--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:07:28 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsO/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -366.04          -370.68
2       -366.10          -369.37
--------------------------------------
TOTAL     -366.07          -370.23
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.887569    0.086489    0.359264    1.461230    0.858873   1501.00   1501.00    1.000
r(A<->C){all}   0.161625    0.017890    0.000001    0.420022    0.127798    170.79    190.61    1.000
r(A<->G){all}   0.175494    0.022005    0.000181    0.480996    0.138477    110.53    155.61    1.011
r(A<->T){all}   0.161499    0.017441    0.000001    0.420945    0.130394    217.25    222.52    1.000
r(C<->G){all}   0.156043    0.016683    0.000011    0.410048    0.125854    190.05    257.50    1.000
r(C<->T){all}   0.179838    0.021225    0.000021    0.479659    0.145186    160.73    175.11    1.001
r(G<->T){all}   0.165501    0.019680    0.000103    0.446196    0.126693    200.45    271.80    1.000
pi(A){all}      0.202998    0.000587    0.157728    0.250342    0.202472   1191.24   1217.94    1.000
pi(C){all}      0.288494    0.000773    0.232430    0.341451    0.288371   1039.69   1150.68    1.000
pi(G){all}      0.313013    0.000810    0.257231    0.367407    0.312416   1009.63   1136.80    1.001
pi(T){all}      0.195495    0.000610    0.147633    0.244896    0.194798   1164.11   1244.49    1.000
alpha{1,2}      0.403119    0.251401    0.000114    1.383848    0.230454   1020.20   1175.93    1.000
alpha{3}        0.445938    0.233448    0.000107    1.431139    0.288239   1192.95   1325.74    1.000
pinvar{all}     0.993354    0.000063    0.978507    0.999997    0.996012   1179.15   1216.54    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-343.89273
Model 2: PositiveSelection	-343.892718
Model 0: one-ratio	-343.892723
Model 7: beta	-343.892735
Model 8: beta&w>1	-343.892713


Model 0 vs 1	1.3999999964653398E-5

Model 2 vs 1	2.3999999939405825E-5

Model 8 vs 7	4.400000000259752E-5
>C1
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C2
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C3
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C4
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C5
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C6
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=89 

C1              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C2              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C3              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C4              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C5              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C6              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
                **************************************************

C1              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C2              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C3              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C4              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C5              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C6              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
                ***************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   89 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   89 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2670]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2670]--->[2670]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.420 Mb, Max= 30.581 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C2              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C3              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C4              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C5              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
C6              VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
                **************************************************

C1              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C2              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C3              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C4              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C5              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
C6              HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
                ***************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C2              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C3              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C4              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C5              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
C6              GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
                **************************************************

C1              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C2              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C3              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C4              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C5              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
C6              GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
                **************************************************

C1              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C2              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C3              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C4              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C5              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
C6              AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
                **************************************************

C1              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C2              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C3              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C4              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C5              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
C6              CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
                **************************************************

C1              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C2              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C3              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C4              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C5              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
C6              CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
                **************************************************

C1              GGCTTGGTCTGCGCCGC
C2              GGCTTGGTCTGCGCCGC
C3              GGCTTGGTCTGCGCCGC
C4              GGCTTGGTCTGCGCCGC
C5              GGCTTGGTCTGCGCCGC
C6              GGCTTGGTCTGCGCCGC
                *****************



>C1
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C2
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C3
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C4
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C5
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C6
GTGGCGCTGACAAGCGAGCAGAAAAAAGAAATTTTGAGTTCCTACGGCCT
GCATGCCACCGATACCGGGTCCCCGGAGGCGCAAATCGCGTTGTTGACCA
AGCGGATTGCGGACCTGACTGAGCACCTCAAGGTACACAAACACGATCAT
CACTCGCGGCGCGGGTTGCTGCTGCTGGTCGGGCGCCGGCGGCGGCTGAT
CAAGTACCTATCGCTGATCGATGTGCAGCGTTATCGCTCGCTGATCGAGC
GGCTTGGTCTGCGCCGC
>C1
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C2
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C3
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C4
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C5
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR
>C6
VALTSEQKKEILSSYGLHATDTGSPEAQIALLTKRIADLTEHLKVHKHDH
HSRRGLLLLVGRRRRLIKYLSLIDVQRYRSLIERLGLRR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 267 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788371
      Setting output file names to "/data/12res/rpsO/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 697967409
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0007126144
      Seed = 1594254976
      Swapseed = 1579788371
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -597.558800 -- -24.965149
         Chain 2 -- -597.558709 -- -24.965149
         Chain 3 -- -597.558800 -- -24.965149
         Chain 4 -- -597.558800 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -597.558800 -- -24.965149
         Chain 2 -- -597.558800 -- -24.965149
         Chain 3 -- -597.558800 -- -24.965149
         Chain 4 -- -597.558800 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-597.559] (-597.559) (-597.559) (-597.559) * [-597.559] (-597.559) (-597.559) (-597.559) 
        500 -- [-373.584] (-381.496) (-389.291) (-381.859) * [-374.454] (-371.260) (-371.082) (-376.200) -- 0:00:00
       1000 -- (-374.092) [-383.192] (-379.807) (-378.140) * (-373.723) (-377.892) (-375.866) [-378.969] -- 0:00:00
       1500 -- (-382.000) (-375.506) (-389.223) [-368.915] * (-378.965) (-387.533) (-380.775) [-375.564] -- 0:00:00
       2000 -- (-372.746) [-376.149] (-383.792) (-375.100) * (-375.029) (-375.104) [-373.926] (-372.637) -- 0:00:00
       2500 -- (-385.216) (-375.627) (-375.365) [-379.629] * [-377.521] (-371.236) (-375.021) (-379.073) -- 0:00:00
       3000 -- (-373.968) [-372.109] (-374.451) (-374.019) * (-373.671) (-370.600) [-380.304] (-379.140) -- 0:00:00
       3500 -- (-381.060) (-373.603) (-390.375) [-380.152] * (-372.016) (-379.451) (-373.576) [-373.688] -- 0:00:00
       4000 -- [-377.683] (-378.146) (-380.296) (-381.941) * (-376.608) [-375.604] (-380.451) (-374.349) -- 0:00:00
       4500 -- (-374.926) (-376.453) (-376.156) [-370.575] * (-379.925) (-371.818) [-377.284] (-374.995) -- 0:00:00
       5000 -- (-375.026) (-383.707) (-379.059) [-376.862] * (-380.320) (-377.723) (-378.527) [-374.643] -- 0:03:19

      Average standard deviation of split frequencies: 0.088815

       5500 -- (-378.326) (-378.816) [-375.248] (-375.169) * (-375.261) (-378.544) [-377.237] (-371.167) -- 0:03:00
       6000 -- (-373.935) [-374.291] (-372.614) (-374.437) * (-388.524) (-374.902) (-385.007) [-371.839] -- 0:02:45
       6500 -- (-374.341) [-377.163] (-373.802) (-383.102) * (-379.890) (-381.922) [-371.726] (-372.821) -- 0:02:32
       7000 -- (-384.388) (-370.898) (-377.230) [-373.420] * (-377.807) (-375.790) (-376.347) [-375.973] -- 0:02:21
       7500 -- (-370.838) [-373.625] (-370.883) (-378.491) * (-375.621) (-378.104) [-376.033] (-377.780) -- 0:02:12
       8000 -- (-375.440) [-374.456] (-377.098) (-379.560) * (-381.145) [-377.487] (-379.306) (-386.417) -- 0:02:04
       8500 -- (-379.890) (-377.041) [-373.627] (-378.895) * (-375.190) (-378.131) (-372.106) [-372.791] -- 0:01:56
       9000 -- (-383.414) (-391.771) (-379.657) [-373.950] * [-374.258] (-373.783) (-377.841) (-375.376) -- 0:01:50
       9500 -- (-376.487) [-370.244] (-372.425) (-379.547) * (-381.796) [-372.708] (-375.162) (-383.967) -- 0:01:44
      10000 -- (-370.723) [-366.016] (-372.910) (-376.591) * [-374.141] (-377.087) (-382.701) (-372.559) -- 0:01:39

      Average standard deviation of split frequencies: 0.083736

      10500 -- (-367.562) [-365.555] (-373.565) (-370.786) * (-372.854) (-374.876) (-369.242) [-371.026] -- 0:01:34
      11000 -- (-366.528) [-367.048] (-379.247) (-381.521) * (-371.479) (-377.113) [-364.477] (-378.670) -- 0:01:29
      11500 -- [-366.465] (-369.953) (-372.830) (-371.280) * [-370.548] (-373.110) (-366.884) (-382.415) -- 0:01:25
      12000 -- (-365.628) (-364.650) [-380.999] (-374.867) * [-370.892] (-373.363) (-366.545) (-367.102) -- 0:01:22
      12500 -- [-369.470] (-371.584) (-378.151) (-374.908) * [-374.508] (-373.106) (-368.210) (-366.864) -- 0:01:19
      13000 -- [-365.360] (-366.542) (-376.523) (-373.314) * (-374.103) (-374.768) (-367.076) [-368.286] -- 0:01:15
      13500 -- (-365.368) (-368.087) (-389.464) [-374.412] * (-387.108) (-377.589) (-365.899) [-367.762] -- 0:01:13
      14000 -- (-365.957) (-369.351) (-378.726) [-372.785] * (-386.765) (-380.171) [-364.826] (-365.745) -- 0:01:10
      14500 -- (-367.875) [-365.594] (-373.607) (-372.756) * (-384.055) (-374.507) [-365.127] (-368.218) -- 0:01:07
      15000 -- [-365.613] (-368.047) (-371.829) (-374.307) * (-381.513) [-374.549] (-365.150) (-367.539) -- 0:01:05

      Average standard deviation of split frequencies: 0.057452

      15500 -- (-374.496) [-366.414] (-365.668) (-374.761) * (-380.517) (-375.602) (-366.262) [-366.729] -- 0:01:03
      16000 -- (-371.681) [-367.091] (-365.458) (-375.257) * (-383.004) [-381.282] (-369.174) (-365.263) -- 0:01:01
      16500 -- (-369.866) (-365.081) (-368.079) [-371.785] * (-379.443) (-391.421) (-367.297) [-365.334] -- 0:00:59
      17000 -- (-368.175) [-366.189] (-369.637) (-381.786) * (-380.188) [-378.312] (-364.723) (-368.006) -- 0:00:57
      17500 -- [-365.103] (-366.927) (-366.719) (-380.879) * (-378.799) (-377.432) [-367.436] (-370.393) -- 0:00:56
      18000 -- [-365.061] (-365.865) (-369.260) (-372.646) * (-373.879) (-374.153) (-367.424) [-366.032] -- 0:00:54
      18500 -- (-367.756) [-366.745] (-365.196) (-371.158) * (-380.414) (-373.593) (-371.217) [-364.718] -- 0:00:53
      19000 -- (-372.232) (-368.371) [-365.429] (-382.799) * (-381.990) (-381.851) [-366.098] (-368.332) -- 0:00:51
      19500 -- (-368.427) (-368.378) [-366.639] (-381.592) * (-389.898) (-374.895) [-368.836] (-368.947) -- 0:00:50
      20000 -- [-364.747] (-368.960) (-367.440) (-378.968) * (-385.528) [-376.658] (-366.751) (-366.086) -- 0:00:49

      Average standard deviation of split frequencies: 0.045620

      20500 -- [-366.257] (-367.862) (-368.103) (-377.020) * (-375.738) (-379.330) (-367.182) [-367.456] -- 0:01:35
      21000 -- (-369.049) (-370.247) (-368.370) [-375.584] * (-370.806) (-374.081) [-371.312] (-367.087) -- 0:01:33
      21500 -- (-367.262) (-366.915) [-364.867] (-379.844) * (-367.162) (-375.924) [-373.310] (-368.105) -- 0:01:31
      22000 -- (-366.653) (-367.576) [-366.892] (-373.657) * (-365.799) (-373.391) (-371.881) [-367.903] -- 0:01:28
      22500 -- (-365.675) (-366.277) [-366.938] (-379.617) * (-364.953) [-375.478] (-368.052) (-366.073) -- 0:01:26
      23000 -- (-366.799) (-367.152) [-365.256] (-377.602) * [-366.979] (-382.299) (-366.273) (-367.240) -- 0:01:24
      23500 -- (-367.126) (-365.886) [-365.770] (-383.081) * (-369.509) (-380.073) (-369.083) [-367.842] -- 0:01:23
      24000 -- [-366.795] (-366.738) (-365.911) (-374.782) * [-365.926] (-386.557) (-365.678) (-364.786) -- 0:01:21
      24500 -- (-364.668) (-368.848) [-365.768] (-378.512) * (-365.244) [-370.941] (-369.667) (-366.099) -- 0:01:19
      25000 -- (-365.184) (-365.686) [-368.748] (-374.052) * [-366.019] (-368.033) (-373.921) (-368.319) -- 0:01:18

      Average standard deviation of split frequencies: 0.031082

      25500 -- (-367.590) [-368.360] (-367.446) (-373.693) * (-366.812) [-368.332] (-371.743) (-368.303) -- 0:01:16
      26000 -- (-365.302) (-365.999) [-364.969] (-376.913) * (-366.661) [-365.255] (-369.422) (-367.576) -- 0:01:14
      26500 -- (-366.746) (-369.030) [-366.647] (-373.193) * (-368.117) [-367.360] (-365.765) (-369.699) -- 0:01:13
      27000 -- (-368.011) (-366.964) (-365.741) [-370.611] * (-366.095) (-366.070) [-368.981] (-369.652) -- 0:01:12
      27500 -- (-366.455) (-364.891) [-369.100] (-380.480) * (-367.214) (-365.281) (-367.351) [-366.130] -- 0:01:10
      28000 -- (-367.685) [-364.705] (-369.013) (-377.247) * (-368.187) [-368.434] (-366.091) (-365.679) -- 0:01:09
      28500 -- [-366.701] (-365.924) (-365.936) (-374.534) * (-372.176) [-366.658] (-365.962) (-365.421) -- 0:01:08
      29000 -- (-366.839) (-365.561) (-369.616) [-373.460] * (-368.814) (-366.954) (-364.672) [-366.744] -- 0:01:06
      29500 -- (-365.118) [-364.777] (-369.578) (-375.335) * [-366.978] (-368.484) (-365.506) (-366.283) -- 0:01:05
      30000 -- [-367.134] (-365.455) (-369.478) (-379.789) * (-365.687) (-370.192) [-366.774] (-365.798) -- 0:01:04

      Average standard deviation of split frequencies: 0.035136

      30500 -- (-366.468) [-367.834] (-367.512) (-383.542) * (-364.939) (-366.048) [-369.856] (-364.765) -- 0:01:03
      31000 -- (-368.020) (-368.516) [-368.406] (-387.030) * (-367.905) (-366.875) (-366.146) [-365.798] -- 0:01:02
      31500 -- (-365.126) (-370.479) (-366.637) [-380.312] * [-365.707] (-365.837) (-366.561) (-366.494) -- 0:01:01
      32000 -- (-368.450) (-366.722) (-366.488) [-382.681] * (-366.712) [-368.464] (-365.453) (-371.596) -- 0:01:00
      32500 -- (-367.123) [-365.442] (-370.081) (-379.293) * (-366.344) [-369.350] (-369.830) (-364.982) -- 0:00:59
      33000 -- [-367.405] (-364.887) (-368.101) (-387.068) * [-368.349] (-367.453) (-371.798) (-366.769) -- 0:00:58
      33500 -- [-365.815] (-365.276) (-366.577) (-381.583) * (-369.666) [-367.823] (-370.943) (-365.697) -- 0:00:57
      34000 -- (-372.227) [-365.304] (-365.922) (-373.175) * (-370.067) [-369.099] (-365.497) (-370.536) -- 0:00:56
      34500 -- (-367.341) (-364.873) [-367.371] (-375.787) * (-367.063) [-367.990] (-367.948) (-376.031) -- 0:00:55
      35000 -- (-364.774) (-365.891) [-367.540] (-367.289) * (-365.905) (-367.087) [-366.402] (-371.970) -- 0:00:55

      Average standard deviation of split frequencies: 0.039907

      35500 -- [-367.867] (-365.401) (-366.185) (-365.337) * [-367.903] (-365.642) (-365.861) (-365.273) -- 0:00:54
      36000 -- (-366.305) (-368.525) [-370.841] (-370.662) * (-367.969) (-366.602) [-366.251] (-365.872) -- 0:01:20
      36500 -- (-367.242) [-367.626] (-366.300) (-371.787) * (-371.925) (-365.776) [-365.533] (-365.654) -- 0:01:19
      37000 -- [-368.400] (-366.028) (-369.990) (-372.257) * [-365.558] (-365.806) (-368.638) (-365.380) -- 0:01:18
      37500 -- (-366.645) (-364.478) (-367.317) [-366.767] * (-365.185) [-369.497] (-371.280) (-367.819) -- 0:01:17
      38000 -- (-365.420) (-369.724) (-366.167) [-367.508] * (-365.299) (-364.900) (-368.077) [-367.682] -- 0:01:15
      38500 -- (-368.308) (-366.981) (-368.594) [-369.261] * [-366.180] (-369.179) (-369.049) (-368.908) -- 0:01:14
      39000 -- (-368.108) (-367.050) (-366.053) [-365.733] * (-365.629) (-368.948) (-366.683) [-364.872] -- 0:01:13
      39500 -- (-369.416) [-366.070] (-367.541) (-365.684) * (-366.222) (-365.553) (-367.213) [-365.604] -- 0:01:12
      40000 -- (-371.041) (-366.072) [-366.354] (-365.564) * (-366.998) (-367.877) (-368.427) [-368.168] -- 0:01:12

      Average standard deviation of split frequencies: 0.035355

      40500 -- (-365.487) (-364.675) (-365.349) [-365.027] * (-366.370) (-369.124) (-366.326) [-365.797] -- 0:01:11
      41000 -- (-365.635) [-364.836] (-367.277) (-368.079) * (-368.463) (-369.458) [-365.927] (-365.362) -- 0:01:10
      41500 -- (-365.862) (-368.255) (-366.354) [-368.056] * (-369.910) (-364.904) [-366.749] (-368.724) -- 0:01:09
      42000 -- (-366.054) [-367.182] (-366.592) (-365.336) * (-368.565) (-365.486) [-369.102] (-369.948) -- 0:01:08
      42500 -- (-366.049) (-368.998) (-366.535) [-365.400] * [-364.940] (-366.844) (-366.794) (-367.378) -- 0:01:07
      43000 -- (-369.466) (-369.004) (-369.409) [-367.442] * (-365.768) (-366.134) (-368.009) [-365.488] -- 0:01:06
      43500 -- (-368.505) (-365.605) [-371.142] (-365.731) * (-365.558) [-369.472] (-367.414) (-368.194) -- 0:01:05
      44000 -- [-369.186] (-366.142) (-365.506) (-366.352) * (-367.433) (-368.703) (-367.119) [-368.232] -- 0:01:05
      44500 -- (-364.770) [-366.566] (-365.615) (-366.392) * (-367.055) (-366.505) [-367.369] (-368.893) -- 0:01:04
      45000 -- (-365.200) [-365.417] (-365.557) (-367.725) * (-367.989) (-367.173) [-365.436] (-365.741) -- 0:01:03

      Average standard deviation of split frequencies: 0.034843

      45500 -- [-365.364] (-368.240) (-365.105) (-370.250) * (-369.361) (-365.100) [-365.772] (-366.173) -- 0:01:02
      46000 -- (-365.879) (-367.866) (-367.001) [-365.346] * (-366.579) [-368.550] (-366.792) (-367.802) -- 0:01:02
      46500 -- (-366.203) [-367.485] (-366.452) (-365.042) * (-365.777) (-366.025) [-366.622] (-369.428) -- 0:01:01
      47000 -- (-367.782) [-366.236] (-369.109) (-372.878) * (-364.539) (-371.199) (-367.003) [-366.831] -- 0:01:00
      47500 -- (-369.085) [-367.071] (-367.678) (-370.560) * (-364.821) [-372.232] (-370.372) (-366.285) -- 0:01:00
      48000 -- (-366.739) (-365.605) [-365.939] (-367.009) * [-365.006] (-368.807) (-365.915) (-366.515) -- 0:00:59
      48500 -- [-366.184] (-364.662) (-365.018) (-367.205) * (-365.872) (-369.919) [-365.809] (-365.693) -- 0:00:58
      49000 -- [-366.155] (-370.630) (-366.921) (-365.644) * (-367.111) (-368.333) [-367.808] (-365.800) -- 0:00:58
      49500 -- (-365.781) (-369.147) (-364.523) [-366.118] * [-366.676] (-366.832) (-365.175) (-365.239) -- 0:00:57
      50000 -- (-369.041) (-367.448) (-364.512) [-366.408] * (-365.914) (-366.184) [-365.169] (-366.660) -- 0:00:57

