-366.966) -- 0:00:02
957500 -- (-368.674) [-365.283] (-367.206) (-368.040) * (-366.789) (-367.599) [-366.550] (-367.752) -- 0:00:02
958000 -- (-374.014) (-365.669) (-370.380) [-367.151] * [-365.191] (-364.691) (-366.373) (-366.277) -- 0:00:02
958500 -- (-366.455) (-367.725) [-368.573] (-365.360) * (-364.533) (-365.524) (-367.171) [-365.912] -- 0:00:02
959000 -- (-368.197) (-365.523) [-367.695] (-365.413) * (-367.928) [-366.844] (-368.156) (-366.217) -- 0:00:02
959500 -- [-365.068] (-366.786) (-368.382) (-365.400) * (-366.769) (-368.795) [-365.124] (-365.112) -- 0:00:02
960000 -- [-364.567] (-366.274) (-367.674) (-366.277) * (-368.260) (-368.115) [-367.974] (-367.264) -- 0:00:02
Average standard deviation of split frequencies: 0.013278
960500 -- (-368.270) (-366.590) [-365.732] (-366.341) * (-365.078) (-370.077) (-372.742) [-365.984] -- 0:00:02
961000 -- (-366.972) (-367.269) [-364.506] (-366.510) * (-366.991) [-367.865] (-366.097) (-364.800) -- 0:00:02
961500 -- (-367.067) [-365.711] (-364.339) (-366.146) * (-365.971) [-366.830] (-367.355) (-366.093) -- 0:00:02
962000 -- (-370.694) (-367.187) (-369.193) [-365.803] * (-365.753) (-366.145) [-366.077] (-366.294) -- 0:00:02
962500 -- (-367.710) (-369.362) [-373.074] (-366.079) * (-366.030) [-366.385] (-366.626) (-365.902) -- 0:00:02
963000 -- (-365.708) [-366.338] (-366.912) (-366.486) * (-364.432) (-367.732) (-367.417) [-366.578] -- 0:00:02
963500 -- (-369.011) (-367.532) [-367.369] (-366.998) * [-365.534] (-367.077) (-365.759) (-370.393) -- 0:00:02
964000 -- (-365.719) (-364.798) [-367.276] (-364.950) * [-365.370] (-367.822) (-364.943) (-365.994) -- 0:00:02
964500 -- (-368.343) (-366.127) [-366.437] (-365.805) * [-365.614] (-366.080) (-366.758) (-365.742) -- 0:00:02
965000 -- (-367.547) [-366.056] (-367.649) (-368.765) * [-367.546] (-365.495) (-365.338) (-365.185) -- 0:00:02
Average standard deviation of split frequencies: 0.012803
965500 -- [-365.338] (-365.900) (-366.879) (-366.295) * (-369.396) [-366.195] (-367.456) (-367.614) -- 0:00:02
966000 -- (-365.880) (-366.466) [-367.601] (-366.098) * (-368.143) (-365.289) (-366.892) [-365.570] -- 0:00:02
966500 -- [-365.473] (-368.972) (-364.894) (-366.727) * (-368.371) (-364.774) (-366.918) [-367.295] -- 0:00:01
967000 -- [-364.804] (-370.422) (-366.105) (-366.656) * (-369.316) (-366.604) [-367.285] (-367.347) -- 0:00:01
967500 -- (-364.709) [-366.359] (-370.958) (-370.999) * (-368.809) [-367.255] (-368.801) (-366.429) -- 0:00:01
968000 -- [-364.582] (-367.825) (-368.271) (-370.095) * (-367.565) (-367.554) [-366.731] (-366.053) -- 0:00:01
968500 -- [-366.026] (-368.558) (-370.282) (-365.968) * (-366.272) (-367.135) (-365.686) [-367.581] -- 0:00:01
969000 -- (-366.594) (-366.984) [-366.978] (-368.053) * (-365.899) [-366.873] (-370.516) (-367.995) -- 0:00:01
969500 -- (-365.043) (-365.897) [-368.301] (-367.837) * (-367.748) (-364.674) (-365.231) [-365.405] -- 0:00:01
970000 -- [-364.476] (-370.737) (-368.647) (-368.603) * (-368.734) (-367.823) [-365.235] (-366.288) -- 0:00:01
Average standard deviation of split frequencies: 0.012598
970500 -- (-365.538) [-366.225] (-369.580) (-366.157) * [-367.151] (-367.253) (-370.156) (-365.893) -- 0:00:01
971000 -- (-364.536) (-368.780) (-372.063) [-366.855] * (-368.098) (-368.562) [-366.570] (-367.264) -- 0:00:01
971500 -- (-365.308) (-368.678) (-366.714) [-365.610] * [-368.033] (-369.345) (-370.331) (-366.489) -- 0:00:01
972000 -- [-365.764] (-364.929) (-366.214) (-364.915) * (-370.517) (-371.130) [-364.987] (-366.313) -- 0:00:01
972500 -- [-366.407] (-366.213) (-370.060) (-372.015) * (-366.622) (-366.284) [-365.055] (-367.191) -- 0:00:01
973000 -- [-365.114] (-365.075) (-367.512) (-371.231) * (-367.305) [-365.587] (-364.876) (-365.680) -- 0:00:01
973500 -- (-367.275) (-364.531) (-365.752) [-370.398] * [-365.179] (-366.141) (-365.809) (-365.194) -- 0:00:01
974000 -- [-365.686] (-364.900) (-366.014) (-373.560) * [-365.595] (-370.584) (-366.842) (-369.040) -- 0:00:01
974500 -- [-367.779] (-366.153) (-368.266) (-369.315) * (-370.133) (-372.622) [-365.724] (-368.634) -- 0:00:01
975000 -- (-365.411) (-365.951) [-365.967] (-368.339) * (-369.008) (-365.881) [-365.527] (-367.428) -- 0:00:01
Average standard deviation of split frequencies: 0.012692
975500 -- (-365.066) (-366.999) (-367.905) [-367.343] * (-366.577) (-367.501) (-368.787) [-364.326] -- 0:00:01