      Average standard deviation of split frequencies: 0.030361

      50500 -- [-368.177] (-367.642) (-365.401) (-366.264) * (-365.294) (-367.347) (-366.500) [-367.835] -- 0:00:56
      51000 -- (-367.522) (-368.568) (-366.524) [-366.421] * [-365.962] (-367.371) (-366.763) (-365.465) -- 0:01:14
      51500 -- (-367.294) (-367.308) (-366.753) [-364.874] * (-365.221) (-368.654) (-370.553) [-367.299] -- 0:01:13
      52000 -- (-364.933) [-366.044] (-367.044) (-366.501) * [-365.732] (-366.022) (-367.038) (-366.894) -- 0:01:12
      52500 -- (-366.593) [-365.101] (-366.068) (-367.879) * (-365.425) (-365.195) [-370.784] (-366.529) -- 0:01:12
      53000 -- [-365.589] (-366.802) (-367.489) (-371.995) * [-366.505] (-366.585) (-371.727) (-367.303) -- 0:01:11
      53500 -- (-365.948) (-368.770) [-371.451] (-367.267) * [-365.309] (-366.140) (-371.801) (-366.426) -- 0:01:10
      54000 -- (-366.139) (-371.482) [-366.675] (-366.987) * (-366.714) (-367.027) (-368.776) [-365.553] -- 0:01:10
      54500 -- [-367.686] (-366.956) (-368.450) (-365.656) * (-367.672) (-370.386) [-366.970] (-366.335) -- 0:01:09
      55000 -- (-366.778) (-367.228) (-364.835) [-369.265] * (-366.881) (-365.902) (-366.274) [-366.781] -- 0:01:08

      Average standard deviation of split frequencies: 0.028355

      55500 -- [-369.150] (-367.843) (-366.391) (-367.609) * (-368.218) [-366.384] (-366.518) (-365.579) -- 0:01:08
      56000 -- (-366.295) [-367.095] (-366.567) (-367.686) * (-367.404) (-366.764) (-369.502) [-366.508] -- 0:01:07
      56500 -- [-364.755] (-366.018) (-365.742) (-368.098) * (-368.117) [-367.186] (-367.330) (-365.949) -- 0:01:06
      57000 -- (-368.428) (-369.655) (-366.542) [-367.918] * [-366.856] (-368.101) (-369.131) (-367.365) -- 0:01:06
      57500 -- [-365.921] (-368.527) (-369.056) (-368.090) * [-369.521] (-365.002) (-366.322) (-365.851) -- 0:01:05
      58000 -- (-364.963) [-368.391] (-365.799) (-367.668) * [-366.023] (-367.649) (-370.024) (-365.955) -- 0:01:04
      58500 -- (-366.981) [-369.711] (-366.809) (-367.857) * (-370.662) [-367.115] (-367.320) (-366.586) -- 0:01:04
      59000 -- (-366.044) [-366.794] (-365.810) (-365.998) * (-368.942) (-369.215) [-365.931] (-367.558) -- 0:01:03
      59500 -- (-367.911) (-368.678) [-364.854] (-367.267) * [-367.520] (-371.127) (-368.049) (-369.810) -- 0:01:03
      60000 -- [-368.690] (-367.210) (-366.678) (-366.127) * (-365.029) (-370.357) [-368.082] (-368.617) -- 0:01:02

      Average standard deviation of split frequencies: 0.031513

      60500 -- (-366.150) [-365.206] (-368.809) (-365.572) * [-365.353] (-369.036) (-368.923) (-365.229) -- 0:01:02
      61000 -- (-366.752) [-367.665] (-367.206) (-369.545) * [-369.540] (-365.332) (-366.839) (-364.991) -- 0:01:01
      61500 -- (-367.370) [-365.480] (-366.402) (-368.882) * (-369.932) (-365.846) (-367.448) [-364.743] -- 0:01:01
      62000 -- (-371.638) [-366.304] (-368.908) (-367.271) * (-366.525) [-365.841] (-369.690) (-366.356) -- 0:01:00
      62500 -- (-366.850) [-365.007] (-365.170) (-366.577) * (-368.814) (-365.209) [-365.794] (-364.802) -- 0:01:00
      63000 -- [-367.064] (-365.150) (-366.271) (-368.912) * (-366.507) [-364.916] (-369.139) (-365.306) -- 0:00:59
      63500 -- (-368.043) (-365.776) [-369.757] (-366.489) * [-365.721] (-367.112) (-368.779) (-365.210) -- 0:00:58
      64000 -- (-367.464) [-367.109] (-370.369) (-365.327) * (-369.932) (-366.739) [-366.401] (-366.918) -- 0:00:58
      64500 -- (-365.796) [-365.623] (-365.745) (-365.604) * (-365.322) [-365.649] (-366.498) (-365.778) -- 0:00:58
      65000 -- (-369.587) [-367.002] (-366.173) (-367.672) * [-367.420] (-366.547) (-368.217) (-366.345) -- 0:00:57

      Average standard deviation of split frequencies: 0.026189

      65500 -- (-366.685) [-366.023] (-368.647) (-366.048) * (-365.279) [-365.761] (-365.515) (-366.219) -- 0:00:57
      66000 -- (-369.125) [-368.079] (-365.081) (-370.538) * [-365.289] (-366.876) (-368.192) (-367.965) -- 0:00:56
      66500 -- [-367.156] (-366.621) (-366.448) (-368.068) * (-365.825) (-373.954) [-365.924] (-366.790) -- 0:01:10
      67000 -- (-367.829) (-367.794) [-368.325] (-366.229) * (-367.630) (-370.596) (-367.976) [-366.929] -- 0:01:09
      67500 -- (-370.012) [-368.887] (-370.180) (-365.322) * (-368.519) [-367.002] (-370.502) (-364.629) -- 0:01:09
      68000 -- (-368.455) (-369.238) [-368.210] (-366.499) * (-365.966) (-366.075) [-365.855] (-365.316) -- 0:01:08
      68500 -- (-364.444) (-373.339) [-366.568] (-368.734) * [-366.038] (-364.416) (-365.412) (-367.337) -- 0:01:07
      69000 -- (-367.085) (-368.564) [-365.549] (-367.258) * (-366.895) (-367.174) [-365.982] (-366.436) -- 0:01:07
      69500 -- (-366.914) [-368.119] (-366.851) (-368.423) * (-369.000) (-368.192) (-367.413) [-367.331] -- 0:01:06
      70000 -- [-368.112] (-365.344) (-367.117) (-369.735) * (-371.147) (-367.977) [-366.342] (-365.922) -- 0:01:06

      Average standard deviation of split frequencies: 0.026366

      70500 -- (-368.756) (-366.884) (-366.449) [-366.633] * [-365.000] (-370.556) (-371.292) (-365.789) -- 0:01:05
      71000 -- (-366.109) (-367.716) (-370.989) [-368.893] * (-366.242) (-367.946) [-365.184] (-366.362) -- 0:01:05
      71500 -- [-365.146] (-373.349) (-369.094) (-366.667) * (-366.850) [-367.257] (-370.017) (-366.007) -- 0:01:04
      72000 -- (-365.077) (-368.371) [-366.594] (-366.078) * [-368.041] (-365.628) (-367.763) (-365.962) -- 0:01:04
      72500 -- (-367.716) (-368.417) [-366.801] (-369.269) * (-367.093) (-366.070) (-366.758) [-367.638] -- 0:01:03
      73000 -- (-367.352) (-367.512) (-366.459) [-367.009] * (-367.531) (-368.723) [-365.050] (-365.224) -- 0:01:03
      73500 -- (-365.313) [-366.101] (-367.559) (-366.268) * (-365.544) (-366.058) [-364.629] (-364.979) -- 0:01:03
      74000 -- (-365.639) (-366.966) [-366.022] (-368.615) * (-365.475) (-366.404) (-369.947) [-367.247] -- 0:01:02
      74500 -- [-364.879] (-367.481) (-365.586) (-367.094) * (-366.293) [-367.866] (-372.206) (-369.241) -- 0:01:02
      75000 -- (-366.070) (-366.477) (-366.445) [-365.799] * [-368.364] (-367.511) (-365.271) (-369.677) -- 0:01:01

      Average standard deviation of split frequencies: 0.028532

      75500 -- (-367.419) (-365.700) [-366.143] (-366.861) * [-367.550] (-366.015) (-368.922) (-365.007) -- 0:01:01
      76000 -- (-366.704) (-365.626) (-366.779) [-368.157] * (-366.978) (-365.492) (-369.514) [-364.899] -- 0:01:00
      76500 -- (-366.683) (-365.735) [-365.689] (-370.771) * (-370.871) [-364.824] (-373.671) (-367.066) -- 0:01:00
      77000 -- (-368.571) (-366.140) (-366.901) [-367.390] * (-367.080) (-368.038) (-368.341) [-366.749] -- 0:00:59
      77500 -- (-369.535) (-368.341) [-366.799] (-367.494) * [-367.662] (-365.839) (-371.353) (-367.166) -- 0:00:59
      78000 -- (-368.068) (-367.286) [-365.637] (-367.827) * (-367.734) (-368.594) [-368.940] (-366.320) -- 0:00:59
      78500 -- (-364.776) (-364.743) (-367.550) [-369.707] * (-366.991) [-368.787] (-370.214) (-369.416) -- 0:00:58
      79000 -- [-371.183] (-371.453) (-368.767) (-369.205) * (-374.579) [-365.530] (-368.361) (-365.944) -- 0:00:58
      79500 -- [-367.493] (-367.119) (-367.795) (-369.076) * (-370.140) (-368.593) [-365.948] (-366.008) -- 0:00:57
      80000 -- [-367.922] (-369.113) (-371.958) (-368.500) * (-365.606) [-368.964] (-369.329) (-366.715) -- 0:00:57

      Average standard deviation of split frequencies: 0.032559

      80500 -- [-365.652] (-368.032) (-371.339) (-369.235) * (-365.612) (-368.243) [-364.440] (-365.368) -- 0:00:57
      81000 -- (-367.300) (-369.123) [-368.861] (-369.697) * (-368.504) [-369.911] (-366.187) (-365.782) -- 0:00:56
      81500 -- (-370.717) (-366.694) [-368.434] (-371.718) * (-365.675) (-365.925) [-368.929] (-366.727) -- 0:00:56
      82000 -- (-365.654) (-369.668) (-367.458) [-366.228] * [-365.615] (-366.241) (-366.541) (-370.418) -- 0:00:55
      82500 -- [-366.982] (-369.132) (-368.469) (-366.859) * [-367.711] (-366.342) (-366.135) (-371.096) -- 0:00:55
      83000 -- (-367.751) (-369.058) (-366.550) [-365.114] * (-369.506) (-369.001) [-364.534] (-366.811) -- 0:00:55
      83500 -- (-365.777) (-366.685) (-368.592) [-367.509] * (-366.054) (-365.773) [-365.885] (-365.486) -- 0:00:54
      84000 -- (-369.341) (-365.018) (-365.485) [-365.480] * [-365.701] (-366.938) (-367.602) (-375.172) -- 0:01:05
      84500 -- (-367.390) (-365.117) [-365.584] (-371.144) * [-365.709] (-368.906) (-367.239) (-373.460) -- 0:01:05
      85000 -- [-367.816] (-366.323) (-366.057) (-365.258) * (-369.190) [-366.560] (-366.462) (-371.759) -- 0:01:04

      Average standard deviation of split frequencies: 0.029650

      85500 -- (-365.749) (-368.141) [-365.582] (-367.555) * [-366.373] (-367.120) (-367.192) (-366.141) -- 0:01:04
      86000 -- (-371.561) [-365.785] (-368.959) (-366.778) * (-365.873) (-365.072) (-367.167) [-365.714] -- 0:01:03
      86500 -- (-373.571) [-365.890] (-369.150) (-371.290) * (-366.171) [-368.750] (-366.655) (-366.526) -- 0:01:03
      87000 -- (-367.704) (-367.380) (-366.158) [-365.269] * (-366.506) [-368.978] (-365.689) (-367.500) -- 0:01:02
      87500 -- (-366.505) (-366.668) (-374.016) [-366.216] * [-365.907] (-367.521) (-369.651) (-369.408) -- 0:01:02
      88000 -- (-368.451) (-368.928) (-367.526) [-366.349] * (-366.031) [-365.934] (-365.734) (-367.345) -- 0:01:02
      88500 -- [-369.222] (-368.531) (-366.275) (-367.940) * (-369.661) [-367.403] (-368.075) (-367.615) -- 0:01:01
      89000 -- (-369.684) [-367.043] (-369.094) (-367.087) * [-367.072] (-368.583) (-366.866) (-364.844) -- 0:01:01
      89500 -- (-366.523) (-367.456) (-365.272) [-366.616] * [-367.388] (-372.953) (-368.157) (-364.804) -- 0:01:01
      90000 -- (-368.504) [-366.518] (-366.626) (-365.135) * (-364.653) (-366.602) (-367.293) [-365.385] -- 0:01:00

      Average standard deviation of split frequencies: 0.033456

      90500 -- (-371.091) [-366.608] (-365.985) (-367.377) * [-365.522] (-367.462) (-366.030) (-365.621) -- 0:01:00
      91000 -- (-372.678) (-365.173) (-366.262) [-366.524] * (-367.027) (-367.999) [-366.596] (-366.199) -- 0:00:59
      91500 -- (-366.620) (-364.910) [-367.428] (-366.361) * [-365.788] (-366.368) (-366.822) (-366.234) -- 0:00:59
      92000 -- (-367.691) (-366.825) (-366.445) [-365.802] * (-369.064) (-365.801) (-369.407) [-366.705] -- 0:00:59
      92500 -- (-365.873) [-366.232] (-365.420) (-366.005) * (-365.453) [-367.227] (-364.946) (-369.159) -- 0:00:58
      93000 -- (-365.725) [-365.839] (-368.520) (-368.026) * [-366.078] (-365.353) (-367.783) (-369.776) -- 0:00:58
      93500 -- (-366.690) (-367.652) (-366.249) [-365.860] * (-368.726) [-366.372] (-372.047) (-367.587) -- 0:00:58
      94000 -- (-367.186) (-368.424) [-366.195] (-365.314) * (-366.185) (-368.601) (-368.329) [-367.420] -- 0:00:57
      94500 -- (-365.828) (-367.705) [-367.591] (-367.414) * [-369.655] (-367.168) (-365.470) (-366.500) -- 0:00:57
      95000 -- [-365.452] (-365.613) (-367.236) (-370.065) * (-368.539) (-367.139) [-367.054] (-366.693) -- 0:00:57

      Average standard deviation of split frequencies: 0.032879

      95500 -- (-366.959) (-368.523) [-367.340] (-369.626) * (-370.627) [-368.439] (-366.013) (-369.863) -- 0:00:56
      96000 -- [-367.929] (-370.065) (-365.302) (-366.605) * [-366.857] (-367.128) (-365.126) (-367.655) -- 0:00:56
      96500 -- (-367.356) (-366.519) [-366.858] (-366.149) * [-368.171] (-367.436) (-365.792) (-370.646) -- 0:00:56
      97000 -- (-364.893) (-367.970) (-369.591) [-366.859] * (-364.510) [-364.821] (-365.471) (-365.292) -- 0:00:55
      97500 -- (-366.864) [-365.669] (-364.688) (-373.156) * (-370.024) (-365.311) (-366.224) [-366.425] -- 0:00:55
      98000 -- (-366.839) (-366.300) (-366.354) [-365.844] * [-368.334] (-366.049) (-366.377) (-368.414) -- 0:00:55
      98500 -- (-366.469) (-367.658) (-367.515) [-367.162] * (-365.911) (-364.450) [-370.723] (-369.111) -- 0:00:54
      99000 -- [-367.885] (-367.274) (-366.162) (-368.134) * [-365.645] (-368.714) (-365.791) (-367.818) -- 0:00:54
      99500 -- [-367.165] (-370.195) (-369.108) (-370.945) * [-364.827] (-367.370) (-365.961) (-365.916) -- 0:00:54
      100000 -- [-373.106] (-369.436) (-367.176) (-367.361) * (-367.904) (-364.803) [-364.732] (-369.296) -- 0:00:54

      Average standard deviation of split frequencies: 0.031219

      100500 -- (-367.829) (-365.595) [-365.634] (-367.104) * [-365.963] (-367.311) (-366.531) (-365.487) -- 0:00:53
      101000 -- (-367.927) (-368.162) [-366.392] (-367.731) * (-365.495) (-365.822) [-365.866] (-367.303) -- 0:01:02
      101500 -- (-364.644) (-369.417) [-367.852] (-372.782) * (-368.451) (-365.362) [-366.483] (-366.963) -- 0:01:01
      102000 -- (-365.092) (-367.389) (-365.447) [-369.319] * (-365.765) (-368.857) (-367.372) [-366.170] -- 0:01:01
      102500 -- (-371.397) (-368.770) [-365.632] (-365.719) * [-364.511] (-366.381) (-365.962) (-373.371) -- 0:01:01
      103000 -- (-365.263) (-366.002) (-366.923) [-368.105] * (-364.985) (-366.049) [-367.742] (-368.370) -- 0:01:00
      103500 -- (-367.576) [-366.729] (-364.990) (-365.464) * (-365.011) (-366.019) (-369.453) [-365.762] -- 0:01:00
      104000 -- (-370.860) (-366.512) [-366.568] (-369.907) * (-368.152) [-366.020] (-369.222) (-365.365) -- 0:01:00
      104500 -- (-366.526) (-367.183) (-367.250) [-366.445] * (-367.687) (-368.123) [-367.193] (-369.699) -- 0:00:59
      105000 -- [-365.191] (-367.391) (-365.711) (-366.616) * (-366.874) (-370.340) [-366.698] (-364.677) -- 0:00:59

      Average standard deviation of split frequencies: 0.029715

      105500 -- [-364.898] (-365.445) (-366.684) (-367.321) * (-365.510) (-366.499) [-366.798] (-365.104) -- 0:00:59
      106000 -- (-364.822) [-365.342] (-369.253) (-366.147) * [-366.270] (-365.491) (-366.663) (-371.158) -- 0:00:59
      106500 -- (-365.700) (-365.916) (-369.819) [-365.404] * (-368.081) (-365.960) [-365.101] (-373.999) -- 0:00:58
      107000 -- (-365.449) (-366.445) [-369.831] (-367.513) * (-367.421) (-366.858) [-368.068] (-368.648) -- 0:00:58
      107500 -- (-367.170) [-365.412] (-368.730) (-369.163) * [-367.153] (-366.923) (-366.237) (-369.601) -- 0:00:58
      108000 -- (-369.781) [-370.535] (-367.596) (-373.498) * (-367.977) [-365.506] (-368.575) (-371.327) -- 0:00:57
      108500 -- (-366.746) (-366.663) [-369.281] (-367.150) * (-366.785) (-367.156) [-365.660] (-367.871) -- 0:00:57
      109000 -- (-365.352) (-373.200) (-370.453) [-366.665] * (-367.395) (-365.006) [-365.840] (-366.050) -- 0:00:57
      109500 -- (-364.867) (-370.373) [-364.574] (-365.578) * (-365.622) (-368.441) (-366.785) [-370.625] -- 0:00:56
      110000 -- (-364.944) (-374.922) (-370.281) [-364.955] * (-365.710) (-366.689) [-366.400] (-365.716) -- 0:00:56

      Average standard deviation of split frequencies: 0.029594

      110500 -- (-366.556) (-365.880) [-370.981] (-366.432) * (-365.501) [-366.331] (-371.620) (-369.441) -- 0:00:56
      111000 -- (-366.117) (-366.071) (-368.128) [-367.261] * (-364.804) (-365.291) (-365.823) [-367.520] -- 0:00:56
      111500 -- (-367.163) [-365.720] (-368.352) (-365.981) * [-368.289] (-368.557) (-368.525) (-366.688) -- 0:00:55
      112000 -- [-365.207] (-366.964) (-369.788) (-365.798) * (-366.861) (-367.404) [-367.480] (-369.085) -- 0:00:55
      112500 -- (-366.074) (-367.015) (-369.175) [-367.116] * (-366.048) (-367.101) [-368.612] (-370.005) -- 0:00:55
      113000 -- (-364.641) (-366.893) (-367.234) [-364.794] * (-368.119) (-367.550) (-365.068) [-367.384] -- 0:00:54
      113500 -- [-366.875] (-365.774) (-368.810) (-367.148) * (-366.591) (-370.516) [-365.450] (-364.714) -- 0:00:54
      114000 -- [-366.868] (-367.822) (-367.062) (-365.478) * [-367.772] (-368.657) (-371.080) (-366.094) -- 0:00:54
      114500 -- (-369.678) [-365.715] (-366.850) (-367.991) * (-364.963) (-365.930) [-364.844] (-366.159) -- 0:00:54
      115000 -- [-364.818] (-366.602) (-367.334) (-364.820) * (-367.776) (-370.664) (-366.124) [-367.582] -- 0:00:53

      Average standard deviation of split frequencies: 0.030276

      115500 -- (-366.969) [-365.691] (-366.804) (-368.766) * (-367.388) [-367.271] (-367.607) (-368.316) -- 0:00:53
      116000 -- (-367.103) [-365.676] (-365.476) (-367.864) * (-370.118) [-366.300] (-367.475) (-368.935) -- 0:00:53
      116500 -- (-365.513) (-365.495) [-369.075] (-367.073) * (-367.957) [-366.829] (-365.719) (-367.213) -- 0:00:53
      117000 -- (-371.684) (-365.730) (-368.905) [-367.552] * (-366.070) (-369.382) (-365.040) [-365.248] -- 0:00:52
      117500 -- (-367.084) [-368.381] (-365.695) (-368.825) * (-367.934) (-365.214) [-368.169] (-365.494) -- 0:00:52
      118000 -- [-366.026] (-367.160) (-365.346) (-365.131) * (-368.953) [-368.293] (-368.528) (-369.581) -- 0:00:59
      118500 -- (-366.554) (-365.329) [-366.461] (-367.322) * (-372.102) (-368.469) [-366.280] (-365.540) -- 0:00:59
      119000 -- (-365.700) (-367.217) [-365.433] (-366.358) * [-365.971] (-367.327) (-367.121) (-366.215) -- 0:00:59
      119500 -- (-366.388) (-366.423) (-364.818) [-365.388] * (-364.939) [-369.108] (-368.052) (-368.081) -- 0:00:58
      120000 -- (-368.211) [-367.416] (-367.178) (-366.475) * [-365.632] (-366.936) (-369.127) (-365.562) -- 0:00:58

      Average standard deviation of split frequencies: 0.029197

      120500 -- [-365.961] (-366.394) (-369.351) (-368.045) * [-366.171] (-368.092) (-365.813) (-366.888) -- 0:00:58
      121000 -- (-366.629) [-365.239] (-366.605) (-373.766) * (-366.828) (-365.809) [-367.709] (-365.739) -- 0:00:58
      121500 -- [-366.316] (-367.168) (-370.552) (-365.983) * (-365.788) [-372.710] (-364.687) (-367.423) -- 0:00:57
      122000 -- (-365.774) (-366.749) [-366.702] (-364.963) * (-367.248) (-367.780) [-366.073] (-365.720) -- 0:00:57
      122500 -- [-367.421] (-372.593) (-365.873) (-364.978) * (-365.224) (-366.751) (-366.898) [-364.811] -- 0:00:57
      123000 -- (-366.851) (-365.530) [-365.833] (-367.149) * [-365.113] (-365.260) (-367.830) (-367.084) -- 0:00:57
      123500 -- (-365.463) (-368.349) [-366.675] (-366.931) * (-366.903) [-364.474] (-368.782) (-364.568) -- 0:00:56
      124000 -- (-366.256) [-365.260] (-367.231) (-365.083) * (-368.993) [-364.969] (-369.647) (-370.222) -- 0:00:56
      124500 -- (-366.325) [-367.809] (-367.166) (-368.512) * [-366.234] (-365.944) (-370.042) (-366.511) -- 0:00:56
      125000 -- (-366.335) (-366.005) (-366.278) [-365.299] * (-372.252) [-365.971] (-373.590) (-366.544) -- 0:00:56

      Average standard deviation of split frequencies: 0.026750

      125500 -- (-373.287) (-365.201) [-369.322] (-368.825) * (-366.239) [-365.766] (-367.181) (-365.068) -- 0:00:55
      126000 -- (-370.770) [-365.353] (-366.704) (-365.085) * (-364.454) (-366.490) [-368.939] (-367.798) -- 0:00:55
      126500 -- (-372.211) (-368.623) (-374.296) [-366.118] * [-365.594] (-368.971) (-368.817) (-367.151) -- 0:00:55
      127000 -- [-365.464] (-367.043) (-377.965) (-365.298) * (-368.762) (-368.626) [-365.065] (-364.990) -- 0:00:54
      127500 -- (-367.720) [-366.219] (-374.050) (-368.490) * [-364.442] (-368.154) (-367.684) (-366.176) -- 0:00:54
      128000 -- (-364.645) (-366.231) (-370.027) [-369.518] * (-366.061) (-367.333) (-365.717) [-370.739] -- 0:00:54
      128500 -- (-369.542) [-366.241] (-370.522) (-369.934) * [-365.942] (-366.837) (-365.619) (-367.920) -- 0:00:54
      129000 -- [-365.946] (-366.786) (-371.531) (-366.925) * (-368.522) (-365.521) [-366.369] (-366.616) -- 0:00:54
      129500 -- [-366.396] (-366.712) (-372.322) (-368.018) * (-369.077) (-365.583) (-364.781) [-366.746] -- 0:00:53
      130000 -- (-367.381) [-366.624] (-368.432) (-366.151) * (-368.564) (-365.868) [-364.512] (-366.857) -- 0:00:53

      Average standard deviation of split frequencies: 0.025823

      130500 -- [-365.348] (-366.306) (-368.759) (-367.962) * (-369.206) (-367.708) [-365.904] (-365.634) -- 0:00:53
      131000 -- [-368.738] (-367.509) (-366.548) (-368.909) * (-370.896) (-365.269) [-367.157] (-367.299) -- 0:00:53
      131500 -- (-369.169) (-368.316) (-367.606) [-367.613] * (-366.290) [-367.974] (-366.189) (-369.026) -- 0:00:52
      132000 -- (-366.915) (-367.711) (-365.110) [-367.142] * (-365.879) [-368.931] (-367.306) (-372.871) -- 0:00:52
      132500 -- (-366.799) [-364.950] (-368.327) (-368.787) * (-365.874) [-367.909] (-368.450) (-364.613) -- 0:00:52
      133000 -- (-365.384) (-364.723) [-366.875] (-369.520) * (-365.393) [-365.890] (-365.735) (-366.628) -- 0:00:52
      133500 -- (-364.996) (-366.933) [-364.614] (-366.118) * (-365.415) [-366.824] (-365.200) (-367.201) -- 0:00:51
      134000 -- [-364.759] (-366.445) (-367.305) (-366.864) * (-367.603) (-365.637) (-365.851) [-366.515] -- 0:00:51
      134500 -- (-365.425) (-367.068) [-366.391] (-365.983) * (-365.380) (-366.620) (-365.322) [-369.413] -- 0:00:51
      135000 -- [-366.278] (-367.598) (-365.916) (-365.312) * (-365.315) (-365.161) (-366.592) [-364.553] -- 0:00:51

      Average standard deviation of split frequencies: 0.022986

      135500 -- (-365.468) (-365.231) (-365.544) [-367.134] * (-369.299) [-365.591] (-365.081) (-365.812) -- 0:00:57
      136000 -- (-370.506) (-367.034) [-365.503] (-366.635) * (-367.509) (-365.285) [-366.912] (-367.409) -- 0:00:57
      136500 -- [-365.812] (-367.469) (-365.769) (-369.623) * (-367.496) (-364.617) (-365.419) [-366.625] -- 0:00:56
      137000 -- [-370.530] (-366.805) (-365.127) (-365.964) * (-365.904) (-366.647) (-365.481) [-367.545] -- 0:00:56
      137500 -- (-365.721) (-366.061) (-365.908) [-368.249] * [-367.727] (-364.699) (-369.006) (-368.387) -- 0:00:56
      138000 -- [-364.828] (-366.164) (-365.316) (-364.483) * (-367.571) (-364.826) (-369.467) [-365.384] -- 0:00:56
      138500 -- (-366.101) [-365.942] (-366.423) (-367.263) * (-372.251) [-368.452] (-368.724) (-364.859) -- 0:00:55
      139000 -- (-365.847) (-368.817) [-365.758] (-366.553) * (-371.095) (-366.339) [-365.521] (-365.507) -- 0:00:55
      139500 -- (-367.737) (-368.250) [-368.215] (-366.488) * (-367.693) [-364.957] (-369.583) (-366.449) -- 0:00:55
      140000 -- (-366.576) [-366.422] (-365.023) (-369.705) * (-366.853) (-365.683) (-368.467) [-365.133] -- 0:00:55

      Average standard deviation of split frequencies: 0.021411

      140500 -- (-368.132) (-367.024) [-366.026] (-368.776) * (-365.864) (-365.859) [-365.842] (-366.349) -- 0:00:55
      141000 -- (-366.347) (-365.105) [-367.205] (-366.525) * (-371.410) (-366.417) (-365.638) [-367.670] -- 0:00:54
      141500 -- (-366.157) (-366.504) (-367.983) [-367.411] * [-365.064] (-367.044) (-366.445) (-369.747) -- 0:00:54
      142000 -- (-365.463) (-365.916) (-365.957) [-366.332] * (-368.114) (-368.803) (-364.757) [-364.566] -- 0:00:54
      142500 -- [-367.188] (-364.979) (-365.591) (-366.853) * (-368.459) (-366.119) (-366.107) [-365.391] -- 0:00:54
      143000 -- [-365.645] (-364.654) (-365.512) (-366.442) * [-366.362] (-366.879) (-366.210) (-367.679) -- 0:00:53
      143500 -- (-369.030) (-369.061) (-366.005) [-366.785] * (-370.175) (-367.139) (-366.050) [-367.120] -- 0:00:53
      144000 -- [-366.486] (-364.475) (-366.771) (-366.321) * (-367.236) (-368.688) [-365.737] (-367.518) -- 0:00:53
      144500 -- (-366.336) (-365.320) (-364.525) [-365.212] * (-372.053) (-367.807) (-367.612) [-367.068] -- 0:00:53
      145000 -- (-367.986) (-366.045) [-374.444] (-366.224) * (-367.903) [-368.852] (-367.331) (-366.148) -- 0:00:53

      Average standard deviation of split frequencies: 0.019050

      145500 -- (-366.024) [-367.570] (-366.994) (-367.789) * (-365.442) (-369.939) (-366.942) [-365.799] -- 0:00:52
      146000 -- (-365.592) (-365.797) [-364.661] (-366.981) * (-366.204) (-368.639) [-365.555] (-365.609) -- 0:00:52
      146500 -- (-366.337) (-365.770) (-366.949) [-364.984] * (-369.850) (-367.003) (-367.737) [-364.526] -- 0:00:52
      147000 -- (-368.512) [-365.724] (-365.784) (-364.715) * [-364.759] (-365.721) (-366.098) (-366.904) -- 0:00:52
      147500 -- [-367.171] (-366.512) (-367.032) (-366.144) * (-366.901) (-367.777) [-367.679] (-368.353) -- 0:00:52
      148000 -- [-365.509] (-365.152) (-365.860) (-365.576) * (-366.959) (-371.720) [-365.752] (-365.092) -- 0:00:51
      148500 -- (-365.407) [-366.353] (-372.643) (-366.569) * (-368.380) [-365.296] (-366.159) (-367.410) -- 0:00:51
      149000 -- (-365.191) (-369.162) [-366.987] (-368.338) * [-367.519] (-366.462) (-367.147) (-366.964) -- 0:00:51
      149500 -- [-365.939] (-366.081) (-365.408) (-368.778) * (-368.786) [-367.780] (-365.076) (-370.252) -- 0:00:51
      150000 -- (-368.704) [-365.797] (-367.631) (-366.250) * [-367.902] (-367.145) (-367.176) (-365.651) -- 0:00:51

      Average standard deviation of split frequencies: 0.017126

      150500 -- (-372.234) (-367.770) [-364.670] (-365.695) * (-366.922) [-365.900] (-368.171) (-366.119) -- 0:00:50
      151000 -- (-367.810) [-366.471] (-367.150) (-366.926) * [-368.009] (-366.519) (-366.036) (-366.551) -- 0:00:50
      151500 -- (-365.805) (-367.202) [-366.277] (-367.775) * (-367.579) (-365.363) (-366.398) [-367.185] -- 0:00:50
      152000 -- (-364.657) [-367.559] (-371.370) (-369.756) * [-365.215] (-366.351) (-369.958) (-366.129) -- 0:00:50
      152500 -- [-364.501] (-368.267) (-371.810) (-368.771) * [-367.660] (-366.221) (-368.989) (-366.405) -- 0:00:55
      153000 -- [-365.660] (-367.521) (-372.256) (-368.022) * (-367.819) [-367.217] (-367.073) (-366.259) -- 0:00:55
      153500 -- (-367.141) (-365.975) (-370.304) [-368.591] * (-366.750) (-373.608) [-369.921] (-367.648) -- 0:00:55
      154000 -- (-367.760) [-366.000] (-365.753) (-366.712) * [-369.181] (-367.772) (-367.269) (-365.014) -- 0:00:54
      154500 -- (-366.574) [-365.854] (-366.591) (-367.232) * [-366.409] (-366.183) (-367.650) (-364.961) -- 0:00:54
      155000 -- (-367.925) (-365.219) (-364.698) [-365.770] * (-369.580) (-366.370) (-370.234) [-365.165] -- 0:00:54

      Average standard deviation of split frequencies: 0.021656

      155500 -- (-367.119) (-365.256) (-365.818) [-365.154] * (-364.551) [-364.919] (-366.368) (-368.674) -- 0:00:54
      156000 -- (-368.652) (-366.411) (-370.689) [-366.319] * [-365.711] (-370.103) (-366.745) (-372.760) -- 0:00:54
      156500 -- (-369.574) (-364.944) [-366.316] (-366.139) * (-365.939) [-369.744] (-366.907) (-368.333) -- 0:00:53
      157000 -- [-367.460] (-365.807) (-367.941) (-364.730) * (-365.964) (-372.601) [-364.661] (-367.670) -- 0:00:53
      157500 -- (-366.988) [-368.292] (-366.237) (-367.747) * [-365.329] (-369.420) (-366.045) (-366.271) -- 0:00:53
      158000 -- (-366.087) (-369.007) [-366.200] (-367.916) * (-366.723) (-368.346) [-365.409] (-366.504) -- 0:00:53
      158500 -- (-367.732) (-368.334) (-370.269) [-370.348] * (-366.399) [-367.744] (-366.062) (-365.807) -- 0:00:53
      159000 -- (-364.836) [-365.156] (-369.368) (-369.942) * (-365.889) (-366.080) [-371.346] (-369.835) -- 0:00:52
      159500 -- [-367.403] (-367.655) (-368.538) (-364.902) * (-365.640) (-367.360) (-366.747) [-366.170] -- 0:00:52
      160000 -- (-369.985) (-367.970) [-369.355] (-365.919) * [-370.281] (-366.195) (-365.501) (-366.423) -- 0:00:52

      Average standard deviation of split frequencies: 0.021027

      160500 -- (-370.093) (-367.108) (-369.127) [-365.935] * (-370.214) (-369.692) [-364.704] (-366.718) -- 0:00:52
      161000 -- (-370.947) [-365.755] (-368.143) (-365.271) * [-368.665] (-368.338) (-365.809) (-366.058) -- 0:00:52
      161500 -- (-371.586) (-368.134) (-366.460) [-367.942] * (-370.407) (-370.242) (-366.557) [-366.887] -- 0:00:51
      162000 -- (-367.424) [-367.147] (-371.983) (-368.469) * [-368.265] (-367.365) (-367.056) (-367.190) -- 0:00:51
      162500 -- (-367.151) (-367.761) (-366.304) [-368.218] * (-365.389) [-365.878] (-366.567) (-367.942) -- 0:00:51
      163000 -- [-365.249] (-366.556) (-367.734) (-366.139) * [-371.747] (-365.172) (-365.206) (-364.839) -- 0:00:51
      163500 -- [-368.971] (-366.552) (-368.665) (-364.795) * (-374.708) [-366.386] (-365.076) (-365.388) -- 0:00:51
      164000 -- [-364.865] (-364.653) (-366.773) (-366.017) * (-371.105) (-364.441) (-368.077) [-368.583] -- 0:00:50
      164500 -- (-367.133) (-366.382) [-366.176] (-365.042) * [-364.919] (-367.067) (-367.423) (-367.089) -- 0:00:50
      165000 -- (-366.677) [-367.862] (-368.135) (-365.923) * (-368.589) [-364.675] (-367.260) (-369.761) -- 0:00:50

      Average standard deviation of split frequencies: 0.021456

      165500 -- [-367.359] (-367.750) (-366.642) (-366.470) * (-365.364) [-364.646] (-371.831) (-365.623) -- 0:00:50
      166000 -- (-369.122) (-369.248) [-366.631] (-365.551) * (-366.053) [-366.996] (-369.133) (-364.910) -- 0:00:50
      166500 -- (-368.773) (-368.213) [-365.622] (-364.667) * (-367.832) (-368.572) (-365.519) [-365.218] -- 0:00:50
      167000 -- (-368.585) (-368.419) (-366.831) [-364.561] * [-365.141] (-370.492) (-368.544) (-367.218) -- 0:00:49
      167500 -- (-366.717) (-367.419) (-365.650) [-365.283] * [-366.748] (-364.721) (-367.296) (-365.488) -- 0:00:49
      168000 -- (-365.898) [-366.829] (-365.108) (-366.514) * [-364.983] (-368.368) (-366.073) (-369.832) -- 0:00:49
      168500 -- (-367.938) [-365.475] (-368.814) (-366.358) * (-368.123) [-367.441] (-370.592) (-364.514) -- 0:00:49
      169000 -- [-367.778] (-368.225) (-368.159) (-365.250) * (-368.386) [-369.416] (-368.306) (-368.072) -- 0:00:49
      169500 -- (-366.770) (-371.299) [-367.615] (-368.432) * (-366.713) [-365.119] (-369.142) (-367.415) -- 0:00:53
      170000 -- [-365.754] (-364.503) (-367.502) (-367.433) * (-366.253) [-365.135] (-367.554) (-367.136) -- 0:00:53

      Average standard deviation of split frequencies: 0.020797

      170500 -- (-368.395) (-364.882) (-367.018) [-365.820] * (-364.784) (-366.589) [-369.320] (-366.870) -- 0:00:53
      171000 -- (-367.984) [-367.171] (-366.067) (-368.742) * [-366.166] (-367.219) (-367.200) (-364.935) -- 0:00:53
      171500 -- (-369.999) (-365.380) (-366.128) [-367.258] * [-367.642] (-367.271) (-368.390) (-368.101) -- 0:00:53
      172000 -- (-367.077) [-365.639] (-368.326) (-365.931) * [-366.388] (-367.609) (-367.444) (-370.366) -- 0:00:52
      172500 -- (-366.017) (-367.016) (-371.123) [-367.854] * [-365.068] (-364.939) (-364.993) (-365.147) -- 0:00:52
      173000 -- (-366.955) [-366.489] (-371.289) (-371.894) * (-368.058) (-367.233) [-364.933] (-367.419) -- 0:00:52
      173500 -- (-369.565) (-370.782) [-366.241] (-368.497) * (-365.120) (-365.023) (-365.327) [-366.557] -- 0:00:52
      174000 -- [-366.228] (-367.751) (-365.461) (-369.395) * (-365.301) [-367.413] (-370.708) (-365.220) -- 0:00:52
      174500 -- (-365.093) (-365.345) [-364.880] (-365.434) * (-365.977) (-364.916) [-367.613] (-367.831) -- 0:00:52
      175000 -- (-366.384) [-365.272] (-367.408) (-366.347) * (-367.242) (-367.098) (-365.302) [-367.872] -- 0:00:51

      Average standard deviation of split frequencies: 0.020482

      175500 -- (-366.436) (-366.522) (-369.823) [-366.393] * (-367.173) (-367.493) (-368.347) [-366.606] -- 0:00:51
      176000 -- (-369.097) (-367.704) [-367.097] (-367.522) * (-366.114) [-365.682] (-366.828) (-368.191) -- 0:00:51
      176500 -- (-365.826) (-367.681) (-367.298) [-368.757] * [-366.511] (-366.715) (-365.687) (-368.496) -- 0:00:51
      177000 -- (-366.253) (-367.093) (-365.199) [-365.660] * (-365.204) [-367.788] (-366.625) (-367.416) -- 0:00:51
      177500 -- (-365.238) (-366.578) (-365.418) [-367.931] * (-366.870) (-365.345) (-365.143) [-365.166] -- 0:00:50
      178000 -- (-367.512) [-367.336] (-368.028) (-365.923) * (-366.553) (-364.870) (-367.069) [-364.983] -- 0:00:50
      178500 -- [-367.158] (-366.470) (-369.014) (-367.707) * (-366.352) (-365.660) (-366.545) [-364.756] -- 0:00:50
      179000 -- [-367.909] (-367.307) (-372.195) (-368.689) * [-365.516] (-365.348) (-368.705) (-364.811) -- 0:00:50
      179500 -- (-373.176) (-365.153) (-365.166) [-367.229] * (-366.714) (-365.640) (-367.894) [-366.885] -- 0:00:50
      180000 -- (-367.512) (-365.786) (-365.734) [-370.052] * (-365.204) (-365.208) [-366.610] (-369.314) -- 0:00:50