976000 -- (-369.361) [-365.989] (-368.471) (-365.783) * (-365.674) (-367.961) [-369.453] (-364.779) -- 0:00:01
976500 -- (-367.205) (-369.431) (-369.869) [-370.697] * (-365.077) [-365.211] (-365.499) (-365.285) -- 0:00:01
977000 -- [-371.014] (-369.318) (-365.476) (-369.699) * (-365.566) [-365.570] (-366.293) (-366.094) -- 0:00:01
977500 -- (-368.304) (-366.420) [-365.429] (-364.586) * (-366.673) [-366.360] (-366.880) (-366.220) -- 0:00:01
978000 -- (-367.283) (-365.398) (-367.754) [-365.296] * (-364.872) [-366.008] (-367.871) (-365.184) -- 0:00:01
978500 -- (-367.379) (-369.739) (-366.998) [-367.279] * (-366.121) (-367.638) [-365.217] (-367.845) -- 0:00:01
979000 -- [-365.025] (-366.473) (-364.432) (-366.892) * (-366.725) (-366.031) [-367.083] (-365.165) -- 0:00:01
979500 -- [-368.249] (-367.137) (-366.855) (-368.462) * (-366.328) (-365.114) [-369.210] (-369.034) -- 0:00:01
980000 -- [-369.677] (-367.118) (-366.171) (-365.338) * (-367.546) (-366.228) (-368.378) [-364.636] -- 0:00:01
Average standard deviation of split frequencies: 0.012204
980500 -- (-369.256) (-367.131) [-366.394] (-366.184) * (-366.434) (-365.264) [-370.138] (-365.158) -- 0:00:01
981000 -- (-365.637) (-366.833) [-365.666] (-365.640) * [-367.393] (-366.028) (-371.379) (-369.633) -- 0:00:01
981500 -- [-365.661] (-367.578) (-369.464) (-365.193) * (-367.522) (-366.481) (-370.089) [-367.282] -- 0:00:01
982000 -- (-366.365) [-365.798] (-368.033) (-365.267) * (-365.738) (-366.491) [-365.014] (-369.096) -- 0:00:01
982500 -- [-366.262] (-369.497) (-366.919) (-365.477) * [-366.392] (-368.871) (-367.761) (-370.612) -- 0:00:01
983000 -- (-368.197) (-369.747) (-367.503) [-366.349] * [-366.709] (-365.587) (-366.848) (-367.261) -- 0:00:01
983500 -- (-369.810) [-368.223] (-366.210) (-366.571) * (-366.596) [-366.323] (-365.588) (-367.687) -- 0:00:00
984000 -- (-365.127) (-365.313) (-364.932) [-364.991] * (-368.455) (-366.426) (-365.151) [-367.620] -- 0:00:00
984500 -- (-368.963) (-365.639) (-365.098) [-368.059] * [-366.247] (-365.580) (-365.572) (-367.569) -- 0:00:00
985000 -- [-367.167] (-369.036) (-367.587) (-368.221) * (-365.052) (-365.388) (-366.181) [-369.235] -- 0:00:00
Average standard deviation of split frequencies: 0.012191
985500 -- (-367.657) (-366.800) (-367.386) [-366.031] * (-368.137) (-367.736) [-373.755] (-369.263) -- 0:00:00
986000 -- (-369.827) (-366.704) [-369.478] (-365.905) * (-365.762) [-367.870] (-371.665) (-364.423) -- 0:00:00
986500 -- [-369.547] (-368.893) (-368.316) (-367.998) * (-366.671) (-365.148) (-370.707) [-368.735] -- 0:00:00
987000 -- [-366.052] (-365.338) (-369.237) (-369.677) * (-365.972) (-366.115) [-367.186] (-364.723) -- 0:00:00
987500 -- [-368.212] (-365.732) (-372.190) (-369.559) * [-365.508] (-364.582) (-369.657) (-365.149) -- 0:00:00
988000 -- (-366.841) (-373.094) (-368.053) [-369.117] * (-366.536) (-364.683) (-367.219) [-367.950] -- 0:00:00
988500 -- (-369.898) [-368.412] (-366.138) (-367.227) * (-365.034) (-364.593) [-366.109] (-368.639) -- 0:00:00
989000 -- [-367.681] (-366.983) (-366.150) (-364.937) * [-368.296] (-365.291) (-368.024) (-366.232) -- 0:00:00
989500 -- (-366.917) (-367.697) (-367.388) [-364.786] * (-372.487) [-367.704] (-365.765) (-368.256) -- 0:00:00
990000 -- (-366.113) (-368.080) [-365.992] (-364.572) * [-365.663] (-367.454) (-365.038) (-365.069) -- 0:00:00
Average standard deviation of split frequencies: 0.011952
990500 -- (-368.209) (-364.977) [-366.055] (-366.757) * [-369.282] (-368.212) (-365.262) (-365.592) -- 0:00:00
991000 -- (-366.886) (-369.829) (-368.680) [-365.258] * (-369.751) (-366.703) (-364.612) [-366.602] -- 0:00:00
991500 -- [-366.663] (-367.989) (-366.746) (-364.765) * (-366.591) [-364.869] (-370.169) (-368.565) -- 0:00:00
992000 -- (-366.784) [-369.707] (-366.595) (-364.632) * (-368.662) (-369.657) (-366.092) [-365.602] -- 0:00:00
992500 -- (-365.937) (-367.766) [-365.582] (-365.317) * (-364.997) (-366.076) (-366.774) [-366.827] -- 0:00:00
993000 -- [-365.425] (-365.839) (-368.692) (-367.886) * (-365.246) [-368.879] (-365.970) (-371.661) -- 0:00:00
993500 -- [-365.556] (-367.334) (-367.184) (-366.071) * (-367.728) [-367.753] (-366.375) (-367.409) -- 0:00:00
994000 -- (-365.714) (-367.741) [-365.974] (-366.068) * (-369.632) (-368.674) (-367.036) [-370.391] -- 0:00:00
994500 -- (-365.348) (-369.564) (-371.603) [-366.552] * (-367.450) (-366.084) (-372.179) [-367.327] -- 0:00:00
995000 -- (-366.204) (-369.794) [-368.575] (-366.229) * (-371.385) (-364.917) (-371.246) [-365.384] -- 0:00:00
Average standard deviation of split frequencies: 0.011805
995500 -- (-366.609) (-371.365) (-366.329) [-366.923] * (-367.052) (-365.771) (-366.902) [-368.855] -- 0:00:00
996000 -- (-367.598) (-365.414) [-366.452] (-366.246) * [-367.340] (-367.419) (-365.676) (-369.954) -- 0:00:00
996500 -- (-364.931) [-365.841] (-365.041) (-365.760) * [-369.076] (-365.364) (-365.185) (-367.136) -- 0:00:00
997000 -- (-365.662) [-367.647] (-364.788) (-364.809) * (-366.977) (-365.548) [-368.264] (-366.572) -- 0:00:00
997500 -- (-368.452) [-367.212] (-365.479) (-366.812) * (-365.964) [-367.390] (-366.235) (-365.947) -- 0:00:00
998000 -- (-365.379) [-365.294] (-364.993) (-367.448) * (-367.954) (-364.878) [-365.750] (-370.161) -- 0:00:00
998500 -- (-366.302) (-368.314) [-368.323] (-366.755) * (-367.267) (-365.354) (-365.924) [-367.115] -- 0:00:00
999000 -- [-365.700] (-365.129) (-369.484) (-371.160) * (-365.444) (-365.545) [-366.116] (-371.078) -- 0:00:00
999500 -- (-366.480) [-367.271] (-369.574) (-369.523) * (-369.392) [-366.476] (-367.402) (-365.226) -- 0:00:00
1000000 -- [-370.239] (-365.364) (-367.920) (-367.002) * (-369.393) [-364.765] (-371.533) (-367.299) -- 0:00:00
Average standard deviation of split frequencies: 0.011750
Analysis completed in 59 seconds
Analysis used 57.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -364.29
Likelihood of best state for "cold" chain of run 2 was -364.29
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.7 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
42.1 % ( 38 %) Dirichlet(Pi{all})
40.7 % ( 28 %) Slider(Pi{all})
78.5 % ( 54 %) Multiplier(Alpha{1,2})
77.7 % ( 46 %) Multiplier(Alpha{3})
26.8 % ( 23 %) Slider(Pinvar{all})
98.7 % ( 99 %) ExtSPR(Tau{all},V{all})
70.2 % ( 69 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 91 %) ParsSPR(Tau{all},V{all})
28.0 % ( 20 %) Multiplier(V{all})
97.4 % ( 96 %) Nodeslider(V{all})
30.5 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
75.9 % ( 74 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
41.7 % ( 22 %) Dirichlet(Pi{all})
41.0 % ( 31 %) Slider(Pi{all})
78.6 % ( 54 %) Multiplier(Alpha{1,2})
77.6 % ( 55 %) Multiplier(Alpha{3})
26.1 % ( 29 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 66 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.6 % ( 90 %) ParsSPR(Tau{all},V{all})
28.1 % ( 23 %) Multiplier(V{all})
97.4 % ( 99 %) Nodeslider(V{all})
30.5 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.64 0.50
2 | 166825 0.82 0.67
3 | 167101 165875 0.84
4 | 167258 166542 166399
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166490 0.83 0.67
3 | 167130 166749 0.84
4 | 166373 166799 166459
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -366.00
| 1 1 |
| |
| 2 |
| 12 112 2 2 2 1 |
| 1 12 1 1 1 2 |
| 1 22 22 12 2 2 2 11 11 |
| 2 * 1*21 1 22 2 22 1 2 1 2 2 |
| 2 12 1 1 2 11 1 1 2 1 2 |
| 2 * 1 1 1 1* 1 1|
|11 1 2 1 1 2 21* 1 |
|2 12 2 * * 2 2 2 1 1 2 22|
| 2 2 1 1 |
| 2 2 1* 221 |
| 1 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -367.69
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -366.04 -370.68
2 -366.10 -369.37
--------------------------------------
TOTAL -366.07 -370.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887569 0.086489 0.359264 1.461230 0.858873 1501.00 1501.00 1.000
r(A<->C){all} 0.161625 0.017890 0.000001 0.420022 0.127798 170.79 190.61 1.000
r(A<->G){all} 0.175494 0.022005 0.000181 0.480996 0.138477 110.53 155.61 1.011
r(A<->T){all} 0.161499 0.017441 0.000001 0.420945 0.130394 217.25 222.52 1.000
r(C<->G){all} 0.156043 0.016683 0.000011 0.410048 0.125854 190.05 257.50 1.000
r(C<->T){all} 0.179838 0.021225 0.000021 0.479659 0.145186 160.73 175.11 1.001
r(G<->T){all} 0.165501 0.019680 0.000103 0.446196 0.126693 200.45 271.80 1.000
pi(A){all} 0.202998 0.000587 0.157728 0.250342 0.202472 1191.24 1217.94 1.000
pi(C){all} 0.288494 0.000773 0.232430 0.341451 0.288371 1039.69 1150.68 1.000
pi(G){all} 0.313013 0.000810 0.257231 0.367407 0.312416 1009.63 1136.80 1.001
pi(T){all} 0.195495 0.000610 0.147633 0.244896 0.194798 1164.11 1244.49 1.000
alpha{1,2} 0.403119 0.251401 0.000114 1.383848 0.230454 1020.20 1175.93 1.000
alpha{3} 0.445938 0.233448 0.000107 1.431139 0.288239 1192.95 1325.74 1.000
pinvar{all} 0.993354 0.000063 0.978507 0.999997 0.996012 1179.15 1216.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ..*..*
8 -- .**.**
9 -- .*..*.