      Average standard deviation of split frequencies: 0.020874

      180500 -- (-366.747) (-368.350) [-365.808] (-368.523) * [-365.893] (-367.961) (-365.639) (-368.790) -- 0:00:49
      181000 -- (-368.370) [-367.881] (-364.692) (-366.299) * (-366.725) [-366.336] (-368.293) (-369.258) -- 0:00:49
      181500 -- (-368.347) [-365.870] (-368.256) (-366.284) * [-366.436] (-366.220) (-367.787) (-368.592) -- 0:00:49
      182000 -- (-367.327) (-369.661) [-366.426] (-368.378) * (-366.293) (-368.479) [-365.516] (-365.925) -- 0:00:49
      182500 -- (-364.673) (-366.434) (-366.046) [-365.594] * (-367.568) (-369.620) (-365.199) [-368.077] -- 0:00:49
      183000 -- (-364.511) (-367.662) (-366.546) [-365.478] * (-365.114) (-367.401) (-371.945) [-364.846] -- 0:00:49
      183500 -- [-366.215] (-368.121) (-366.561) (-365.784) * (-365.742) [-370.598] (-373.418) (-376.442) -- 0:00:48
      184000 -- [-366.145] (-368.933) (-368.176) (-368.402) * (-365.310) [-367.243] (-365.324) (-369.030) -- 0:00:48
      184500 -- (-365.392) (-365.866) [-365.554] (-365.347) * [-367.579] (-366.031) (-365.885) (-365.226) -- 0:00:48
      185000 -- (-370.247) (-370.013) (-367.385) [-367.149] * [-367.085] (-367.588) (-366.032) (-366.255) -- 0:00:48

      Average standard deviation of split frequencies: 0.018934

      185500 -- [-365.828] (-366.299) (-365.641) (-365.261) * (-372.956) [-368.600] (-367.538) (-366.260) -- 0:00:48
      186000 -- [-365.968] (-366.087) (-367.248) (-365.548) * (-369.258) (-367.948) [-367.368] (-367.247) -- 0:00:48
      186500 -- (-367.947) (-366.353) (-369.148) [-366.446] * (-365.892) (-367.173) [-366.887] (-367.177) -- 0:00:47
      187000 -- (-370.181) (-366.827) (-366.068) [-365.692] * (-367.026) [-365.993] (-372.880) (-367.464) -- 0:00:52
      187500 -- [-366.262] (-366.493) (-366.716) (-373.093) * (-367.291) (-365.976) [-368.234] (-366.230) -- 0:00:52
      188000 -- (-367.242) (-366.720) (-370.885) [-367.129] * (-367.309) (-366.541) [-364.620] (-368.127) -- 0:00:51
      188500 -- (-364.778) (-366.012) (-374.086) [-365.190] * (-365.806) (-369.300) [-367.268] (-366.128) -- 0:00:51
      189000 -- (-365.530) [-364.773] (-367.005) (-366.255) * (-366.197) [-366.702] (-367.176) (-365.331) -- 0:00:51
      189500 -- [-365.544] (-365.492) (-365.834) (-368.247) * [-366.145] (-364.357) (-366.823) (-366.853) -- 0:00:51
      190000 -- (-364.554) [-369.150] (-368.396) (-369.060) * (-371.816) [-366.786] (-375.015) (-368.728) -- 0:00:51

      Average standard deviation of split frequencies: 0.016725

      190500 -- (-365.165) (-370.669) [-366.527] (-365.141) * [-365.961] (-365.594) (-367.298) (-367.971) -- 0:00:50
      191000 -- (-367.857) (-365.926) [-367.444] (-367.899) * (-366.203) [-367.072] (-369.468) (-366.998) -- 0:00:50
      191500 -- (-365.831) [-367.111] (-368.854) (-369.585) * (-369.244) (-366.620) (-368.030) [-367.172] -- 0:00:50
      192000 -- (-365.241) [-366.967] (-366.647) (-370.136) * (-365.625) (-366.762) (-365.860) [-370.218] -- 0:00:50
      192500 -- [-365.280] (-367.141) (-368.247) (-368.148) * [-368.291] (-367.552) (-367.591) (-367.510) -- 0:00:50
      193000 -- (-367.682) (-368.621) [-367.116] (-366.100) * (-367.556) [-367.286] (-365.386) (-364.572) -- 0:00:50
      193500 -- [-366.390] (-366.694) (-366.990) (-367.646) * (-368.951) [-366.005] (-364.358) (-368.534) -- 0:00:50
      194000 -- (-365.818) (-366.800) [-365.156] (-371.867) * [-368.638] (-369.460) (-366.886) (-365.994) -- 0:00:49
      194500 -- (-374.002) (-367.037) [-366.665] (-369.800) * [-366.953] (-366.930) (-366.077) (-367.039) -- 0:00:49
      195000 -- (-369.897) [-367.351] (-371.113) (-366.212) * (-367.593) [-365.875] (-364.867) (-370.826) -- 0:00:49

      Average standard deviation of split frequencies: 0.016553

      195500 -- [-365.425] (-368.127) (-366.752) (-365.300) * (-371.700) [-365.496] (-369.871) (-370.861) -- 0:00:49
      196000 -- (-365.142) [-367.209] (-371.532) (-365.298) * (-366.136) (-367.285) (-371.924) [-369.298] -- 0:00:49
      196500 -- (-371.962) [-366.199] (-372.051) (-364.868) * (-369.098) (-367.846) (-367.929) [-366.658] -- 0:00:49
      197000 -- [-367.089] (-366.012) (-374.468) (-367.199) * (-365.062) (-367.330) (-367.562) [-364.824] -- 0:00:48
      197500 -- (-367.568) (-366.950) [-368.042] (-367.783) * (-367.641) [-365.588] (-365.722) (-368.282) -- 0:00:48
      198000 -- (-370.401) (-364.569) (-369.517) [-367.034] * [-366.591] (-372.595) (-370.565) (-365.186) -- 0:00:48
      198500 -- [-367.661] (-368.007) (-367.732) (-369.806) * (-367.178) (-369.707) (-367.330) [-365.406] -- 0:00:48
      199000 -- (-370.029) (-367.085) (-369.940) [-365.965] * (-366.278) [-365.600] (-365.012) (-364.555) -- 0:00:48
      199500 -- [-367.195] (-366.531) (-369.065) (-371.334) * (-370.127) (-367.912) (-365.529) [-367.206] -- 0:00:48
      200000 -- (-365.870) [-366.149] (-366.502) (-365.288) * (-367.773) (-366.321) (-367.998) [-366.313] -- 0:00:48

      Average standard deviation of split frequencies: 0.017688

      200500 -- [-369.077] (-368.581) (-366.114) (-366.171) * [-367.380] (-367.507) (-368.920) (-367.401) -- 0:00:47
      201000 -- (-365.759) (-367.402) (-372.183) [-366.891] * (-365.495) (-367.813) (-365.416) [-366.859] -- 0:00:47
      201500 -- (-368.272) [-367.573] (-365.006) (-370.814) * (-367.071) (-367.281) (-366.721) [-365.424] -- 0:00:47
      202000 -- [-366.015] (-369.685) (-367.144) (-366.450) * (-368.316) (-366.503) [-365.644] (-366.402) -- 0:00:47
      202500 -- (-367.230) (-368.812) [-368.593] (-364.726) * (-366.307) (-367.130) [-366.074] (-366.693) -- 0:00:47
      203000 -- (-367.961) (-366.285) [-367.678] (-366.167) * (-364.631) [-366.818] (-368.639) (-366.197) -- 0:00:47
      203500 -- [-365.550] (-371.155) (-364.639) (-367.783) * (-368.119) (-367.456) (-366.628) [-365.889] -- 0:00:46
      204000 -- (-366.606) [-366.658] (-367.020) (-365.907) * (-367.649) (-367.982) [-366.560] (-364.898) -- 0:00:50
      204500 -- (-368.851) [-366.231] (-366.490) (-366.853) * (-366.091) (-364.980) (-366.105) [-364.814] -- 0:00:50
      205000 -- (-365.084) [-368.417] (-365.947) (-365.779) * [-366.486] (-366.873) (-372.692) (-365.294) -- 0:00:50

      Average standard deviation of split frequencies: 0.015637

      205500 -- (-366.394) [-366.687] (-366.806) (-367.298) * [-364.871] (-369.603) (-369.175) (-365.725) -- 0:00:50
      206000 -- (-366.548) (-366.184) (-372.165) [-369.178] * (-366.149) (-365.005) (-369.568) [-366.021] -- 0:00:50
      206500 -- (-365.701) (-367.573) (-365.987) [-365.046] * (-368.155) (-365.152) [-366.317] (-371.399) -- 0:00:49
      207000 -- (-366.892) (-367.494) [-364.927] (-370.443) * (-369.182) (-365.194) [-366.306] (-368.520) -- 0:00:49
      207500 -- (-365.454) (-365.579) [-367.683] (-368.181) * (-366.009) (-366.696) [-365.324] (-366.664) -- 0:00:49
      208000 -- [-365.283] (-365.148) (-366.095) (-367.419) * (-370.660) (-366.377) [-366.803] (-366.550) -- 0:00:49
      208500 -- [-369.299] (-366.984) (-366.468) (-369.700) * (-365.964) (-368.631) (-366.317) [-365.415] -- 0:00:49
      209000 -- (-366.622) [-366.026] (-366.229) (-365.989) * (-365.424) [-365.125] (-365.040) (-365.864) -- 0:00:49
      209500 -- (-366.565) (-366.918) [-365.805] (-369.163) * (-365.186) (-369.306) (-367.890) [-369.136] -- 0:00:49
      210000 -- (-364.786) (-371.410) (-366.051) [-370.221] * (-366.366) (-369.654) (-366.867) [-367.570] -- 0:00:48

      Average standard deviation of split frequencies: 0.015310

      210500 -- (-368.308) [-367.987] (-368.231) (-367.634) * [-368.294] (-370.420) (-365.867) (-369.567) -- 0:00:48
      211000 -- (-368.446) [-374.144] (-365.838) (-370.960) * (-365.162) (-367.363) (-368.231) [-369.208] -- 0:00:48
      211500 -- (-366.797) (-372.043) [-365.465] (-368.446) * (-365.338) [-365.142] (-366.135) (-365.985) -- 0:00:48
      212000 -- [-366.913] (-368.207) (-365.379) (-365.725) * (-365.768) (-366.861) [-366.858] (-368.282) -- 0:00:48
      212500 -- (-365.985) (-366.304) (-368.171) [-366.855] * (-365.405) [-364.867] (-367.882) (-367.063) -- 0:00:48
      213000 -- (-367.299) [-366.379] (-369.717) (-366.268) * (-365.087) (-366.857) [-366.835] (-366.312) -- 0:00:48
      213500 -- (-366.758) [-366.047] (-365.898) (-365.952) * (-368.990) [-368.368] (-367.513) (-366.567) -- 0:00:47
      214000 -- (-366.372) [-366.563] (-365.765) (-366.477) * (-366.467) (-367.340) [-366.742] (-368.427) -- 0:00:47
      214500 -- (-368.944) [-366.988] (-369.442) (-368.292) * (-367.817) (-367.023) (-365.729) [-366.567] -- 0:00:47
      215000 -- (-368.768) (-365.676) [-365.741] (-366.960) * (-370.330) (-370.641) [-368.679] (-366.888) -- 0:00:47

      Average standard deviation of split frequencies: 0.015277

      215500 -- (-367.673) [-365.961] (-368.521) (-366.212) * (-368.914) (-367.465) (-366.068) [-367.981] -- 0:00:47
      216000 -- (-366.861) (-364.689) (-370.028) [-366.942] * [-364.982] (-369.122) (-366.171) (-368.465) -- 0:00:47
      216500 -- (-366.420) (-367.242) [-366.859] (-367.541) * [-366.211] (-366.327) (-373.522) (-368.142) -- 0:00:47
      217000 -- (-369.834) [-367.344] (-367.695) (-366.376) * (-368.102) (-364.586) [-366.405] (-368.077) -- 0:00:46
      217500 -- (-367.406) (-369.361) [-365.428] (-370.322) * (-368.164) [-366.609] (-369.148) (-368.886) -- 0:00:46
      218000 -- (-365.541) [-366.432] (-366.392) (-366.864) * (-367.927) (-368.984) (-366.976) [-364.686] -- 0:00:46
      218500 -- (-365.043) [-367.876] (-366.515) (-369.400) * [-366.753] (-367.626) (-365.861) (-364.825) -- 0:00:46
      219000 -- (-371.942) (-374.493) (-368.572) [-364.923] * [-365.845] (-366.165) (-366.120) (-365.720) -- 0:00:46
      219500 -- (-369.009) (-370.437) (-366.322) [-367.676] * (-366.519) (-366.682) [-368.407] (-368.050) -- 0:00:46
      220000 -- (-367.189) [-367.529] (-367.277) (-368.632) * (-368.113) (-365.448) (-369.082) [-365.746] -- 0:00:46

      Average standard deviation of split frequencies: 0.016289

      220500 -- (-369.209) (-366.173) [-365.724] (-373.618) * [-367.114] (-368.371) (-365.002) (-365.057) -- 0:00:45
      221000 -- (-370.915) [-366.137] (-368.415) (-369.788) * (-368.784) (-365.765) [-366.935] (-366.186) -- 0:00:49
      221500 -- [-367.189] (-370.491) (-366.231) (-370.658) * (-368.482) (-365.415) [-367.700] (-367.177) -- 0:00:49
      222000 -- [-367.174] (-370.024) (-368.143) (-368.620) * (-367.311) [-365.564] (-365.253) (-368.696) -- 0:00:49
      222500 -- (-367.799) (-372.645) [-370.975] (-366.206) * (-365.289) (-366.090) [-365.032] (-366.782) -- 0:00:48
      223000 -- (-366.558) (-370.218) (-369.444) [-366.331] * (-370.605) (-367.864) (-365.151) [-365.149] -- 0:00:48
      223500 -- (-366.113) (-368.445) [-367.757] (-366.158) * (-366.867) (-367.439) [-366.658] (-365.245) -- 0:00:48
      224000 -- [-367.259] (-366.068) (-368.517) (-365.793) * (-367.409) (-365.611) (-366.393) [-366.891] -- 0:00:48
      224500 -- (-366.023) [-367.050] (-368.398) (-367.827) * (-368.269) [-366.083] (-368.879) (-365.803) -- 0:00:48
      225000 -- (-366.151) [-367.562] (-365.947) (-366.902) * (-369.886) (-365.758) (-364.985) [-366.154] -- 0:00:48

      Average standard deviation of split frequencies: 0.015876

      225500 -- (-367.712) (-367.591) [-371.207] (-368.235) * (-368.310) (-368.121) (-367.250) [-368.075] -- 0:00:48
      226000 -- (-366.377) [-365.558] (-368.412) (-365.022) * (-368.312) (-364.928) (-365.221) [-367.632] -- 0:00:47
      226500 -- (-365.678) [-366.490] (-365.901) (-368.852) * [-366.032] (-365.586) (-365.005) (-365.764) -- 0:00:47
      227000 -- (-365.603) [-366.551] (-366.514) (-366.275) * (-365.307) (-368.063) [-365.822] (-366.104) -- 0:00:47
      227500 -- (-368.161) (-366.822) (-367.997) [-365.452] * (-366.043) (-365.947) (-365.719) [-365.507] -- 0:00:47
      228000 -- (-367.151) (-365.411) [-367.456] (-370.538) * (-365.302) (-371.579) (-365.614) [-364.926] -- 0:00:47
      228500 -- [-373.781] (-366.455) (-365.310) (-366.872) * [-364.709] (-367.006) (-367.547) (-366.541) -- 0:00:47
      229000 -- (-370.983) (-364.708) [-365.261] (-365.414) * (-370.259) [-365.261] (-369.200) (-368.722) -- 0:00:47
      229500 -- (-369.418) (-371.463) [-370.982] (-366.450) * (-368.786) (-365.203) [-367.235] (-367.223) -- 0:00:47
      230000 -- (-365.949) (-367.988) [-365.866] (-366.758) * (-368.083) (-365.708) (-365.508) [-370.175] -- 0:00:46

      Average standard deviation of split frequencies: 0.014944

      230500 -- (-366.013) [-366.006] (-368.615) (-367.280) * (-367.630) [-366.821] (-364.822) (-365.827) -- 0:00:46
      231000 -- (-366.717) [-366.730] (-367.186) (-367.304) * (-366.026) (-366.765) [-365.430] (-370.048) -- 0:00:46
      231500 -- (-364.863) [-366.343] (-368.515) (-368.254) * (-369.072) (-364.775) (-368.569) [-366.280] -- 0:00:46
      232000 -- (-367.627) (-365.823) (-369.215) [-367.426] * (-366.942) (-368.080) (-367.418) [-370.078] -- 0:00:46
      232500 -- (-366.740) (-369.245) [-370.414] (-366.176) * [-368.241] (-372.009) (-365.151) (-367.574) -- 0:00:46
      233000 -- (-369.107) [-367.958] (-367.094) (-364.485) * (-365.605) (-371.104) (-369.558) [-367.618] -- 0:00:46
      233500 -- (-366.651) (-365.757) [-369.392] (-366.323) * (-366.256) (-373.576) (-364.936) [-366.980] -- 0:00:45
      234000 -- (-365.682) [-366.470] (-366.924) (-366.048) * (-366.421) [-366.898] (-368.016) (-366.090) -- 0:00:45
      234500 -- (-368.250) [-368.255] (-365.824) (-366.247) * (-366.670) (-366.910) (-368.208) [-365.163] -- 0:00:45
      235000 -- [-365.443] (-371.022) (-364.717) (-365.224) * (-369.775) (-365.715) [-365.444] (-366.336) -- 0:00:45

      Average standard deviation of split frequencies: 0.013395

      235500 -- (-365.043) [-365.242] (-365.816) (-366.294) * (-369.776) (-365.220) [-367.977] (-366.573) -- 0:00:45
      236000 -- [-365.493] (-367.294) (-364.686) (-368.927) * (-369.932) [-365.280] (-367.460) (-365.833) -- 0:00:45
      236500 -- [-366.461] (-367.600) (-366.811) (-365.196) * (-369.485) [-366.789] (-366.887) (-366.128) -- 0:00:45
      237000 -- (-365.591) (-367.124) [-367.657] (-366.566) * [-369.776] (-368.269) (-366.161) (-369.480) -- 0:00:45
      237500 -- (-366.157) (-365.854) (-365.911) [-369.356] * (-370.618) (-366.404) [-366.087] (-366.796) -- 0:00:44
      238000 -- (-366.199) (-369.834) [-365.177] (-366.797) * (-372.652) (-364.962) (-365.560) [-365.167] -- 0:00:44
      238500 -- (-365.617) (-371.182) (-367.255) [-367.791] * (-375.274) (-366.012) (-368.705) [-364.505] -- 0:00:47
      239000 -- (-365.225) (-368.847) [-367.610] (-366.779) * [-374.316] (-365.110) (-365.880) (-364.305) -- 0:00:47
      239500 -- (-367.598) (-369.454) (-369.563) [-366.844] * [-365.536] (-365.858) (-366.300) (-364.804) -- 0:00:47
      240000 -- (-370.234) (-365.854) [-364.883] (-365.369) * (-365.979) [-365.048] (-366.389) (-367.706) -- 0:00:47

      Average standard deviation of split frequencies: 0.013834

      240500 -- [-366.744] (-365.531) (-364.980) (-365.664) * [-364.729] (-368.131) (-369.864) (-367.525) -- 0:00:47
      241000 -- (-366.258) (-365.364) (-367.895) [-366.661] * (-365.729) (-370.198) (-369.895) [-365.782] -- 0:00:47
      241500 -- (-365.155) [-364.754] (-365.969) (-373.846) * [-368.861] (-367.035) (-366.326) (-365.508) -- 0:00:47
      242000 -- (-365.449) [-365.770] (-366.581) (-367.383) * (-367.097) (-369.422) [-365.728] (-368.312) -- 0:00:46
      242500 -- [-367.220] (-366.944) (-367.135) (-367.084) * (-367.515) (-367.574) (-367.767) [-366.868] -- 0:00:46
      243000 -- [-368.117] (-371.103) (-365.243) (-368.459) * (-368.296) (-365.921) (-365.968) [-365.163] -- 0:00:46
      243500 -- [-367.892] (-371.651) (-364.622) (-369.090) * (-367.750) [-366.743] (-366.238) (-364.506) -- 0:00:46
      244000 -- (-366.026) [-367.007] (-364.688) (-367.122) * (-367.859) (-368.439) [-368.625] (-368.671) -- 0:00:46
      244500 -- [-365.156] (-368.959) (-366.452) (-370.447) * [-365.060] (-367.052) (-365.517) (-367.989) -- 0:00:46
      245000 -- (-366.366) [-365.566] (-366.960) (-370.155) * (-366.012) (-370.245) [-365.255] (-371.254) -- 0:00:46

      Average standard deviation of split frequencies: 0.013893

      245500 -- (-365.335) [-366.299] (-364.955) (-366.809) * (-368.933) (-369.969) [-365.181] (-366.390) -- 0:00:46
      246000 -- (-365.865) (-370.171) (-370.813) [-365.298] * [-369.508] (-366.226) (-366.191) (-365.823) -- 0:00:45
      246500 -- (-370.770) [-365.560] (-365.481) (-366.950) * (-366.512) (-368.999) (-367.808) [-365.805] -- 0:00:45
      247000 -- (-366.936) (-364.845) [-366.486] (-366.769) * (-369.173) [-365.126] (-366.722) (-371.960) -- 0:00:45
      247500 -- [-365.006] (-365.967) (-365.643) (-364.662) * (-367.626) (-365.498) [-365.658] (-367.709) -- 0:00:45
      248000 -- [-366.376] (-369.478) (-365.354) (-367.319) * (-366.304) (-367.619) [-365.989] (-366.252) -- 0:00:45
      248500 -- (-366.264) (-372.084) [-364.569] (-368.724) * (-370.699) (-365.174) (-367.853) [-365.967] -- 0:00:45
      249000 -- (-367.190) (-368.172) (-366.407) [-367.260] * (-366.338) [-369.534] (-367.451) (-365.015) -- 0:00:45
      249500 -- [-367.121] (-368.289) (-368.810) (-369.632) * [-368.580] (-365.959) (-368.384) (-365.826) -- 0:00:45
      250000 -- (-365.990) (-370.313) [-368.862] (-368.296) * (-368.623) (-366.483) [-364.554] (-366.199) -- 0:00:45

      Average standard deviation of split frequencies: 0.015162

      250500 -- [-367.493] (-367.903) (-369.065) (-369.818) * (-366.852) [-366.880] (-368.195) (-367.354) -- 0:00:44
      251000 -- (-367.428) (-366.555) [-366.352] (-369.093) * (-366.644) (-369.234) [-369.130] (-366.091) -- 0:00:44
      251500 -- (-373.597) (-371.319) [-366.511] (-367.525) * (-364.719) (-368.140) (-366.056) [-366.095] -- 0:00:44
      252000 -- (-365.441) (-376.470) [-365.376] (-365.490) * [-365.474] (-366.523) (-367.546) (-370.546) -- 0:00:44
      252500 -- (-365.122) (-368.006) (-365.961) [-365.252] * [-365.616] (-367.536) (-365.923) (-366.816) -- 0:00:44
      253000 -- (-367.224) (-364.868) [-368.374] (-367.622) * [-366.461] (-365.553) (-368.784) (-366.413) -- 0:00:44
      253500 -- (-365.398) (-365.152) (-365.843) [-366.685] * (-367.465) (-368.549) (-366.280) [-367.599] -- 0:00:44
      254000 -- (-367.602) (-367.732) (-365.876) [-366.636] * (-365.312) [-367.394] (-365.619) (-370.040) -- 0:00:44
      254500 -- (-366.856) (-365.615) (-365.567) [-366.301] * [-365.656] (-369.167) (-365.522) (-368.423) -- 0:00:43
      255000 -- (-368.148) (-365.542) (-365.375) [-365.651] * (-367.738) [-368.286] (-367.115) (-369.121) -- 0:00:43

      Average standard deviation of split frequencies: 0.014271

      255500 -- (-366.493) (-365.818) (-366.175) [-366.607] * (-365.393) (-366.190) (-369.260) [-368.321] -- 0:00:46
      256000 -- (-370.564) (-366.164) (-365.396) [-366.806] * (-368.217) [-368.383] (-365.547) (-368.287) -- 0:00:46
      256500 -- [-367.544] (-365.085) (-367.270) (-368.358) * [-365.830] (-365.332) (-365.789) (-367.391) -- 0:00:46
      257000 -- (-369.510) [-367.668] (-365.823) (-365.256) * [-374.608] (-369.696) (-364.882) (-366.884) -- 0:00:46
      257500 -- (-366.053) (-367.460) [-368.986] (-367.305) * (-369.626) [-367.126] (-366.299) (-368.209) -- 0:00:46
      258000 -- (-367.259) [-369.129] (-369.381) (-366.168) * (-366.738) (-368.582) (-366.847) [-365.964] -- 0:00:46
      258500 -- (-366.100) [-367.449] (-368.575) (-366.932) * (-367.603) (-365.016) (-373.013) [-367.093] -- 0:00:45
      259000 -- (-369.903) (-367.348) [-364.527] (-366.630) * [-365.590] (-367.078) (-366.416) (-365.921) -- 0:00:45
      259500 -- (-368.881) [-367.161] (-366.369) (-366.003) * [-366.322] (-366.482) (-367.523) (-367.554) -- 0:00:45
      260000 -- (-367.502) (-365.831) [-364.961] (-365.796) * (-372.284) [-365.692] (-365.789) (-365.613) -- 0:00:45

      Average standard deviation of split frequencies: 0.016276

      260500 -- [-370.373] (-366.726) (-364.740) (-366.422) * (-367.611) (-365.490) [-367.454] (-365.162) -- 0:00:45
      261000 -- [-367.555] (-370.863) (-368.172) (-367.523) * [-366.756] (-365.883) (-367.435) (-368.649) -- 0:00:45
      261500 -- [-365.450] (-369.140) (-366.768) (-366.261) * (-369.611) (-368.838) [-367.167] (-367.013) -- 0:00:45
      262000 -- (-368.190) [-369.609] (-371.837) (-367.018) * (-365.680) (-364.740) (-367.125) [-369.748] -- 0:00:45
      262500 -- (-367.641) (-369.269) (-365.676) [-365.764] * [-365.965] (-365.987) (-366.778) (-368.287) -- 0:00:44
      263000 -- [-367.971] (-368.127) (-367.311) (-366.861) * (-366.113) (-367.397) [-367.010] (-372.466) -- 0:00:44
      263500 -- (-364.938) (-366.699) (-374.302) [-367.221] * (-365.654) (-367.631) (-368.859) [-365.238] -- 0:00:44
      264000 -- (-364.920) (-367.833) (-365.987) [-368.103] * (-365.848) (-369.795) (-367.341) [-367.597] -- 0:00:44
      264500 -- (-368.160) (-367.119) [-367.333] (-369.555) * (-367.234) (-366.001) (-366.692) [-366.002] -- 0:00:44
      265000 -- (-366.005) (-368.067) (-365.905) [-366.894] * [-370.370] (-370.140) (-370.000) (-364.699) -- 0:00:44

      Average standard deviation of split frequencies: 0.014670

      265500 -- (-367.295) (-367.652) (-364.960) [-368.439] * (-367.257) [-368.475] (-366.371) (-367.582) -- 0:00:44
      266000 -- (-369.260) (-365.796) [-366.889] (-365.277) * (-366.198) [-365.484] (-366.848) (-367.838) -- 0:00:44
      266500 -- (-369.688) [-366.592] (-365.844) (-366.933) * [-365.999] (-367.431) (-367.052) (-368.273) -- 0:00:44
      267000 -- (-365.160) [-365.952] (-366.310) (-367.052) * [-366.462] (-366.914) (-365.271) (-369.816) -- 0:00:43
      267500 -- [-372.212] (-366.202) (-366.923) (-364.768) * (-365.269) [-370.642] (-367.606) (-366.740) -- 0:00:43
      268000 -- [-368.814] (-366.861) (-368.245) (-367.267) * [-364.569] (-372.481) (-372.495) (-366.259) -- 0:00:43
      268500 -- (-370.595) (-368.266) (-367.270) [-367.100] * (-365.104) (-370.327) [-369.119] (-364.595) -- 0:00:43
      269000 -- (-365.442) (-369.183) [-366.251] (-369.132) * [-365.671] (-369.883) (-368.843) (-368.657) -- 0:00:43
      269500 -- (-367.780) (-367.974) (-365.157) [-367.107] * (-367.239) [-366.830] (-364.833) (-367.351) -- 0:00:43
      270000 -- [-367.493] (-369.362) (-365.508) (-368.395) * (-367.939) [-366.723] (-365.580) (-367.604) -- 0:00:43

      Average standard deviation of split frequencies: 0.014610

      270500 -- (-364.667) (-366.646) (-368.959) [-368.779] * [-365.191] (-364.684) (-367.452) (-370.061) -- 0:00:43
      271000 -- [-367.919] (-366.665) (-367.600) (-365.489) * (-365.259) (-366.843) (-364.888) [-366.803] -- 0:00:43
      271500 -- [-365.431] (-365.662) (-370.631) (-366.242) * [-366.709] (-367.860) (-364.703) (-365.783) -- 0:00:42
      272000 -- [-364.822] (-369.594) (-371.285) (-368.539) * (-367.942) (-365.520) (-369.177) [-364.757] -- 0:00:42
      272500 -- [-365.480] (-366.361) (-369.285) (-368.375) * (-366.798) (-367.992) (-373.781) [-370.513] -- 0:00:45
      273000 -- [-366.204] (-365.844) (-364.883) (-365.842) * (-368.459) (-369.444) (-365.252) [-369.331] -- 0:00:45
      273500 -- [-367.469] (-367.396) (-365.196) (-366.493) * [-367.611] (-367.879) (-365.208) (-370.738) -- 0:00:45
      274000 -- [-365.711] (-365.419) (-366.102) (-365.970) * [-365.509] (-369.169) (-364.532) (-367.716) -- 0:00:45
      274500 -- (-366.008) (-364.844) (-365.712) [-364.824] * (-365.871) (-366.683) (-368.181) [-365.611] -- 0:00:44
      275000 -- [-367.435] (-365.388) (-368.413) (-365.617) * [-367.723] (-367.805) (-369.401) (-365.356) -- 0:00:44

      Average standard deviation of split frequencies: 0.015277

      275500 -- (-365.629) [-365.881] (-366.259) (-365.710) * (-367.135) [-367.990] (-368.710) (-366.503) -- 0:00:44
      276000 -- (-367.585) (-366.833) (-366.605) [-365.159] * (-368.809) (-369.407) (-364.653) [-365.652] -- 0:00:44
      276500 -- [-366.606] (-367.350) (-365.420) (-369.390) * (-370.486) (-368.341) [-367.419] (-366.379) -- 0:00:44
      277000 -- (-367.566) [-366.709] (-365.628) (-365.900) * [-365.015] (-369.737) (-366.065) (-368.042) -- 0:00:44
      277500 -- (-367.157) [-365.383] (-365.099) (-366.687) * [-366.326] (-366.395) (-366.130) (-367.985) -- 0:00:44
      278000 -- (-368.275) (-369.174) [-366.023] (-364.973) * (-365.363) (-371.324) (-366.485) [-366.507] -- 0:00:44
      278500 -- [-365.801] (-364.886) (-366.727) (-365.967) * (-371.059) (-369.682) (-366.428) [-368.525] -- 0:00:44
      279000 -- (-367.104) (-366.255) (-365.274) [-367.504] * [-365.280] (-367.444) (-366.597) (-368.756) -- 0:00:43
      279500 -- [-377.743] (-371.619) (-367.032) (-365.541) * [-365.299] (-369.501) (-365.735) (-366.554) -- 0:00:43
      280000 -- (-370.524) (-369.241) (-365.536) [-364.635] * (-369.709) [-369.031] (-368.235) (-365.269) -- 0:00:43

      Average standard deviation of split frequencies: 0.015808

      280500 -- (-367.405) (-366.415) (-367.314) [-364.886] * (-367.581) (-370.285) (-364.940) [-367.651] -- 0:00:43
      281000 -- (-367.017) (-370.592) [-364.404] (-364.985) * (-367.859) (-367.694) (-368.463) [-373.145] -- 0:00:43
      281500 -- [-365.040] (-366.240) (-365.348) (-364.476) * (-365.883) [-369.427] (-371.193) (-366.948) -- 0:00:43
      282000 -- (-365.016) (-367.461) (-366.925) [-364.681] * (-365.990) (-367.440) (-366.068) [-365.518] -- 0:00:43
      282500 -- [-365.041] (-370.955) (-367.423) (-365.450) * (-366.737) (-365.904) (-369.031) [-370.045] -- 0:00:43
      283000 -- (-371.063) (-365.124) [-368.040] (-365.694) * (-368.336) (-366.875) (-369.155) [-370.282] -- 0:00:43
      283500 -- (-369.154) (-366.389) [-368.627] (-370.200) * [-364.733] (-366.668) (-369.010) (-366.430) -- 0:00:42
      284000 -- (-367.135) (-368.187) [-365.389] (-370.825) * (-365.283) (-368.622) (-366.768) [-368.212] -- 0:00:42
      284500 -- (-367.249) (-364.931) [-365.487] (-369.135) * [-366.219] (-365.959) (-365.236) (-365.401) -- 0:00:42
      285000 -- (-367.051) (-364.801) (-373.516) [-366.458] * (-367.961) (-366.857) [-367.604] (-367.400) -- 0:00:42

      Average standard deviation of split frequencies: 0.014834

      285500 -- (-366.718) (-366.459) [-367.136] (-366.363) * (-368.565) (-368.217) (-369.104) [-365.138] -- 0:00:42
      286000 -- (-368.710) (-365.464) (-365.020) [-365.852] * (-366.257) (-366.795) [-365.250] (-368.217) -- 0:00:42
      286500 -- (-366.408) [-366.612] (-367.378) (-367.891) * (-367.496) (-369.611) (-364.625) [-368.840] -- 0:00:42
      287000 -- [-365.076] (-365.905) (-367.389) (-370.340) * (-368.158) (-369.718) (-364.496) [-368.616] -- 0:00:42
      287500 -- [-366.057] (-365.058) (-366.214) (-366.111) * (-365.086) (-368.064) [-367.468] (-368.457) -- 0:00:42
      288000 -- (-366.899) (-365.005) (-367.833) [-366.352] * [-367.209] (-367.155) (-365.663) (-368.856) -- 0:00:42
      288500 -- (-366.143) (-366.365) [-365.713] (-365.910) * (-367.056) [-365.649] (-366.259) (-370.172) -- 0:00:41
      289000 -- (-364.934) (-366.046) [-364.717] (-369.872) * [-367.550] (-366.724) (-366.101) (-369.201) -- 0:00:41
      289500 -- (-366.979) (-366.614) (-365.215) [-371.415] * (-364.621) [-365.633] (-366.967) (-365.031) -- 0:00:44
      290000 -- (-365.233) (-366.773) [-365.890] (-367.893) * (-367.341) [-366.619] (-366.826) (-370.626) -- 0:00:44

      Average standard deviation of split frequencies: 0.015279

      290500 -- (-364.571) (-366.820) [-368.889] (-369.793) * [-368.381] (-368.589) (-365.218) (-372.465) -- 0:00:43
      291000 -- [-365.740] (-367.849) (-365.965) (-365.904) * [-372.565] (-367.706) (-365.748) (-370.351) -- 0:00:43
      291500 -- (-366.719) (-369.642) (-367.119) [-368.434] * (-365.889) [-366.378] (-365.076) (-375.219) -- 0:00:43
      292000 -- (-368.265) (-369.567) (-367.201) [-366.080] * (-366.666) (-367.805) (-366.310) [-365.673] -- 0:00:43
      292500 -- (-369.058) (-369.250) [-366.345] (-365.998) * (-367.006) [-365.870] (-367.185) (-369.888) -- 0:00:43
      293000 -- (-367.691) (-366.658) (-365.594) [-367.319] * (-367.295) (-365.987) (-370.755) [-369.554] -- 0:00:43
      293500 -- (-365.611) [-367.704] (-367.521) (-365.938) * (-365.288) [-365.346] (-365.381) (-365.184) -- 0:00:43
      294000 -- (-365.936) [-368.222] (-366.095) (-367.959) * (-367.232) (-366.438) [-367.856] (-369.540) -- 0:00:43
      294500 -- (-367.962) (-365.568) [-365.686] (-366.705) * [-367.789] (-366.375) (-366.641) (-370.269) -- 0:00:43
      295000 -- [-365.377] (-372.005) (-367.088) (-367.486) * (-365.829) (-372.022) (-366.035) [-367.110] -- 0:00:43

      Average standard deviation of split frequencies: 0.013998

      295500 -- (-367.330) (-366.122) [-366.299] (-366.048) * [-366.009] (-367.868) (-365.645) (-367.990) -- 0:00:42
      296000 -- (-366.293) (-368.682) (-367.944) [-366.322] * (-367.668) [-365.693] (-366.535) (-368.580) -- 0:00:42
      296500 -- [-365.361] (-367.240) (-368.916) (-365.867) * (-370.098) [-367.724] (-366.338) (-366.688) -- 0:00:42
      297000 -- (-365.640) (-365.541) [-371.176] (-366.672) * [-366.018] (-366.088) (-364.604) (-369.530) -- 0:00:42
      297500 -- (-367.686) (-365.202) (-370.249) [-369.087] * (-366.217) (-367.456) [-365.076] (-372.358) -- 0:00:42
      298000 -- [-370.497] (-368.314) (-372.465) (-370.340) * [-367.645] (-367.794) (-364.445) (-366.870) -- 0:00:42
      298500 -- (-367.403) (-370.710) (-364.849) [-365.080] * (-368.169) [-367.119] (-364.596) (-365.657) -- 0:00:42
      299000 -- [-365.809] (-367.255) (-366.903) (-366.007) * (-366.013) (-371.604) (-365.753) [-365.927] -- 0:00:42
      299500 -- [-365.618] (-366.363) (-374.716) (-367.131) * (-364.403) (-366.046) (-367.732) [-366.202] -- 0:00:42
      300000 -- [-366.956] (-369.791) (-374.356) (-364.812) * [-365.937] (-371.787) (-365.949) (-369.001) -- 0:00:42

      Average standard deviation of split frequencies: 0.015349

      300500 -- [-368.427] (-366.151) (-367.659) (-365.408) * [-368.486] (-369.082) (-365.879) (-372.053) -- 0:00:41
      301000 -- (-368.443) (-370.129) [-368.996] (-365.102) * (-368.697) (-368.311) (-365.572) [-366.587] -- 0:00:41
      301500 -- [-369.144] (-367.816) (-365.411) (-365.647) * (-366.233) (-373.163) (-365.173) [-368.357] -- 0:00:41
      302000 -- (-367.304) (-364.892) [-364.913] (-364.611) * [-366.809] (-365.004) (-366.818) (-367.702) -- 0:00:41
      302500 -- (-365.996) (-365.011) (-365.215) [-366.465] * (-365.539) [-366.329] (-366.931) (-364.753) -- 0:00:41
      303000 -- (-366.370) [-365.084] (-365.250) (-365.131) * (-366.100) (-365.475) [-365.198] (-371.074) -- 0:00:41
      303500 -- (-366.785) [-366.844] (-370.447) (-365.398) * [-365.334] (-365.390) (-366.678) (-365.999) -- 0:00:41
      304000 -- (-364.894) [-365.805] (-369.856) (-368.444) * (-365.437) (-365.537) (-366.179) [-365.385] -- 0:00:41
      304500 -- [-367.785] (-366.252) (-366.996) (-365.021) * [-367.389] (-366.733) (-366.737) (-366.270) -- 0:00:41
      305000 -- [-367.046] (-365.565) (-365.389) (-367.327) * [-365.675] (-369.870) (-367.413) (-365.795) -- 0:00:41

      Average standard deviation of split frequencies: 0.016216

      305500 -- (-365.310) (-366.608) [-365.830] (-367.157) * (-368.204) (-366.851) [-366.423] (-368.898) -- 0:00:40
      306000 -- (-365.175) (-366.235) (-370.964) [-364.788] * (-371.490) [-367.623] (-366.142) (-369.405) -- 0:00:40
      306500 -- [-369.547] (-366.044) (-368.168) (-365.175) * (-370.748) (-366.950) (-367.709) [-367.484] -- 0:00:42
      307000 -- (-366.096) [-365.376] (-367.472) (-370.823) * (-365.045) (-369.934) [-365.315] (-365.712) -- 0:00:42
      307500 -- (-365.411) [-368.661] (-365.992) (-365.561) * (-365.003) (-370.445) (-368.803) [-366.997] -- 0:00:42
      308000 -- (-364.876) (-365.438) [-367.234] (-367.211) * (-364.622) [-366.569] (-372.739) (-365.415) -- 0:00:42
      308500 -- (-366.309) (-370.894) [-366.950] (-368.593) * (-364.758) (-368.903) [-368.354] (-367.405) -- 0:00:42
      309000 -- (-365.250) (-368.109) [-364.779] (-365.842) * [-366.313] (-366.760) (-367.887) (-367.205) -- 0:00:42
      309500 -- (-365.181) [-365.716] (-370.810) (-365.650) * (-371.485) (-367.940) (-368.893) [-366.339] -- 0:00:42
      310000 -- (-367.488) [-369.654] (-366.461) (-368.020) * (-370.136) (-368.385) (-366.490) [-365.107] -- 0:00:42

      Average standard deviation of split frequencies: 0.015573

      310500 -- (-367.112) (-368.538) [-368.859] (-366.458) * (-367.850) (-373.152) (-365.306) [-369.314] -- 0:00:42
      311000 -- [-364.931] (-374.221) (-368.737) (-366.528) * (-369.803) (-367.375) [-365.924] (-371.202) -- 0:00:42
      311500 -- (-366.959) (-368.180) [-373.293] (-367.413) * (-368.797) (-367.469) [-366.667] (-372.013) -- 0:00:41
      312000 -- (-368.359) [-365.426] (-368.401) (-368.275) * (-367.247) (-366.233) (-369.316) [-369.008] -- 0:00:41
      312500 -- (-365.562) (-367.749) [-365.612] (-365.015) * (-367.694) [-367.462] (-367.868) (-366.946) -- 0:00:41
      313000 -- (-367.745) [-366.158] (-370.038) (-367.488) * [-367.359] (-366.618) (-365.733) (-366.336) -- 0:00:41
      313500 -- (-369.813) [-365.872] (-367.030) (-365.668) * [-369.850] (-366.664) (-368.525) (-365.388) -- 0:00:41
      314000 -- [-366.532] (-370.233) (-366.803) (-366.547) * [-367.753] (-365.243) (-367.666) (-366.435) -- 0:00:41
      314500 -- (-365.293) [-366.813] (-371.873) (-366.082) * [-366.722] (-371.906) (-365.188) (-365.848) -- 0:00:41
      315000 -- (-367.229) [-367.043] (-365.780) (-366.868) * [-364.893] (-365.029) (-369.128) (-367.099) -- 0:00:41