10 -- ..****
11 -- ..*.*.
12 -- ...**.
13 -- .***.*
14 -- ...*.*
15 -- .****.
16 -- .**...
17 -- ..**..
18 -- .*...*
19 -- .*.***
20 -- .*.*..
21 -- ....**
22 -- .**.*.
23 -- ..**.*
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 473 0.157562 0.029679 0.136576 0.178548 2
8 473 0.157562 0.009893 0.150566 0.164557 2
9 453 0.150899 0.025910 0.132578 0.169221 2
10 440 0.146569 0.021670 0.131246 0.161892 2
11 435 0.144903 0.006124 0.140573 0.149234 2
12 435 0.144903 0.015546 0.133911 0.155896 2
13 430 0.143238 0.016959 0.131246 0.155230 2
14 429 0.142905 0.002355 0.141239 0.144570 2
15 428 0.142572 0.010364 0.135243 0.149900 2
16 423 0.140906 0.005182 0.137242 0.144570 2
17 419 0.139574 0.004240 0.136576 0.142572 2
18 419 0.139574 0.001413 0.138574 0.140573 2
19 409 0.136243 0.014604 0.125916 0.146569 2
20 392 0.130580 0.000942 0.129913 0.131246 2
21 387 0.128914 0.008951 0.122585 0.135243 2
22 287 0.095603 0.015546 0.084610 0.106596 2
23 280 0.093271 0.010364 0.085943 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.098852 0.009839 0.000004 0.292474 0.068723 1.000 2
length{all}[2] 0.101447 0.009748 0.000071 0.296747 0.072974 1.000 2
length{all}[3] 0.099689 0.010176 0.000037 0.304843 0.068436 1.000 2
length{all}[4] 0.097084 0.009223 0.000038 0.280811 0.069233 1.000 2
length{all}[5] 0.099676 0.009711 0.000093 0.285999 0.069977 1.000 2
length{all}[6] 0.094835 0.009022 0.000072 0.291114 0.065603 1.000 2
length{all}[7] 0.091352 0.009555 0.000089 0.289025 0.058579 1.001 2
length{all}[8] 0.100114 0.009187 0.000114 0.277128 0.071313 1.003 2
length{all}[9] 0.105950 0.010872 0.000964 0.317477 0.071854 1.000 2
length{all}[10] 0.094750 0.010517 0.000307 0.287924 0.060760 0.998 2
length{all}[11] 0.099453 0.010486 0.000164 0.317942 0.064635 0.998 2
length{all}[12] 0.102014 0.010981 0.000072 0.319593 0.067844 0.999 2
length{all}[13] 0.095220 0.007955 0.000359 0.279586 0.073240 0.998 2
length{all}[14] 0.090359 0.007846 0.000637 0.257314 0.069559 0.998 2
length{all}[15] 0.101058 0.009115 0.000071 0.287248 0.076473 1.010 2
length{all}[16] 0.107392 0.011676 0.000117 0.311143 0.074435 0.998 2
length{all}[17] 0.099641 0.009050 0.000238 0.276667 0.070429 0.999 2
length{all}[18] 0.101457 0.012155 0.000314 0.309868 0.068212 0.998 2
length{all}[19] 0.098716 0.008727 0.000137 0.296016 0.069729 1.000 2
length{all}[20] 0.103749 0.011905 0.000252 0.326844 0.067969 1.000 2
length{all}[21] 0.098270 0.009422 0.000251 0.313730 0.066567 1.001 2
length{all}[22] 0.105608 0.012099 0.000073 0.317864 0.069164 0.999 2
length{all}[23] 0.094992 0.009016 0.000348 0.275115 0.065963 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.011750
Maximum standard deviation of split frequencies = 0.029679
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.010
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/-------------------------------------------------------------------- C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|-------------------------------------------------------------------- C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\----------------------------------------------------------------- C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 267
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 38 patterns at 89 / 89 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 38 patterns at 89 / 89 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
37088 bytes for conP
3344 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.017666 0.067142 0.045270 0.099808 0.086167 0.104266 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -380.433053
Iterating by ming2
Initial: fx= 380.433053
x= 0.01767 0.06714 0.04527 0.09981 0.08617 0.10427 0.30000 1.30000
1 h-m-p 0.0000 0.0002 211.6928 +++ 371.358375 m 0.0002 14 | 1/8
2 h-m-p 0.0009 0.0074 42.5134 -----------.. | 1/8
3 h-m-p 0.0000 0.0003 193.5332 +++ 359.422665 m 0.0003 46 | 2/8
4 h-m-p 0.0017 0.0096 33.1991 -----------.. | 2/8
5 h-m-p 0.0000 0.0003 173.7825 +++ 351.766748 m 0.0003 78 | 3/8
6 h-m-p 0.0016 0.0134 24.2886 -----------.. | 3/8
7 h-m-p 0.0000 0.0002 150.9575 +++ 346.722653 m 0.0002 110 | 4/8
8 h-m-p 0.0016 0.0198 16.9414 -----------.. | 4/8
9 h-m-p 0.0000 0.0002 123.6132 ++ 344.291823 m 0.0002 141 | 5/8
10 h-m-p 0.0013 0.0328 10.6081 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 87.6185 ++ 343.892723 m 0.0001 172 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 -----C 343.892723 0 0.0004 188 | 6/8
13 h-m-p 0.0160 8.0000 0.0000 C 343.892723 0 0.0160 201 | 6/8
14 h-m-p 0.0160 8.0000 0.0000 ---C 343.892723 0 0.0001 217
Out..