      Average standard deviation of split frequencies: 0.014669

      315500 -- (-367.156) (-367.882) (-367.205) [-366.431] * (-368.446) [-366.588] (-367.827) (-368.524) -- 0:00:41
      316000 -- (-367.822) [-365.148] (-366.832) (-366.700) * [-364.668] (-367.325) (-368.184) (-369.992) -- 0:00:41
      316500 -- (-367.224) [-365.419] (-368.865) (-366.046) * (-365.707) [-369.449] (-366.597) (-367.803) -- 0:00:41
      317000 -- (-366.803) (-367.882) [-365.869] (-367.163) * (-367.408) [-368.726] (-367.433) (-367.413) -- 0:00:40
      317500 -- (-365.029) (-365.950) (-367.947) [-368.935] * (-366.905) [-365.524] (-366.836) (-367.218) -- 0:00:40
      318000 -- (-369.765) (-365.993) [-369.673] (-370.739) * (-367.264) (-365.285) [-367.799] (-366.426) -- 0:00:40
      318500 -- (-365.978) (-364.944) [-368.781] (-367.188) * (-367.801) [-370.736] (-365.273) (-369.431) -- 0:00:40
      319000 -- [-364.786] (-367.431) (-366.454) (-365.038) * (-367.949) (-373.408) [-365.050] (-366.420) -- 0:00:40
      319500 -- (-369.856) (-370.315) [-369.940] (-366.631) * (-369.900) (-368.753) (-366.355) [-365.621] -- 0:00:40
      320000 -- (-365.993) [-365.557] (-367.955) (-366.777) * (-367.363) [-366.132] (-365.350) (-367.592) -- 0:00:40

      Average standard deviation of split frequencies: 0.015133

      320500 -- (-365.420) [-366.964] (-370.415) (-366.708) * (-367.626) (-369.045) [-365.673] (-369.850) -- 0:00:40
      321000 -- (-369.456) (-366.962) (-366.363) [-365.248] * (-368.152) (-370.787) [-370.377] (-367.089) -- 0:00:40
      321500 -- (-365.282) (-366.270) (-365.775) [-367.110] * [-365.988] (-368.815) (-372.138) (-365.917) -- 0:00:40
      322000 -- (-366.595) (-368.236) [-366.646] (-366.688) * [-366.636] (-368.857) (-373.227) (-364.842) -- 0:00:40
      322500 -- (-366.406) [-367.352] (-365.657) (-366.902) * (-366.235) (-370.888) (-375.066) [-366.638] -- 0:00:39
      323000 -- (-372.126) [-364.858] (-367.161) (-365.825) * (-366.830) (-364.922) [-368.807] (-366.770) -- 0:00:39
      323500 -- [-366.660] (-364.925) (-366.396) (-370.263) * (-365.415) (-366.499) (-366.503) [-367.205] -- 0:00:41
      324000 -- (-365.226) (-369.773) [-364.779] (-367.373) * (-369.579) (-373.033) [-367.953] (-366.629) -- 0:00:41
      324500 -- (-364.587) (-366.273) (-368.859) [-366.085] * (-366.427) [-364.777] (-366.556) (-365.993) -- 0:00:41
      325000 -- (-367.851) (-367.320) [-365.821] (-366.297) * [-365.525] (-365.970) (-367.261) (-368.502) -- 0:00:41

      Average standard deviation of split frequencies: 0.014384

      325500 -- (-365.678) (-370.816) (-364.912) [-366.031] * (-365.025) (-366.967) [-365.842] (-365.196) -- 0:00:41
      326000 -- (-366.768) (-366.145) (-364.451) [-365.549] * (-365.867) [-366.501] (-368.155) (-365.511) -- 0:00:41
      326500 -- (-366.165) [-365.026] (-368.805) (-365.907) * (-366.151) (-365.419) [-365.826] (-366.976) -- 0:00:41
      327000 -- (-366.801) (-366.577) (-370.829) [-364.816] * [-367.751] (-364.839) (-367.665) (-368.780) -- 0:00:41
      327500 -- (-366.779) [-365.054] (-372.912) (-368.825) * [-366.998] (-365.173) (-366.796) (-370.923) -- 0:00:41
      328000 -- (-367.712) [-367.323] (-365.856) (-366.213) * (-372.981) (-364.448) (-365.394) [-367.388] -- 0:00:40
      328500 -- (-366.936) [-368.389] (-365.977) (-366.795) * (-368.205) [-367.414] (-368.901) (-369.894) -- 0:00:40
      329000 -- [-367.898] (-369.560) (-365.698) (-365.160) * [-366.196] (-367.922) (-366.416) (-367.161) -- 0:00:40
      329500 -- (-365.675) (-371.128) (-366.110) [-365.427] * (-369.645) (-364.968) [-369.952] (-368.799) -- 0:00:40
      330000 -- (-365.556) (-368.492) (-368.874) [-366.464] * (-368.551) (-367.548) [-366.945] (-365.930) -- 0:00:40

      Average standard deviation of split frequencies: 0.013656

      330500 -- (-369.575) (-367.342) (-367.501) [-367.472] * (-364.858) (-366.301) [-365.384] (-369.159) -- 0:00:40
      331000 -- [-367.794] (-369.203) (-370.009) (-366.206) * (-366.680) (-367.188) [-368.886] (-367.529) -- 0:00:40
      331500 -- (-369.809) (-367.792) [-369.148] (-373.581) * [-366.220] (-373.205) (-366.103) (-364.735) -- 0:00:40
      332000 -- (-367.572) (-365.018) (-369.757) [-364.665] * [-365.325] (-366.809) (-365.293) (-365.408) -- 0:00:40
      332500 -- (-365.059) [-367.520] (-371.602) (-367.390) * [-366.846] (-368.938) (-365.529) (-370.118) -- 0:00:40
      333000 -- (-364.968) [-370.283] (-368.406) (-364.989) * (-365.842) (-369.069) [-366.387] (-370.807) -- 0:00:40
      333500 -- (-365.177) (-366.938) (-368.211) [-366.476] * (-365.546) (-365.556) [-365.153] (-367.336) -- 0:00:39
      334000 -- (-367.914) (-369.424) [-365.842] (-371.143) * (-365.600) (-367.675) [-365.322] (-366.248) -- 0:00:39
      334500 -- [-369.071] (-366.768) (-366.457) (-367.002) * (-367.860) [-365.975] (-365.539) (-366.727) -- 0:00:39
      335000 -- (-366.397) (-366.838) [-366.208] (-368.173) * (-367.470) (-364.988) [-368.075] (-369.500) -- 0:00:39

      Average standard deviation of split frequencies: 0.013365

      335500 -- [-367.236] (-367.619) (-365.628) (-366.797) * [-368.680] (-370.220) (-366.657) (-368.595) -- 0:00:39
      336000 -- [-365.179] (-367.700) (-369.062) (-365.615) * (-367.104) (-366.782) [-366.781] (-367.885) -- 0:00:39
      336500 -- (-367.573) [-366.966] (-367.768) (-367.293) * [-367.297] (-365.263) (-365.730) (-371.476) -- 0:00:39
      337000 -- (-372.257) (-366.267) [-365.730] (-370.521) * (-366.796) (-369.393) (-366.908) [-365.808] -- 0:00:39
      337500 -- (-368.240) [-365.750] (-366.051) (-367.549) * (-365.620) (-369.615) (-371.721) [-370.560] -- 0:00:39
      338000 -- (-367.151) (-367.426) (-367.797) [-364.985] * (-370.545) (-367.181) [-366.089] (-365.775) -- 0:00:39
      338500 -- [-365.889] (-368.320) (-366.776) (-369.424) * (-366.352) (-366.765) (-366.882) [-368.924] -- 0:00:39
      339000 -- [-365.985] (-365.706) (-366.722) (-370.028) * (-369.781) [-366.767] (-369.135) (-370.191) -- 0:00:38
      339500 -- (-368.013) (-365.640) (-367.021) [-365.933] * (-367.469) (-365.885) [-367.847] (-367.927) -- 0:00:38
      340000 -- (-365.259) (-366.033) (-367.066) [-365.167] * (-365.595) (-367.937) [-367.259] (-366.428) -- 0:00:38

      Average standard deviation of split frequencies: 0.014789

      340500 -- (-365.307) (-365.775) [-368.887] (-364.669) * (-366.472) (-368.626) (-365.403) [-365.292] -- 0:00:40
      341000 -- [-366.889] (-366.254) (-370.091) (-365.454) * (-368.836) (-368.276) (-367.029) [-367.052] -- 0:00:40
      341500 -- (-367.479) (-365.845) [-368.035] (-367.679) * (-367.800) [-365.304] (-364.568) (-365.008) -- 0:00:40
      342000 -- (-370.057) (-367.017) (-366.669) [-365.380] * (-365.862) (-365.207) [-366.471] (-368.125) -- 0:00:40
      342500 -- (-367.015) (-372.833) (-367.443) [-365.755] * (-365.362) (-365.945) [-367.120] (-365.946) -- 0:00:40
      343000 -- (-373.821) (-367.160) (-366.277) [-365.207] * (-366.905) (-365.380) (-365.908) [-368.391] -- 0:00:40
      343500 -- (-370.045) (-367.198) (-369.817) [-367.576] * (-374.288) [-365.741] (-371.949) (-366.429) -- 0:00:40
      344000 -- (-366.351) [-367.527] (-370.836) (-365.360) * (-375.075) (-368.132) (-369.325) [-365.130] -- 0:00:40
      344500 -- [-367.896] (-367.774) (-366.232) (-366.165) * [-365.644] (-366.733) (-366.182) (-365.312) -- 0:00:39
      345000 -- (-366.981) (-366.284) (-368.186) [-366.161] * [-366.641] (-368.221) (-366.924) (-365.197) -- 0:00:39

      Average standard deviation of split frequencies: 0.013304

      345500 -- (-366.134) [-366.761] (-367.111) (-368.156) * (-367.745) [-365.993] (-367.435) (-365.895) -- 0:00:39
      346000 -- [-371.763] (-366.618) (-367.520) (-365.544) * [-365.429] (-369.391) (-365.305) (-365.870) -- 0:00:39
      346500 -- (-366.573) [-365.677] (-365.878) (-367.086) * (-365.786) [-368.453] (-366.825) (-365.997) -- 0:00:39
      347000 -- (-368.212) [-365.568] (-369.696) (-366.228) * (-364.884) (-364.915) (-369.597) [-369.055] -- 0:00:39
      347500 -- (-365.086) (-368.535) (-374.059) [-369.502] * (-367.446) [-367.571] (-371.335) (-372.194) -- 0:00:39
      348000 -- (-369.504) [-369.043] (-368.897) (-368.795) * [-368.291] (-367.185) (-369.121) (-369.499) -- 0:00:39
      348500 -- (-369.544) (-370.582) (-369.705) [-369.419] * (-367.120) (-366.564) [-365.902] (-367.606) -- 0:00:39
      349000 -- (-366.149) [-367.156] (-368.256) (-369.012) * [-369.350] (-364.748) (-371.726) (-369.123) -- 0:00:39
      349500 -- (-368.949) (-365.178) [-367.748] (-365.354) * (-368.295) (-367.807) [-368.505] (-377.082) -- 0:00:39
      350000 -- (-368.268) (-364.672) [-365.493] (-375.179) * (-365.117) (-368.845) [-365.181] (-372.182) -- 0:00:39

      Average standard deviation of split frequencies: 0.013527

      350500 -- (-365.901) (-365.910) [-365.912] (-369.004) * [-366.274] (-373.436) (-366.030) (-366.486) -- 0:00:38
      351000 -- (-366.347) (-365.915) [-365.875] (-371.043) * [-367.200] (-371.331) (-365.435) (-368.909) -- 0:00:38
      351500 -- [-367.155] (-365.404) (-367.350) (-374.010) * (-366.280) [-367.860] (-368.078) (-365.223) -- 0:00:38
      352000 -- [-366.479] (-366.464) (-369.678) (-368.546) * (-364.966) (-366.831) (-366.285) [-366.841] -- 0:00:38
      352500 -- [-370.591] (-367.601) (-370.527) (-368.583) * (-366.965) (-364.780) (-366.445) [-366.834] -- 0:00:38
      353000 -- [-366.899] (-371.255) (-365.654) (-364.769) * (-366.343) [-367.212] (-366.372) (-367.078) -- 0:00:38
      353500 -- (-365.139) (-368.243) [-367.551] (-367.354) * (-368.463) (-365.098) [-365.609] (-367.361) -- 0:00:38
      354000 -- [-367.833] (-368.656) (-367.874) (-367.899) * (-364.809) (-366.440) [-365.929] (-365.683) -- 0:00:38
      354500 -- (-367.431) (-369.961) [-365.556] (-367.565) * (-366.202) (-369.540) (-365.648) [-366.324] -- 0:00:38
      355000 -- (-368.242) [-365.386] (-365.892) (-365.956) * [-366.297] (-365.665) (-365.828) (-367.309) -- 0:00:38

      Average standard deviation of split frequencies: 0.012229

      355500 -- [-366.076] (-367.829) (-366.725) (-366.149) * (-368.266) (-365.478) (-368.083) [-368.464] -- 0:00:38
      356000 -- (-367.813) (-364.952) (-366.257) [-365.755] * (-366.605) [-365.165] (-366.828) (-368.374) -- 0:00:37
      356500 -- (-367.408) (-365.443) (-367.958) [-365.031] * (-369.603) [-370.606] (-366.795) (-365.995) -- 0:00:37
      357000 -- (-365.760) (-367.640) (-366.744) [-365.872] * (-365.674) [-368.597] (-366.708) (-366.245) -- 0:00:37
      357500 -- (-371.268) (-371.133) [-367.667] (-367.087) * [-365.908] (-365.005) (-368.053) (-366.520) -- 0:00:39
      358000 -- [-368.524] (-369.709) (-370.617) (-366.820) * (-367.502) (-365.974) [-368.320] (-369.855) -- 0:00:39
      358500 -- [-366.552] (-371.251) (-373.869) (-364.838) * (-367.995) (-365.986) (-366.553) [-366.313] -- 0:00:39
      359000 -- (-365.192) [-366.881] (-370.243) (-364.794) * (-366.174) [-365.783] (-368.209) (-368.897) -- 0:00:39
      359500 -- (-375.007) [-365.659] (-367.789) (-366.174) * (-368.321) (-365.353) [-367.088] (-365.313) -- 0:00:39
      360000 -- (-366.062) (-369.780) (-366.711) [-367.741] * (-365.671) (-367.790) [-365.961] (-370.993) -- 0:00:39

      Average standard deviation of split frequencies: 0.013070

      360500 -- (-366.841) (-371.567) [-366.729] (-365.823) * (-365.518) (-366.511) [-367.310] (-370.533) -- 0:00:39
      361000 -- (-371.961) [-366.251] (-368.089) (-368.621) * (-365.587) [-366.717] (-366.488) (-368.428) -- 0:00:38
      361500 -- (-369.105) (-365.030) [-366.412] (-366.797) * (-365.381) (-366.815) (-365.372) [-365.128] -- 0:00:38
      362000 -- [-367.777] (-364.501) (-368.407) (-366.121) * (-366.218) (-368.051) [-368.611] (-370.354) -- 0:00:38
      362500 -- (-367.480) (-370.071) (-366.538) [-367.161] * (-370.019) (-367.622) (-365.927) [-365.055] -- 0:00:38
      363000 -- (-371.263) (-370.469) [-365.506] (-367.323) * [-366.384] (-366.337) (-367.356) (-367.464) -- 0:00:38
      363500 -- [-368.472] (-366.662) (-367.619) (-367.035) * [-366.438] (-367.835) (-366.844) (-366.342) -- 0:00:38
      364000 -- (-366.143) (-366.929) [-368.224] (-367.982) * (-368.039) [-366.119] (-366.585) (-364.590) -- 0:00:38
      364500 -- (-367.543) (-366.747) [-366.503] (-367.438) * (-368.966) [-366.005] (-369.072) (-367.187) -- 0:00:38
      365000 -- [-365.975] (-367.926) (-366.431) (-368.922) * [-366.060] (-368.846) (-366.986) (-366.837) -- 0:00:38

      Average standard deviation of split frequencies: 0.013166

      365500 -- [-366.801] (-366.709) (-367.162) (-365.607) * (-371.857) (-366.529) (-365.284) [-367.117] -- 0:00:38
      366000 -- (-366.648) (-365.939) [-367.162] (-366.391) * (-368.066) [-368.457] (-369.518) (-364.740) -- 0:00:38
      366500 -- (-369.530) [-367.180] (-369.419) (-364.735) * (-370.477) (-371.028) [-368.401] (-365.876) -- 0:00:38
      367000 -- (-367.370) [-365.955] (-372.496) (-365.576) * (-365.834) (-367.385) (-366.363) [-365.460] -- 0:00:37
      367500 -- (-367.369) (-365.791) (-369.913) [-365.975] * [-364.948] (-366.561) (-366.486) (-365.654) -- 0:00:37
      368000 -- (-368.694) (-370.586) (-366.578) [-369.138] * (-365.038) [-365.003] (-367.743) (-367.987) -- 0:00:37
      368500 -- [-368.936] (-365.372) (-365.196) (-368.777) * (-367.098) (-366.044) [-367.104] (-368.240) -- 0:00:37
      369000 -- (-372.302) [-366.152] (-369.860) (-365.815) * (-367.572) [-366.706] (-373.207) (-365.627) -- 0:00:37
      369500 -- [-365.070] (-365.917) (-371.714) (-365.927) * (-364.565) (-369.317) (-370.424) [-365.230] -- 0:00:37
      370000 -- [-366.241] (-365.911) (-372.984) (-365.509) * (-365.861) (-366.270) (-366.481) [-366.423] -- 0:00:37

      Average standard deviation of split frequencies: 0.013283

      370500 -- (-366.156) [-368.272] (-365.048) (-366.988) * [-364.888] (-366.636) (-366.338) (-366.376) -- 0:00:37
      371000 -- [-365.616] (-365.748) (-367.339) (-365.575) * [-368.823] (-366.347) (-366.742) (-366.096) -- 0:00:37
      371500 -- (-367.198) [-366.593] (-369.702) (-368.992) * (-365.654) (-367.999) (-365.343) [-369.846] -- 0:00:37
      372000 -- (-365.424) [-367.037] (-369.960) (-367.959) * (-366.781) (-369.493) (-364.967) [-365.339] -- 0:00:37
      372500 -- [-365.667] (-369.647) (-368.325) (-364.777) * (-367.286) [-366.316] (-366.790) (-366.999) -- 0:00:37
      373000 -- (-367.258) (-374.483) (-367.423) [-365.853] * (-367.917) (-366.597) [-369.970] (-365.279) -- 0:00:36
      373500 -- [-365.286] (-366.708) (-370.410) (-367.910) * (-366.216) (-366.216) [-372.382] (-365.173) -- 0:00:36
      374000 -- (-366.569) [-366.578] (-365.484) (-367.064) * (-367.858) (-369.108) (-368.653) [-366.241] -- 0:00:36
      374500 -- (-369.837) [-365.794] (-368.023) (-367.790) * (-364.905) (-366.419) (-367.755) [-364.773] -- 0:00:38
      375000 -- (-365.724) [-366.594] (-367.785) (-365.685) * (-366.345) (-368.419) [-364.853] (-367.219) -- 0:00:38

      Average standard deviation of split frequencies: 0.013422

      375500 -- (-365.736) (-366.658) [-367.073] (-365.789) * (-364.745) (-368.947) [-364.924] (-365.724) -- 0:00:38
      376000 -- [-365.763] (-366.948) (-366.601) (-366.375) * [-365.618] (-365.404) (-366.092) (-365.661) -- 0:00:38
      376500 -- (-366.883) [-366.326] (-367.453) (-368.411) * (-368.708) [-365.130] (-365.430) (-367.238) -- 0:00:38
      377000 -- (-367.966) [-366.149] (-366.515) (-369.100) * (-367.332) [-365.645] (-368.810) (-364.769) -- 0:00:38
      377500 -- (-366.263) (-366.564) [-370.034] (-368.701) * (-367.589) (-366.011) [-366.665] (-365.693) -- 0:00:37
      378000 -- (-365.213) [-368.342] (-368.638) (-369.950) * [-365.468] (-366.253) (-365.670) (-367.596) -- 0:00:37
      378500 -- [-364.549] (-367.401) (-368.905) (-365.799) * (-366.980) (-367.457) (-366.157) [-365.811] -- 0:00:37
      379000 -- (-367.439) [-367.556] (-369.806) (-365.231) * (-370.393) (-366.928) (-366.743) [-369.705] -- 0:00:37
      379500 -- (-367.978) (-365.369) (-365.392) [-365.743] * (-367.153) (-365.461) [-368.087] (-365.144) -- 0:00:37
      380000 -- (-364.984) (-366.693) (-367.339) [-365.741] * (-369.657) (-368.589) [-367.830] (-365.495) -- 0:00:37