lnL = -343.892723
218 lfun, 218 eigenQcodon, 1308 P(t)
Time used: 0:00
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.076439 0.107390 0.065511 0.073899 0.062096 0.035651 0.299702 0.778330 0.100619
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 15.819422
np = 9
lnL0 = -377.168925
Iterating by ming2
Initial: fx= 377.168925
x= 0.07644 0.10739 0.06551 0.07390 0.06210 0.03565 0.29970 0.77833 0.10062
1 h-m-p 0.0000 0.0005 175.4355 +++ 361.337833 m 0.0005 15 | 1/9
2 h-m-p 0.0001 0.0004 217.4808 ++ 350.387195 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0001 213.9608 ++ 349.142381 m 0.0001 39 | 3/9
4 h-m-p 0.0010 0.0185 8.3643 -----------.. | 3/9
5 h-m-p 0.0000 0.0000 167.0579 ++ 349.057978 m 0.0000 72 | 4/9
6 h-m-p 0.0001 0.0493 6.4057 ---------.. | 4/9
7 h-m-p 0.0000 0.0001 144.4358 ++ 346.980875 m 0.0001 103 | 5/9
8 h-m-p 0.0021 0.0543 5.5631 ------------.. | 5/9
9 h-m-p 0.0000 0.0000 120.7150 ++ 346.555075 m 0.0000 137 | 6/9
10 h-m-p 0.0005 0.0630 4.5907 -----------.. | 6/9
11 h-m-p 0.0000 0.0004 85.1473 +++ 343.892755 m 0.0004 171 | 7/9
12 h-m-p 0.6839 8.0000 0.0001 ++ 343.892755 m 8.0000 183 | 7/9
13 h-m-p 0.0088 4.3921 0.1766 +++++ 343.892730 m 4.3921 200 | 8/9
14 h-m-p 1.6000 8.0000 0.0579 ------------Y 343.892730 0 0.0000 226 | 8/9
15 h-m-p 0.0160 8.0000 0.0000 ----------Y 343.892730 0 0.0000 249
Out..
lnL = -343.892730
250 lfun, 750 eigenQcodon, 3000 P(t)
Time used: 0:01
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.065106 0.016810 0.048444 0.105613 0.022923 0.081580 0.441268 1.095694 0.245331 0.366061 1.403174
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 8.390127
np = 11
lnL0 = -372.637518
Iterating by ming2
Initial: fx= 372.637518
x= 0.06511 0.01681 0.04844 0.10561 0.02292 0.08158 0.44127 1.09569 0.24533 0.36606 1.40317
1 h-m-p 0.0000 0.0002 198.7251 +++ 364.433130 m 0.0002 17 | 1/11
2 h-m-p 0.0001 0.0004 87.0534 ++ 361.745547 m 0.0004 31 | 2/11
3 h-m-p 0.0001 0.0005 130.5475 ++ 353.802668 m 0.0005 45 | 3/11
4 h-m-p 0.0003 0.0014 81.6630 ++ 349.221811 m 0.0014 59 | 4/11
5 h-m-p 0.0000 0.0000 176110.8281 ++ 346.147975 m 0.0000 73 | 5/11
6 h-m-p 0.0000 0.0000 4958.3528 ++ 345.339641 m 0.0000 87 | 6/11
7 h-m-p 0.0073 0.2529 2.6916 -------------.. | 6/11
8 h-m-p 0.0000 0.0002 86.9154 +++ 343.892744 m 0.0002 127 | 7/11
9 h-m-p 0.5726 8.0000 0.0000 ++ 343.892744 m 8.0000 141 | 7/11
10 h-m-p 0.0160 8.0000 0.0279 +++++ 343.892741 m 8.0000 162 | 7/11
11 h-m-p 0.1477 0.7383 1.4086 ++ 343.892733 m 0.7383 180 | 7/11
12 h-m-p -0.0000 -0.0000 0.8440
h-m-p: -0.00000000e+00 -0.00000000e+00 8.44021589e-01 343.892733
.. | 7/11
13 h-m-p 0.0160 8.0000 0.0000 +++++ 343.892733 m 8.0000 212 | 7/11
14 h-m-p 0.0000 0.0002 1.8695 -------Y 343.892733 0 0.0000 237 | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 343.892733 m 8.0000 254 | 7/11
16 h-m-p 0.0000 0.0019 362.3239 ++++ 343.892718 m 0.0019 274 | 8/11
17 h-m-p 1.6000 8.0000 0.0242 -------C 343.892718 0 0.0000 295 | 8/11
18 h-m-p 0.3715 8.0000 0.0000 +++ 343.892718 m 8.0000 313 | 8/11
19 h-m-p 0.0160 8.0000 0.0280 ------------N 343.892718 0 0.0000 342 | 8/11
20 h-m-p 0.0160 8.0000 0.0000 -------------.. | 8/11
21 h-m-p 0.0160 8.0000 0.0000 ------------- | 8/11
22 h-m-p 0.0160 8.0000 0.0000 -------------
Out..
lnL = -343.892718
427 lfun, 1708 eigenQcodon, 7686 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -343.896488 S = -343.891189 -0.002025
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 38 patterns 0:03
did 20 / 38 patterns 0:03
did 30 / 38 patterns 0:03
did 38 / 38 patterns 0:03
Time used: 0:03
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.106878 0.075201 0.048801 0.044998 0.109747 0.035744 0.000100 0.622833 1.622330
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.053833
np = 9
lnL0 = -378.134919
Iterating by ming2
Initial: fx= 378.134919
x= 0.10688 0.07520 0.04880 0.04500 0.10975 0.03574 0.00011 0.62283 1.62233
1 h-m-p 0.0000 0.0000 185.8058 ++ 378.082127 m 0.0000 23 | 1/9
2 h-m-p 0.0001 0.0252 24.7670 +++++ 369.948500 m 0.0252 47 | 2/9
3 h-m-p 0.0003 0.0013 126.7509 ++ 358.812075 m 0.0013 67 | 3/9
4 h-m-p 0.0003 0.0014 23.3785 ++ 357.140034 m 0.0014 86 | 4/9
5 h-m-p 0.0003 0.0017 19.3881 ++ 356.996474 m 0.0017 104 | 5/9
6 h-m-p 0.0003 0.0014 42.5752 ++ 354.391350 m 0.0014 121 | 6/9
7 h-m-p 0.0002 0.0010 41.1480 ++ 350.145051 m 0.0010 137 | 7/9
8 h-m-p 0.0272 8.0000 0.8791 --------------.. | 7/9
9 h-m-p 0.0000 0.0010 78.4265 ++++ 343.892735 m 0.0010 180 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 --N 343.892735 0 0.0250 196 | 7/9
11 h-m-p 0.0160 8.0000 0.0000 N 343.892735 0 0.0160 209
Out..
lnL = -343.892735
210 lfun, 2310 eigenQcodon, 12600 P(t)
Time used: 0:06
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.079192 0.014858 0.080574 0.064457 0.073401 0.087431 0.000100 0.900000 0.234875 1.790373 1.300109
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 20.980416
np = 11
lnL0 = -373.623283
Iterating by ming2
Initial: fx= 373.623283
x= 0.07919 0.01486 0.08057 0.06446 0.07340 0.08743 0.00011 0.90000 0.23488 1.79037 1.30011
1 h-m-p 0.0000 0.0000 159.4975 ++ 373.592456 m 0.0000 27 | 1/11
2 h-m-p 0.0000 0.0003 194.8410 +++ 367.524602 m 0.0003 53 | 2/11
3 h-m-p 0.0004 0.0019 76.0800 ++ 348.893917 m 0.0019 77 | 3/11
4 h-m-p 0.0006 0.0029 40.2128 ++ 345.916121 m 0.0029 100 | 4/11
5 h-m-p 0.0000 0.0001 243.8703 ++ 345.687700 m 0.0001 122 | 5/11
6 h-m-p 0.0005 0.0025 5.3956 -----------.. | 5/11
7 h-m-p 0.0000 0.0001 146.1766 ++ 344.579808 m 0.0001 172 | 6/11
8 h-m-p 0.0040 0.1323 1.5392 ------------.. | 6/11
9 h-m-p 0.0000 0.0000 122.1063 ++ 344.383770 m 0.0000 221 | 7/11
10 h-m-p 0.0019 0.5036 0.5839 ------------.. | 7/11
11 h-m-p 0.0000 0.0001 86.5303 ++ 343.892723 m 0.0001 268 | 8/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 343.892723 m 8.0000 289 | 8/11
13 h-m-p 0.0105 5.2343 0.1685 +++++ 343.892717 m 5.2343 309 | 8/11
14 h-m-p -0.0000 -0.0000 0.0525
h-m-p: -0.00000000e+00 -0.00000000e+00 5.24564747e-02 343.892717
.. | 8/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 343.892717 m 8.0000 343 | 8/11
16 h-m-p 0.0000 0.0002 0.1793 -----C 343.892717 0 0.0000 365 | 8/11
17 h-m-p 0.0160 8.0000 0.0000 +++++ 343.892717 m 8.0000 385 | 8/11
18 h-m-p 0.0008 0.2559 0.3299 +++++ 343.892716 m 0.2559 405 | 9/11
19 h-m-p 0.1522 8.0000 0.4386 +++ 343.892714 m 8.0000 423 | 9/11
20 h-m-p 1.6000 8.0000 0.2677 ++ 343.892713 m 8.0000 439 | 9/11
21 h-m-p 1.0932 8.0000 1.9591 ++ 343.892713 m 8.0000 455 | 9/11
22 h-m-p 1.6000 8.0000 1.7645 ++ 343.892713 m 8.0000 471 | 9/11
23 h-m-p 1.4729 8.0000 9.5840 ++ 343.892713 m 8.0000 487 | 9/11
24 h-m-p 1.6000 8.0000 7.4543 ++ 343.892713 m 8.0000 503 | 9/11
25 h-m-p 1.6000 8.0000 17.0112 ++ 343.892713 m 8.0000 519 | 9/11
26 h-m-p 0.2277 1.1545 597.7267 ++ 343.892713 m 1.1545 535 | 9/11
27 h-m-p 0.9233 4.6165 216.1827 -------Y 343.892713 0 0.0000 558 | 9/11
28 h-m-p 0.3500 1.7500 0.0017 -Y 343.892713 0 0.0156 575 | 9/11
29 h-m-p 1.0000 8.0000 0.0000 ------------C 343.892713 0 0.0000 603
Out..