      Average standard deviation of split frequencies: 0.013768

      380500 -- [-368.388] (-365.741) (-364.879) (-365.194) * [-365.778] (-367.458) (-365.006) (-364.874) -- 0:00:37
      381000 -- (-369.290) (-365.390) [-366.272] (-365.838) * [-369.539] (-370.589) (-366.439) (-370.112) -- 0:00:37
      381500 -- (-365.469) [-366.580] (-366.852) (-367.022) * (-365.202) (-369.472) [-369.507] (-369.185) -- 0:00:37
      382000 -- (-370.689) [-364.659] (-366.784) (-366.834) * [-368.276] (-367.641) (-368.039) (-372.614) -- 0:00:37
      382500 -- (-365.901) (-368.205) (-366.044) [-365.310] * [-365.076] (-372.036) (-368.588) (-369.907) -- 0:00:37
      383000 -- (-366.569) (-369.713) [-369.177] (-365.225) * (-366.878) [-366.493] (-369.232) (-367.468) -- 0:00:37
      383500 -- [-365.054] (-365.295) (-366.571) (-369.146) * [-367.157] (-367.994) (-367.178) (-369.769) -- 0:00:36
      384000 -- (-368.834) [-364.550] (-366.329) (-368.877) * (-366.532) [-365.882] (-366.858) (-367.995) -- 0:00:36
      384500 -- (-366.405) (-368.289) [-365.971] (-366.022) * (-365.037) [-368.141] (-367.148) (-366.071) -- 0:00:36
      385000 -- (-365.779) [-368.557] (-370.594) (-365.428) * (-366.932) (-367.073) [-366.021] (-364.655) -- 0:00:36

      Average standard deviation of split frequencies: 0.014511

      385500 -- [-366.619] (-367.250) (-366.160) (-367.336) * (-368.382) [-367.493] (-367.387) (-365.743) -- 0:00:36
      386000 -- (-366.358) [-368.117] (-372.926) (-366.891) * [-364.657] (-370.109) (-367.415) (-368.765) -- 0:00:36
      386500 -- (-366.820) (-368.310) (-369.770) [-370.853] * (-365.283) (-366.332) [-367.217] (-364.636) -- 0:00:36
      387000 -- [-367.908] (-365.759) (-367.362) (-367.813) * (-368.631) [-365.977] (-368.517) (-370.787) -- 0:00:36
      387500 -- (-365.665) [-365.700] (-368.937) (-368.223) * (-367.800) (-372.502) [-365.643] (-367.481) -- 0:00:36
      388000 -- [-366.947] (-364.769) (-364.743) (-366.846) * (-366.407) (-370.816) (-368.353) [-367.773] -- 0:00:36
      388500 -- (-367.694) [-366.030] (-364.979) (-366.048) * (-367.389) (-369.424) [-371.956] (-366.299) -- 0:00:36
      389000 -- (-371.733) (-367.652) (-372.696) [-367.124] * [-366.228] (-372.461) (-367.296) (-366.541) -- 0:00:36
      389500 -- [-365.120] (-366.720) (-367.625) (-366.752) * (-366.040) [-366.840] (-367.524) (-366.779) -- 0:00:36
      390000 -- [-368.200] (-365.375) (-365.388) (-373.731) * (-366.314) [-365.643] (-369.463) (-366.607) -- 0:00:35

      Average standard deviation of split frequencies: 0.014551

      390500 -- (-369.119) (-367.595) [-364.835] (-366.148) * (-370.885) (-365.181) (-369.958) [-366.177] -- 0:00:35
      391000 -- (-366.076) (-365.452) [-366.842] (-365.172) * (-371.389) (-367.850) (-365.201) [-365.941] -- 0:00:35
      391500 -- (-367.359) (-365.209) (-368.061) [-367.908] * [-369.861] (-366.136) (-367.030) (-365.223) -- 0:00:35
      392000 -- [-368.319] (-365.064) (-365.493) (-367.244) * (-366.282) (-371.600) [-366.620] (-365.769) -- 0:00:37
      392500 -- (-367.587) [-370.026] (-365.683) (-365.662) * (-366.546) (-367.194) (-367.436) [-365.755] -- 0:00:37
      393000 -- [-365.879] (-366.794) (-366.569) (-366.723) * (-368.976) (-364.996) (-367.065) [-366.586] -- 0:00:37
      393500 -- (-364.871) (-370.245) [-366.278] (-365.816) * (-365.812) [-364.676] (-366.311) (-365.908) -- 0:00:36
      394000 -- (-365.434) (-371.832) [-368.163] (-368.952) * [-369.044] (-367.038) (-366.314) (-366.718) -- 0:00:36
      394500 -- [-365.764] (-366.169) (-365.044) (-369.892) * (-366.519) (-365.090) [-368.833] (-365.697) -- 0:00:36
      395000 -- [-367.509] (-369.991) (-365.321) (-366.685) * (-366.646) (-367.265) (-365.822) [-365.897] -- 0:00:36

      Average standard deviation of split frequencies: 0.014775

      395500 -- [-366.861] (-367.545) (-367.290) (-369.228) * (-369.285) (-366.397) [-365.811] (-368.238) -- 0:00:36
      396000 -- [-367.692] (-366.624) (-365.704) (-367.668) * (-365.939) (-368.558) [-365.544] (-364.996) -- 0:00:36
      396500 -- (-365.914) (-367.843) [-366.458] (-368.622) * [-366.974] (-368.353) (-365.339) (-365.537) -- 0:00:36
      397000 -- (-366.920) (-370.241) (-366.139) [-365.872] * (-365.909) (-368.622) (-365.609) [-366.762] -- 0:00:36
      397500 -- (-369.117) (-368.712) (-369.319) [-365.869] * [-366.660] (-365.438) (-367.743) (-365.373) -- 0:00:36
      398000 -- (-370.231) (-364.797) (-369.329) [-365.833] * (-367.125) (-367.081) [-366.022] (-365.982) -- 0:00:36
      398500 -- (-369.501) (-367.400) [-366.614] (-365.833) * (-367.045) (-367.481) [-368.242] (-364.652) -- 0:00:36
      399000 -- [-365.492] (-368.834) (-366.027) (-365.991) * (-366.193) [-366.770] (-366.030) (-366.157) -- 0:00:36
      399500 -- (-373.279) (-371.927) (-366.366) [-366.041] * (-365.763) (-366.556) (-367.004) [-365.499] -- 0:00:36
      400000 -- (-368.587) [-365.390] (-371.664) (-366.327) * (-367.390) (-364.978) [-367.172] (-367.601) -- 0:00:36

      Average standard deviation of split frequencies: 0.014465

      400500 -- (-370.400) [-367.570] (-366.496) (-366.634) * (-368.445) [-366.379] (-370.527) (-367.276) -- 0:00:35
      401000 -- (-367.238) [-367.748] (-367.043) (-368.439) * (-368.107) (-367.770) [-370.830] (-366.484) -- 0:00:35
      401500 -- (-366.913) (-368.316) (-368.421) [-368.014] * (-370.376) (-367.252) [-369.898] (-367.674) -- 0:00:35
      402000 -- (-365.519) (-365.363) [-366.782] (-365.779) * (-366.223) (-369.756) (-367.371) [-367.256] -- 0:00:35
      402500 -- [-367.151] (-365.190) (-369.055) (-365.622) * (-367.507) [-367.127] (-366.447) (-365.616) -- 0:00:35
      403000 -- (-368.543) (-368.988) (-368.494) [-365.726] * (-367.756) (-366.254) (-366.260) [-364.732] -- 0:00:35
      403500 -- (-366.035) (-366.122) (-367.588) [-367.754] * [-368.725] (-365.380) (-365.908) (-365.180) -- 0:00:35
      404000 -- [-365.997] (-367.345) (-367.959) (-366.364) * (-365.865) [-368.628] (-365.611) (-366.945) -- 0:00:35
      404500 -- (-366.765) (-368.501) [-366.799] (-364.960) * [-366.685] (-366.998) (-366.751) (-366.849) -- 0:00:35
      405000 -- [-365.976] (-367.682) (-369.148) (-368.266) * (-365.402) (-366.707) (-365.853) [-367.445] -- 0:00:35

      Average standard deviation of split frequencies: 0.014070

      405500 -- (-365.239) (-368.921) [-368.736] (-370.117) * (-368.328) (-366.364) [-368.037] (-365.989) -- 0:00:35
      406000 -- (-370.158) (-368.769) (-367.697) [-366.929] * [-365.863] (-365.595) (-370.132) (-364.903) -- 0:00:35
      406500 -- (-369.089) (-367.317) (-365.881) [-367.732] * [-365.589] (-366.908) (-367.919) (-364.637) -- 0:00:35
      407000 -- [-365.655] (-369.556) (-369.465) (-366.184) * (-365.798) (-366.699) (-365.237) [-369.163] -- 0:00:34
      407500 -- (-369.131) [-370.213] (-366.960) (-368.672) * [-365.299] (-368.605) (-366.124) (-367.501) -- 0:00:34
      408000 -- (-365.846) (-365.249) (-367.012) [-368.754] * (-365.011) (-364.541) [-366.576] (-365.399) -- 0:00:34
      408500 -- (-366.778) (-365.351) (-365.567) [-365.793] * (-365.181) (-372.003) [-369.437] (-364.741) -- 0:00:34
      409000 -- (-369.089) [-366.998] (-364.690) (-368.176) * [-367.324] (-369.856) (-366.151) (-366.453) -- 0:00:36
      409500 -- [-366.220] (-365.462) (-364.605) (-365.970) * (-366.640) (-365.157) [-367.329] (-365.861) -- 0:00:36
      410000 -- (-368.043) (-365.741) (-369.764) [-369.645] * (-369.330) (-368.482) [-367.261] (-366.207) -- 0:00:35

      Average standard deviation of split frequencies: 0.014788

      410500 -- (-368.860) [-365.401] (-368.882) (-367.702) * (-370.383) [-366.567] (-365.775) (-366.106) -- 0:00:35
      411000 -- (-368.533) (-366.319) [-365.806] (-369.363) * (-368.658) [-364.790] (-366.896) (-365.532) -- 0:00:35
      411500 -- (-366.017) [-365.749] (-368.272) (-365.164) * (-365.369) [-365.486] (-366.846) (-369.846) -- 0:00:35
      412000 -- (-365.940) (-364.436) [-369.989] (-365.495) * [-365.489] (-367.134) (-365.420) (-367.866) -- 0:00:35
      412500 -- (-364.944) [-365.316] (-365.153) (-368.068) * [-367.697] (-375.612) (-369.409) (-367.395) -- 0:00:35
      413000 -- (-364.439) [-364.883] (-366.946) (-365.183) * (-368.907) (-369.860) [-366.655] (-367.086) -- 0:00:35
      413500 -- (-365.371) (-366.303) (-365.954) [-365.251] * (-365.755) (-367.576) (-365.078) [-365.804] -- 0:00:35
      414000 -- (-371.668) (-365.565) [-368.308] (-368.959) * (-368.377) (-365.677) (-364.807) [-366.341] -- 0:00:35
      414500 -- (-367.826) (-367.235) (-365.498) [-371.990] * [-367.263] (-366.651) (-365.652) (-366.774) -- 0:00:35
      415000 -- (-368.014) [-367.800] (-365.549) (-365.159) * [-368.307] (-365.983) (-367.149) (-369.637) -- 0:00:35

      Average standard deviation of split frequencies: 0.015265

      415500 -- [-367.733] (-368.989) (-365.725) (-368.948) * (-369.388) [-366.738] (-367.612) (-369.280) -- 0:00:35
      416000 -- [-365.657] (-366.557) (-367.276) (-366.717) * (-367.113) (-368.308) (-368.311) [-366.146] -- 0:00:35
      416500 -- (-365.568) (-366.749) (-368.505) [-366.997] * (-368.372) (-368.513) [-365.769] (-370.751) -- 0:00:35
      417000 -- (-366.606) [-366.179] (-366.937) (-366.075) * (-367.089) (-367.226) [-366.783] (-367.710) -- 0:00:34
      417500 -- (-367.919) (-365.830) [-365.251] (-366.387) * [-366.317] (-367.323) (-365.713) (-367.598) -- 0:00:34
      418000 -- (-366.585) (-365.170) [-370.870] (-368.206) * (-366.201) [-367.480] (-369.749) (-366.568) -- 0:00:34
      418500 -- [-365.575] (-366.628) (-367.546) (-366.323) * (-369.475) (-366.962) [-368.013] (-366.175) -- 0:00:34
      419000 -- (-369.244) [-366.708] (-365.244) (-365.408) * (-365.560) (-370.077) [-366.168] (-367.604) -- 0:00:34
      419500 -- (-366.410) [-367.036] (-366.249) (-367.070) * (-365.267) (-366.139) [-366.289] (-367.894) -- 0:00:34
      420000 -- (-368.044) [-366.472] (-367.153) (-368.824) * (-365.363) (-368.520) [-367.480] (-367.185) -- 0:00:34

      Average standard deviation of split frequencies: 0.015359

      420500 -- [-365.790] (-367.508) (-367.683) (-371.106) * (-365.955) (-365.662) [-364.569] (-368.234) -- 0:00:34
      421000 -- (-367.127) [-366.491] (-366.873) (-365.701) * (-366.475) [-366.249] (-368.844) (-364.797) -- 0:00:34
      421500 -- (-366.375) [-364.740] (-366.847) (-368.947) * [-367.164] (-365.014) (-366.439) (-365.932) -- 0:00:34
      422000 -- (-367.542) (-365.567) (-368.397) [-367.482] * (-365.731) [-364.925] (-367.330) (-366.973) -- 0:00:34
      422500 -- (-367.463) (-369.371) [-368.182] (-369.737) * (-368.181) (-365.759) (-365.493) [-369.738] -- 0:00:34
      423000 -- (-368.403) [-365.441] (-364.535) (-367.057) * (-369.722) [-366.324] (-365.687) (-365.062) -- 0:00:34
      423500 -- (-365.858) (-365.012) (-370.718) [-364.913] * (-365.376) (-368.389) (-366.622) [-367.025] -- 0:00:34
      424000 -- (-372.595) (-364.747) [-366.993] (-365.945) * (-365.376) (-367.021) [-365.540] (-365.341) -- 0:00:33
      424500 -- (-366.632) (-365.123) (-369.192) [-367.939] * (-365.913) (-366.046) (-367.554) [-364.818] -- 0:00:33
      425000 -- (-368.564) (-369.574) (-369.984) [-366.244] * (-365.335) (-367.279) [-367.613] (-366.863) -- 0:00:33

      Average standard deviation of split frequencies: 0.014509

      425500 -- [-368.323] (-365.974) (-366.120) (-364.792) * (-367.576) (-365.959) (-370.119) [-366.387] -- 0:00:33
      426000 -- (-366.579) (-370.440) (-365.304) [-366.883] * (-366.089) (-365.421) [-369.966] (-364.908) -- 0:00:35
      426500 -- (-365.934) (-371.533) [-365.123] (-367.614) * (-371.902) [-366.077] (-366.185) (-365.846) -- 0:00:34
      427000 -- (-365.849) (-364.558) (-365.991) [-366.194] * (-369.346) (-368.583) (-366.141) [-367.418] -- 0:00:34
      427500 -- [-365.729] (-367.436) (-368.724) (-367.928) * (-369.999) [-365.280] (-365.732) (-366.089) -- 0:00:34
      428000 -- (-368.578) (-366.189) [-366.321] (-367.497) * (-367.816) [-366.336] (-365.045) (-365.001) -- 0:00:34
      428500 -- (-366.343) (-366.167) (-366.830) [-366.233] * (-366.715) (-367.302) [-364.597] (-365.661) -- 0:00:34
      429000 -- (-368.692) (-365.870) (-369.730) [-367.177] * [-367.274] (-365.449) (-366.050) (-366.301) -- 0:00:34
      429500 -- (-366.961) (-367.891) [-366.310] (-370.783) * (-366.762) (-367.419) (-372.312) [-364.437] -- 0:00:34
      430000 -- (-373.752) (-364.845) [-366.876] (-369.441) * (-368.004) [-370.480] (-367.170) (-364.911) -- 0:00:34

      Average standard deviation of split frequencies: 0.013682

      430500 -- (-370.375) (-364.663) (-367.505) [-366.221] * (-369.894) [-365.279] (-368.130) (-366.253) -- 0:00:34
      431000 -- (-365.329) (-365.301) [-367.360] (-367.380) * [-365.988] (-365.059) (-370.575) (-366.040) -- 0:00:34
      431500 -- [-366.034] (-366.059) (-368.907) (-365.534) * [-368.054] (-366.749) (-368.453) (-367.812) -- 0:00:34
      432000 -- (-366.959) (-367.158) [-365.278] (-366.598) * (-367.638) (-366.556) (-364.982) [-365.899] -- 0:00:34
      432500 -- (-367.208) (-366.703) (-365.502) [-365.770] * (-365.432) [-366.935] (-373.569) (-366.361) -- 0:00:34
      433000 -- (-368.882) [-367.050] (-366.126) (-365.337) * (-368.674) [-365.860] (-368.199) (-368.286) -- 0:00:34
      433500 -- (-367.121) (-367.483) (-364.833) [-365.887] * (-366.183) (-369.513) [-368.723] (-365.532) -- 0:00:33
      434000 -- (-366.089) (-367.489) (-365.113) [-367.742] * (-365.402) [-368.688] (-366.084) (-364.937) -- 0:00:33
      434500 -- (-370.657) (-367.863) [-366.131] (-367.886) * (-366.625) (-366.992) [-364.780] (-366.593) -- 0:00:33
      435000 -- (-370.101) (-366.679) (-364.743) [-364.865] * [-364.711] (-368.113) (-367.643) (-365.012) -- 0:00:33

      Average standard deviation of split frequencies: 0.012974

      435500 -- (-369.699) (-373.436) [-368.307] (-371.586) * (-364.645) [-365.620] (-366.735) (-365.289) -- 0:00:33
      436000 -- (-364.872) (-367.548) (-365.829) [-366.608] * (-367.555) [-365.554] (-367.904) (-368.579) -- 0:00:33
      436500 -- [-364.855] (-366.089) (-365.992) (-365.652) * (-365.689) [-366.506] (-367.950) (-365.826) -- 0:00:33
      437000 -- [-365.478] (-367.520) (-366.524) (-366.824) * [-367.057] (-365.808) (-366.675) (-365.954) -- 0:00:33
      437500 -- (-368.400) [-365.717] (-367.545) (-367.416) * (-365.735) (-367.100) (-365.584) [-365.862] -- 0:00:33
      438000 -- (-366.272) [-366.563] (-364.717) (-367.362) * (-365.773) (-365.958) (-366.946) [-366.979] -- 0:00:33
      438500 -- [-367.660] (-365.431) (-366.452) (-365.217) * (-367.371) (-366.249) (-368.985) [-365.772] -- 0:00:33
      439000 -- [-364.781] (-366.185) (-367.805) (-367.367) * (-368.690) (-365.808) [-365.475] (-366.135) -- 0:00:33
      439500 -- [-367.140] (-366.102) (-365.711) (-365.257) * [-365.121] (-366.059) (-368.570) (-364.944) -- 0:00:33
      440000 -- [-367.446] (-367.777) (-367.290) (-367.034) * (-364.458) (-365.685) (-368.294) [-366.413] -- 0:00:33

      Average standard deviation of split frequencies: 0.013655

      440500 -- (-367.768) (-369.042) [-366.687] (-365.111) * (-369.843) (-364.322) (-366.083) [-366.266] -- 0:00:33
      441000 -- (-366.477) (-367.334) [-366.266] (-366.953) * (-367.848) (-366.819) (-366.361) [-366.243] -- 0:00:32
      441500 -- (-365.697) (-366.461) [-367.184] (-365.585) * (-367.670) [-367.842] (-368.752) (-370.023) -- 0:00:32
      442000 -- (-369.792) [-367.445] (-365.261) (-365.181) * (-365.872) (-371.443) (-366.676) [-367.428] -- 0:00:32
      442500 -- [-367.458] (-368.650) (-367.465) (-365.567) * (-366.775) (-365.844) (-366.094) [-366.845] -- 0:00:32
      443000 -- (-365.990) (-366.794) (-366.338) [-365.635] * (-364.856) [-365.749] (-367.749) (-367.306) -- 0:00:32
      443500 -- (-367.122) (-369.791) [-365.795] (-370.025) * (-367.498) (-366.600) (-365.180) [-367.214] -- 0:00:33
      444000 -- (-370.454) (-368.940) (-368.669) [-366.820] * (-368.716) (-368.715) [-365.870] (-365.164) -- 0:00:33
      444500 -- (-366.410) (-367.391) (-365.354) [-365.772] * (-366.891) (-365.608) (-366.992) [-365.311] -- 0:00:33
      445000 -- (-365.528) (-368.418) (-365.143) [-366.027] * (-365.237) (-365.640) [-367.145] (-366.978) -- 0:00:33