lnL = -343.892713
604 lfun, 7248 eigenQcodon, 39864 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -343.890625 S = -343.890619 -0.000003
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 38 patterns 0:16
did 20 / 38 patterns 0:16
did 30 / 38 patterns 0:16
did 38 / 38 patterns 0:16
Time used: 0:16
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=89
NC_011896_1_WP_010907966_1_891_MLBR_RS04190 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
NC_002677_1_NP_301642_1_514_rpsO VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
**************************************************
NC_011896_1_WP_010907966_1_891_MLBR_RS04190 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
NC_002677_1_NP_301642_1_514_rpsO HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705 HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
***************************************
>NC_011896_1_WP_010907966_1_891_MLBR_RS04190 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC >NC_002677_1_NP_301642_1_514_rpsO GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC >NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC >NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC >NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC >NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705 GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC GGCTTGGTCTGCGCCGC
>NC_011896_1_WP_010907966_1_891_MLBR_RS04190 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR >NC_002677_1_NP_301642_1_514_rpsO VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR >NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR >NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR >NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR >NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705 VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
#NEXUS
[ID: 0007126144]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907966_1_891_MLBR_RS04190
NC_002677_1_NP_301642_1_514_rpsO
NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675
NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950
NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625
NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907966_1_891_MLBR_RS04190,
2 NC_002677_1_NP_301642_1_514_rpsO,
3 NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675,
4 NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950,
5 NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625,
6 NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06872282,2:0.07297385,3:0.06843599,4:0.06923305,5:0.06997741,6:0.06560349);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06872282,2:0.07297385,3:0.06843599,4:0.06923305,5:0.06997741,6:0.06560349);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -366.04 -370.68
2 -366.10 -369.37
--------------------------------------
TOTAL -366.07 -370.23
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.887569 0.086489 0.359264 1.461230 0.858873 1501.00 1501.00 1.000
r(A<->C){all} 0.161625 0.017890 0.000001 0.420022 0.127798 170.79 190.61 1.000
r(A<->G){all} 0.175494 0.022005 0.000181 0.480996 0.138477 110.53 155.61 1.011
r(A<->T){all} 0.161499 0.017441 0.000001 0.420945 0.130394 217.25 222.52 1.000
r(C<->G){all} 0.156043 0.016683 0.000011 0.410048 0.125854 190.05 257.50 1.000
r(C<->T){all} 0.179838 0.021225 0.000021 0.479659 0.145186 160.73 175.11 1.001
r(G<->T){all} 0.165501 0.019680 0.000103 0.446196 0.126693 200.45 271.80 1.000
pi(A){all} 0.202998 0.000587 0.157728 0.250342 0.202472 1191.24 1217.94 1.000
pi(C){all} 0.288494 0.000773 0.232430 0.341451 0.288371 1039.69 1150.68 1.000
pi(G){all} 0.313013 0.000810 0.257231 0.367407 0.312416 1009.63 1136.80 1.001
pi(T){all} 0.195495 0.000610 0.147633 0.244896 0.194798 1164.11 1244.49 1.000
alpha{1,2} 0.403119 0.251401 0.000114 1.383848 0.230454 1020.20 1175.93 1.000
alpha{3} 0.445938 0.233448 0.000107 1.431139 0.288239 1192.95 1325.74 1.000
pinvar{all} 0.993354 0.000063 0.978507 0.999997 0.996012 1179.15 1216.54 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/rpsO/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 89
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 0 0 0 0 0 0 | TCC 2 2 2 2 2 2 | TAC 2 2 2 2 2 2 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 4 4 4 4 4 4 | TCG 3 3 3 3 3 3 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 2 2 2 2 2 2 | Arg CGT 1 1 1 1 1 1
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 4 4 4 4 4 4 | CGC 5 5 5 5 5 5
CTA 1 1 1 1 1 1 | CCA 0 0 0 0 0 0 | Gln CAA 1 1 1 1 1 1 | CGA 0 0 0 0 0 0
CTG 10 10 10 10 10 10 | CCG 1 1 1 1 1 1 | CAG 2 2 2 2 2 2 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 2 2 2 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 1 1 1 1 1 1
ATC 4 4 4 4 4 4 | ACC 3 3 3 3 3 3 | AAC 0 0 0 0 0 0 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 1 1 1 1 1 1 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 0 0 0 0 0 0 | ACG 0 0 0 0 0 0 | AAG 3 3 3 3 3 3 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 0 0 0 0 0 0 | Asp GAT 3 3 3 3 3 3 | Gly GGT 1 1 1 1 1 1
GTC 1 1 1 1 1 1 | GCC 1 1 1 1 1 1 | GAC 1 1 1 1 1 1 | GGC 1 1 1 1 1 1
GTA 1 1 1 1 1 1 | GCA 0 0 0 0 0 0 | Glu GAA 1 1 1 1 1 1 | GGA 0 0 0 0 0 0
GTG 2 2 2 2 2 2 | GCG 4 4 4 4 4 4 | GAG 4 4 4 4 4 4 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907966_1_891_MLBR_RS04190
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
#2: NC_002677_1_NP_301642_1_514_rpsO
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
#3: NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
#4: NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
#5: NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
#6: NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 0 | Tyr Y TAT 6 | Cys C TGT 0
TTC 0 | TCC 12 | TAC 12 | TGC 0
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 24 | TCG 18 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 12 | Arg R CGT 6
CTC 6 | CCC 0 | CAC 24 | CGC 30
CTA 6 | CCA 0 | Gln Q CAA 6 | CGA 0
CTG 60 | CCG 6 | CAG 12 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 12 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 6
ATC 24 | ACC 18 | AAC 0 | AGC 6
ATA 0 | ACA 6 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 0 | ACG 0 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 0 | Asp D GAT 18 | Gly G GGT 6
GTC 6 | GCC 6 | GAC 6 | GGC 6
GTA 6 | GCA 0 | Glu E GAA 6 | GGA 0
GTG 12 | GCG 24 | GAG 24 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13483 C:0.39326 A:0.21348 G:0.25843
position 2: T:0.30337 C:0.17978 A:0.30337 G:0.21348
position 3: T:0.14607 C:0.29213 A:0.08989 G:0.47191
Average T:0.19476 C:0.28839 A:0.20225 G:0.31461
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -343.892723 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.299702 1.300109
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907966_1_891_MLBR_RS04190: 0.000004, NC_002677_1_NP_301642_1_514_rpsO: 0.000004, NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675: 0.000004, NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950: 0.000004, NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625: 0.000004, NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.29970
omega (dN/dS) = 1.30011
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
7..2 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
7..3 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
7..4 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
7..5 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
7..6 0.000 217.3 49.7 1.3001 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:00
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -343.892730 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.441268 0.000010 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907966_1_891_MLBR_RS04190: 0.000004, NC_002677_1_NP_301642_1_514_rpsO: 0.000004, NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675: 0.000004, NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950: 0.000004, NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625: 0.000004, NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.44127
MLEs of dN/dS (w) for site classes (K=2)
p: 0.00001 0.99999
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 216.1 50.9 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:01
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
check convergence..
lnL(ntime: 6 np: 11): -343.892718 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.281385 0.554621 0.000001 1.226716
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907966_1_891_MLBR_RS04190: 0.000004, NC_002677_1_NP_301642_1_514_rpsO: 0.000004, NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675: 0.000004, NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950: 0.000004, NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625: 0.000004, NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.28138 0.55462 0.16399
w: 0.00000 1.00000 1.22672
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
7..2 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
7..3 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
7..4 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
7..5 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
7..6 0.000 220.4 46.6 0.7558 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907966_1_891_MLBR_RS04190)
Pr(w>1) post mean +- SE for w
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907966_1_891_MLBR_RS04190)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:03
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -343.892735 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.442876
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907966_1_891_MLBR_RS04190: 0.000004, NC_002677_1_NP_301642_1_514_rpsO: 0.000004, NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675: 0.000004, NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950: 0.000004, NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625: 0.000004, NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.44288
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 220.4 46.6 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:06
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -343.892713 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 1.861305 998.996982
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907966_1_891_MLBR_RS04190: 0.000004, NC_002677_1_NP_301642_1_514_rpsO: 0.000004, NZ_LVXE01000082_1_WP_010907966_1_2778_A3216_RS13675: 0.000004, NZ_LYPH01000083_1_WP_010907966_1_2693_A8144_RS12950: 0.000004, NZ_CP029543_1_WP_010907966_1_910_DIJ64_RS04625: 0.000004, NZ_AP014567_1_WP_010907966_1_926_JK2ML_RS04705: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 1.86131
(p1 = 0.99999) w = 998.99698
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 998.99698
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
7..2 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
7..3 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
7..4 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
7..5 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
7..6 0.000 220.4 46.6 998.9870 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907966_1_891_MLBR_RS04190)
Pr(w>1) post mean +- SE for w
1 V 1.000** 998.987
2 A 1.000** 998.987
3 L 1.000** 998.987
4 T 1.000** 998.987
5 S 1.000** 998.987
6 E 1.000** 998.987
7 Q 1.000** 998.987
8 K 1.000** 998.987
9 K 1.000** 998.987
10 E 1.000** 998.987
11 I 1.000** 998.987
12 L 1.000** 998.987
13 S 1.000** 998.987
14 S 1.000** 998.987
15 Y 1.000** 998.987
16 G 1.000** 998.987
17 L 1.000** 998.987
18 H 1.000** 998.987
19 A 1.000** 998.987
20 T 1.000** 998.987
21 D 1.000** 998.987
22 T 1.000** 998.987
23 G 1.000** 998.987
24 S 1.000** 998.987
25 P 1.000** 998.987
26 E 1.000** 998.987
27 A 1.000** 998.987
28 Q 1.000** 998.987
29 I 1.000** 998.987
30 A 1.000** 998.987
31 L 1.000** 998.987
32 L 1.000** 998.987
33 T 1.000** 998.987
34 K 1.000** 998.987
35 R 1.000** 998.987
36 I 1.000** 998.987
37 A 1.000** 998.987
38 D 1.000** 998.987
39 L 1.000** 998.987
40 T 1.000** 998.987
41 E 1.000** 998.987
42 H 1.000** 998.987
43 L 1.000** 998.987
44 K 1.000** 998.987
45 V 1.000** 998.987
46 H 1.000** 998.987
47 K 1.000** 998.987
48 H 1.000** 998.987
49 D 1.000** 998.987
50 H 1.000** 998.987
51 H 1.000** 998.987
52 S 1.000** 998.987
53 R 1.000** 998.987
54 R 1.000** 998.987
55 G 1.000** 998.987
56 L 1.000** 998.987
57 L 1.000** 998.987
58 L 1.000** 998.987
59 L 1.000** 998.987
60 V 1.000** 998.987
61 G 1.000** 998.987
62 R 1.000** 998.987
63 R 1.000** 998.987
64 R 1.000** 998.987
65 R 1.000** 998.987
66 L 1.000** 998.987
67 I 1.000** 998.987
68 K 1.000** 998.987
69 Y 1.000** 998.987
70 L 1.000** 998.987
71 S 1.000** 998.987
72 L 1.000** 998.987
73 I 1.000** 998.987
74 D 1.000** 998.987
75 V 1.000** 998.987
76 Q 1.000** 998.987
77 R 1.000** 998.987
78 Y 1.000** 998.987
79 R 1.000** 998.987
80 S 1.000** 998.987
81 L 1.000** 998.987
82 I 1.000** 998.987
83 E 1.000** 998.987
84 R 1.000** 998.987
85 L 1.000** 998.987
86 G 1.000** 998.987
87 L 1.000** 998.987
88 R 1.000** 998.987
89 R 1.000** 998.987
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907966_1_891_MLBR_RS04190)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:16
Model 1: NearlyNeutral -343.89273 Model 2: PositiveSelection -343.892718 Model 0: one-ratio -343.892723 Model 7: beta -343.892735 Model 8: beta&w>1 -343.892713 Model 0 vs 1 1.3999999964653398E-5 Model 2 vs 1 2.3999999939405825E-5 Model 8 vs 7 4.400000000259752E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