      Average standard deviation of split frequencies: 0.013506

      445500 -- [-365.099] (-365.290) (-364.711) (-367.525) * (-365.202) (-367.725) (-367.085) [-366.811] -- 0:00:33
      446000 -- (-366.041) [-369.359] (-366.774) (-368.757) * [-366.788] (-368.101) (-366.356) (-366.588) -- 0:00:33
      446500 -- (-366.689) [-366.632] (-365.604) (-366.035) * (-366.289) (-366.676) [-367.431] (-369.151) -- 0:00:33
      447000 -- [-370.630] (-367.862) (-365.646) (-366.425) * (-364.893) (-364.619) (-367.770) [-365.262] -- 0:00:33
      447500 -- (-370.158) (-365.730) [-365.855] (-366.552) * [-367.866] (-368.627) (-366.539) (-365.951) -- 0:00:33
      448000 -- [-365.900] (-365.172) (-365.045) (-367.927) * (-367.127) (-366.940) (-365.946) [-366.741] -- 0:00:33
      448500 -- (-365.380) (-367.810) (-365.256) [-369.798] * [-365.694] (-368.346) (-368.823) (-366.110) -- 0:00:33
      449000 -- (-367.363) (-369.814) [-369.225] (-366.587) * (-366.123) (-370.799) [-366.481] (-369.399) -- 0:00:33
      449500 -- [-365.532] (-366.530) (-366.401) (-366.807) * (-365.902) (-368.890) [-366.515] (-367.382) -- 0:00:33
      450000 -- (-365.853) (-366.632) (-365.738) [-365.244] * (-368.727) [-368.243] (-366.339) (-370.243) -- 0:00:33

      Average standard deviation of split frequencies: 0.015383

      450500 -- [-366.870] (-366.546) (-367.819) (-372.605) * (-367.445) (-367.310) [-368.298] (-370.744) -- 0:00:32
      451000 -- (-367.390) (-367.343) [-367.902] (-369.419) * [-367.236] (-368.187) (-369.163) (-366.083) -- 0:00:32
      451500 -- (-368.470) (-366.797) [-367.715] (-365.764) * (-367.108) (-365.178) [-369.132] (-364.767) -- 0:00:32
      452000 -- (-365.250) (-367.868) (-365.318) [-368.192] * (-366.494) (-367.975) [-367.295] (-366.395) -- 0:00:32
      452500 -- (-366.010) [-367.010] (-368.599) (-365.063) * (-366.209) [-365.313] (-369.134) (-367.614) -- 0:00:32
      453000 -- (-366.423) (-365.743) (-367.498) [-365.248] * (-366.808) [-364.970] (-364.693) (-370.392) -- 0:00:32
      453500 -- [-372.237] (-366.434) (-365.049) (-367.667) * (-365.801) (-367.870) [-365.853] (-368.618) -- 0:00:32
      454000 -- (-366.729) (-370.058) [-365.845] (-370.386) * (-365.419) (-367.285) [-367.404] (-364.739) -- 0:00:32
      454500 -- [-367.558] (-370.023) (-365.827) (-368.436) * (-366.236) (-367.556) [-366.442] (-366.393) -- 0:00:32
      455000 -- (-364.890) [-368.325] (-366.321) (-365.228) * (-376.042) [-368.329] (-366.878) (-367.336) -- 0:00:32

      Average standard deviation of split frequencies: 0.015263

      455500 -- (-366.927) [-365.880] (-366.734) (-366.081) * (-368.741) (-367.062) [-367.861] (-365.968) -- 0:00:32
      456000 -- (-368.318) [-365.895] (-367.383) (-368.307) * (-367.316) [-365.942] (-373.549) (-367.404) -- 0:00:32
      456500 -- (-368.587) [-368.603] (-367.020) (-367.502) * (-369.445) (-366.744) (-370.828) [-365.681] -- 0:00:32
      457000 -- [-364.657] (-364.602) (-368.726) (-365.846) * (-366.303) [-367.393] (-367.851) (-365.871) -- 0:00:32
      457500 -- (-368.522) (-367.488) (-366.224) [-366.308] * (-366.153) (-365.182) [-365.240] (-368.408) -- 0:00:32
      458000 -- (-365.831) [-365.990] (-365.411) (-366.999) * (-366.801) (-370.464) [-365.888] (-366.820) -- 0:00:31
      458500 -- (-365.058) (-368.677) (-367.720) [-365.844] * (-367.708) [-365.594] (-370.423) (-368.113) -- 0:00:31
      459000 -- [-366.381] (-367.155) (-373.997) (-369.172) * (-369.774) (-365.704) (-366.791) [-366.366] -- 0:00:31
      459500 -- (-368.914) (-369.110) [-364.853] (-366.324) * [-366.829] (-364.624) (-367.171) (-367.300) -- 0:00:31
      460000 -- [-365.982] (-367.447) (-367.442) (-365.452) * (-365.944) (-365.221) [-365.335] (-365.993) -- 0:00:31

      Average standard deviation of split frequencies: 0.015222

      460500 -- (-366.896) [-368.870] (-364.864) (-372.752) * (-367.470) (-367.231) [-365.396] (-367.918) -- 0:00:32
      461000 -- [-365.780] (-367.101) (-367.276) (-369.070) * (-365.930) (-364.954) [-365.757] (-366.478) -- 0:00:32
      461500 -- [-366.134] (-368.236) (-367.912) (-368.903) * [-365.742] (-364.437) (-367.659) (-366.279) -- 0:00:32
      462000 -- (-370.815) [-369.624] (-365.397) (-367.053) * (-367.788) (-364.814) [-367.412] (-365.931) -- 0:00:32
      462500 -- (-367.099) (-367.536) [-364.751] (-368.354) * [-365.594] (-367.335) (-365.540) (-365.916) -- 0:00:32
      463000 -- [-368.690] (-370.302) (-368.637) (-366.488) * (-365.965) (-366.468) (-367.624) [-367.173] -- 0:00:32
      463500 -- (-364.890) [-365.121] (-368.981) (-364.682) * (-368.105) [-365.107] (-365.541) (-370.211) -- 0:00:32
      464000 -- (-366.206) (-367.624) (-372.766) [-366.795] * (-369.209) [-367.292] (-368.489) (-366.543) -- 0:00:32
      464500 -- (-367.788) (-364.531) [-365.576] (-367.355) * (-372.132) (-366.992) [-368.297] (-366.083) -- 0:00:32
      465000 -- (-369.556) [-365.555] (-365.533) (-366.387) * (-366.428) (-365.796) [-367.537] (-367.019) -- 0:00:32

      Average standard deviation of split frequencies: 0.015230

      465500 -- (-367.462) (-368.726) (-365.641) [-365.503] * [-365.759] (-367.187) (-367.400) (-366.365) -- 0:00:32
      466000 -- (-365.957) (-366.364) [-366.617] (-366.660) * (-367.577) [-365.025] (-366.769) (-367.516) -- 0:00:32
      466500 -- (-371.371) [-366.925] (-367.870) (-366.014) * (-371.958) (-366.521) [-365.658] (-366.198) -- 0:00:32
      467000 -- (-366.372) (-366.702) (-365.271) [-365.945] * (-376.390) (-367.098) [-366.481] (-368.913) -- 0:00:31
      467500 -- (-365.207) [-366.344] (-365.067) (-367.051) * (-371.992) (-366.173) (-367.472) [-365.019] -- 0:00:31
      468000 -- [-367.173] (-365.862) (-367.513) (-366.614) * (-367.374) [-367.624] (-364.647) (-365.493) -- 0:00:31
      468500 -- (-374.073) (-365.285) (-365.094) [-365.043] * [-366.715] (-367.787) (-366.045) (-365.728) -- 0:00:31
      469000 -- (-367.108) [-365.457] (-365.767) (-367.893) * (-367.124) (-365.614) [-366.719] (-370.073) -- 0:00:31
      469500 -- (-365.729) [-364.509] (-366.530) (-365.802) * [-364.880] (-370.553) (-369.724) (-370.060) -- 0:00:31
      470000 -- (-364.945) (-365.496) (-365.818) [-365.940] * (-366.109) (-365.839) [-365.843] (-367.902) -- 0:00:31

      Average standard deviation of split frequencies: 0.014912

      470500 -- (-367.046) [-369.200] (-367.548) (-365.412) * [-366.959] (-366.023) (-367.167) (-367.290) -- 0:00:31
      471000 -- (-369.133) (-367.153) [-366.302] (-367.649) * [-366.606] (-371.859) (-367.032) (-369.365) -- 0:00:31
      471500 -- (-366.899) (-368.213) [-365.124] (-368.096) * (-368.287) (-367.156) (-364.687) [-367.741] -- 0:00:31
      472000 -- (-368.543) (-366.856) (-366.775) [-365.422] * (-366.946) (-365.987) [-365.074] (-373.180) -- 0:00:31
      472500 -- (-367.587) (-366.678) [-364.763] (-366.094) * (-366.667) [-365.415] (-366.552) (-370.292) -- 0:00:31
      473000 -- (-367.735) (-365.456) [-364.983] (-367.892) * (-367.211) (-369.613) [-368.243] (-369.085) -- 0:00:31
      473500 -- [-365.057] (-367.135) (-367.478) (-365.247) * (-369.807) (-366.643) [-369.181] (-369.231) -- 0:00:31
      474000 -- (-364.805) (-366.628) (-366.924) [-366.401] * [-367.478] (-365.295) (-366.925) (-365.724) -- 0:00:31
      474500 -- (-367.955) [-367.643] (-369.748) (-366.128) * (-364.551) [-369.010] (-365.501) (-365.254) -- 0:00:31
      475000 -- (-373.347) [-367.957] (-368.628) (-366.308) * (-368.635) [-364.515] (-366.243) (-365.836) -- 0:00:30

      Average standard deviation of split frequencies: 0.014910

      475500 -- (-366.513) (-369.913) (-365.645) [-365.603] * (-366.859) (-366.274) (-365.234) [-366.300] -- 0:00:30
      476000 -- (-368.610) (-367.154) [-365.016] (-365.585) * (-369.353) (-367.125) (-367.167) [-366.513] -- 0:00:30
      476500 -- (-366.832) (-367.707) [-365.928] (-368.481) * (-365.937) (-365.053) (-366.566) [-365.729] -- 0:00:30
      477000 -- (-368.539) (-365.820) (-371.148) [-366.748] * (-367.291) [-364.749] (-366.208) (-366.017) -- 0:00:30
      477500 -- (-370.104) [-365.097] (-367.289) (-365.939) * (-364.481) (-370.065) (-365.689) [-367.946] -- 0:00:30
      478000 -- (-367.708) [-365.299] (-368.682) (-366.264) * (-368.951) [-366.687] (-366.336) (-365.670) -- 0:00:31
      478500 -- (-367.168) (-365.894) [-367.250] (-365.908) * [-365.796] (-367.251) (-365.353) (-367.387) -- 0:00:31
      479000 -- (-366.234) (-368.126) [-364.781] (-365.528) * (-366.735) (-370.304) (-365.199) [-367.905] -- 0:00:31
      479500 -- (-367.481) (-367.164) (-367.211) [-365.267] * (-364.789) (-372.297) [-365.060] (-366.742) -- 0:00:31
      480000 -- (-368.922) (-366.199) [-367.085] (-366.749) * [-366.823] (-372.708) (-366.166) (-365.147) -- 0:00:31

      Average standard deviation of split frequencies: 0.014076

      480500 -- [-365.823] (-365.094) (-365.423) (-366.364) * (-364.696) (-367.565) [-367.276] (-371.270) -- 0:00:31
      481000 -- (-366.122) [-364.539] (-366.789) (-370.097) * (-368.501) (-365.785) (-365.717) [-365.807] -- 0:00:31
      481500 -- [-366.751] (-365.251) (-366.962) (-364.682) * (-364.787) [-367.517] (-365.662) (-366.173) -- 0:00:31
      482000 -- [-366.896] (-365.842) (-371.518) (-365.842) * [-366.651] (-367.184) (-365.182) (-364.717) -- 0:00:31
      482500 -- [-367.788] (-366.664) (-367.872) (-366.865) * (-369.254) (-367.374) (-365.222) [-365.362] -- 0:00:31
      483000 -- (-370.593) (-368.026) [-367.403] (-367.738) * [-368.928] (-366.504) (-365.133) (-364.885) -- 0:00:31
      483500 -- [-372.596] (-364.847) (-367.607) (-365.828) * (-370.574) [-365.373] (-365.710) (-365.004) -- 0:00:30
      484000 -- (-366.267) [-365.916] (-366.181) (-371.258) * (-366.497) (-365.559) (-367.162) [-366.031] -- 0:00:30
      484500 -- (-368.238) [-368.387] (-368.009) (-366.526) * (-368.518) [-372.269] (-365.596) (-369.755) -- 0:00:30
      485000 -- (-373.441) (-367.583) (-365.939) [-365.404] * (-370.046) [-367.177] (-369.109) (-368.497) -- 0:00:30

      Average standard deviation of split frequencies: 0.013222

      485500 -- (-366.508) [-369.268] (-366.303) (-365.739) * (-366.481) [-367.351] (-368.778) (-365.461) -- 0:00:30
      486000 -- (-365.531) [-364.458] (-366.027) (-366.854) * [-369.969] (-369.923) (-367.536) (-368.793) -- 0:00:30
      486500 -- [-367.462] (-365.561) (-368.864) (-365.270) * (-367.430) (-368.742) [-366.509] (-367.534) -- 0:00:30
      487000 -- (-366.700) (-370.357) (-369.386) [-368.659] * (-368.653) (-365.773) (-369.025) [-368.051] -- 0:00:30
      487500 -- [-365.441] (-371.502) (-367.938) (-367.680) * (-367.150) (-369.477) [-366.672] (-368.857) -- 0:00:30
      488000 -- (-367.139) (-370.898) [-368.883] (-367.208) * [-367.278] (-365.682) (-369.808) (-369.511) -- 0:00:30
      488500 -- (-368.342) [-367.870] (-369.265) (-365.519) * [-366.414] (-367.633) (-369.000) (-365.714) -- 0:00:30
      489000 -- [-367.576] (-368.067) (-367.583) (-366.985) * (-365.162) (-365.574) (-369.019) [-368.627] -- 0:00:30
      489500 -- (-371.376) (-366.736) [-367.657] (-365.487) * [-367.895] (-366.284) (-365.450) (-368.848) -- 0:00:30
      490000 -- (-367.655) (-369.092) [-367.819] (-365.567) * (-367.017) (-366.077) [-367.579] (-370.930) -- 0:00:30

      Average standard deviation of split frequencies: 0.013400

      490500 -- (-365.753) (-372.903) [-366.579] (-365.276) * (-368.282) (-366.871) (-372.842) [-368.932] -- 0:00:30
      491000 -- [-367.263] (-366.394) (-368.258) (-367.245) * (-368.785) (-369.485) [-365.902] (-368.100) -- 0:00:30
      491500 -- (-367.683) [-367.903] (-365.893) (-365.021) * (-366.526) [-365.622] (-368.049) (-368.256) -- 0:00:30
      492000 -- (-365.798) (-371.487) [-366.192] (-366.537) * (-367.315) (-367.056) (-366.127) [-366.760] -- 0:00:29
      492500 -- (-367.431) (-368.766) (-369.911) [-369.032] * (-368.649) [-366.670] (-365.255) (-367.051) -- 0:00:29
      493000 -- [-366.770] (-365.305) (-365.093) (-368.521) * (-365.854) [-366.122] (-364.949) (-365.784) -- 0:00:29
      493500 -- [-366.580] (-365.388) (-369.993) (-367.306) * [-369.620] (-370.211) (-370.532) (-368.972) -- 0:00:29
      494000 -- [-365.570] (-365.775) (-369.589) (-366.925) * (-372.751) (-365.119) (-368.545) [-365.262] -- 0:00:29
      494500 -- (-365.006) (-365.231) (-367.021) [-365.256] * [-369.833] (-365.735) (-368.719) (-366.506) -- 0:00:29
      495000 -- (-365.135) (-365.732) (-366.710) [-364.984] * (-369.247) (-367.742) (-365.695) [-367.514] -- 0:00:30

      Average standard deviation of split frequencies: 0.012672

      495500 -- (-373.143) (-368.269) [-370.760] (-366.518) * (-366.958) (-369.833) (-365.739) [-366.937] -- 0:00:30
      496000 -- [-366.666] (-369.083) (-371.340) (-367.455) * (-365.666) [-365.041] (-368.268) (-366.382) -- 0:00:30
      496500 -- (-365.439) (-366.304) [-373.355] (-367.943) * (-370.617) (-366.839) [-364.546] (-367.178) -- 0:00:30
      497000 -- (-365.625) [-366.536] (-366.308) (-366.814) * (-371.121) [-373.433] (-366.913) (-367.562) -- 0:00:30
      497500 -- (-366.387) [-365.835] (-366.645) (-366.219) * [-367.187] (-366.592) (-366.833) (-367.424) -- 0:00:30
      498000 -- [-365.349] (-366.825) (-365.232) (-367.005) * (-367.054) (-365.952) [-368.770] (-365.344) -- 0:00:30
      498500 -- (-367.594) (-365.240) [-369.588] (-368.364) * (-369.680) (-365.357) (-369.827) [-365.872] -- 0:00:30
      499000 -- (-364.566) [-365.087] (-366.561) (-366.537) * (-366.292) [-365.509] (-366.537) (-369.131) -- 0:00:30
      499500 -- (-366.051) [-364.955] (-367.091) (-365.323) * [-366.158] (-368.103) (-365.585) (-369.538) -- 0:00:30
      500000 -- (-366.027) (-366.768) [-368.617] (-366.779) * [-367.845] (-368.402) (-367.264) (-367.967) -- 0:00:30

      Average standard deviation of split frequencies: 0.013132

      500500 -- [-365.077] (-366.600) (-365.903) (-365.948) * (-367.557) (-368.906) (-367.782) [-367.869] -- 0:00:29
      501000 -- [-368.340] (-367.729) (-365.763) (-367.975) * (-367.235) (-368.257) [-364.866] (-365.998) -- 0:00:29
      501500 -- (-367.641) (-367.599) (-366.435) [-366.514] * (-371.450) (-368.049) (-366.814) [-364.696] -- 0:00:29
      502000 -- (-370.359) (-365.542) (-372.283) [-365.958] * (-369.387) (-369.251) [-366.527] (-366.286) -- 0:00:29
      502500 -- [-365.209] (-365.648) (-370.511) (-366.567) * (-369.662) [-365.297] (-366.755) (-368.648) -- 0:00:29
      503000 -- [-369.226] (-364.954) (-367.526) (-365.378) * (-365.649) (-365.156) (-368.425) [-366.509] -- 0:00:29
      503500 -- (-366.111) [-365.441] (-366.583) (-366.330) * (-364.824) (-365.088) [-370.486] (-367.289) -- 0:00:29
      504000 -- (-367.850) (-365.701) [-370.293] (-365.202) * (-365.326) (-365.923) [-366.266] (-367.885) -- 0:00:29
      504500 -- [-366.909] (-366.211) (-365.021) (-365.536) * (-365.719) [-371.367] (-368.497) (-367.169) -- 0:00:29
      505000 -- (-367.682) [-365.249] (-365.319) (-366.918) * (-366.396) [-365.406] (-366.266) (-366.271) -- 0:00:29

      Average standard deviation of split frequencies: 0.013386

      505500 -- (-368.040) (-366.375) [-364.984] (-366.932) * (-365.005) (-364.704) (-366.251) [-368.898] -- 0:00:29
      506000 -- (-365.817) [-365.192] (-365.870) (-365.256) * [-370.126] (-366.106) (-368.368) (-373.753) -- 0:00:29
      506500 -- [-365.495] (-366.037) (-364.921) (-368.078) * (-366.097) (-368.999) (-365.332) [-368.302] -- 0:00:29
      507000 -- (-365.362) (-365.538) (-373.006) [-367.037] * (-366.704) [-366.915] (-366.914) (-369.591) -- 0:00:29
      507500 -- (-366.577) (-367.436) [-365.992] (-365.148) * (-367.374) (-365.643) (-367.982) [-365.405] -- 0:00:29
      508000 -- [-369.878] (-367.626) (-369.694) (-367.469) * [-369.309] (-365.816) (-365.999) (-365.072) -- 0:00:29
      508500 -- [-367.388] (-368.318) (-368.134) (-369.598) * [-372.798] (-365.561) (-365.297) (-367.878) -- 0:00:28
      509000 -- [-366.269] (-371.869) (-368.831) (-366.718) * (-368.747) (-365.950) (-365.812) [-365.312] -- 0:00:28
      509500 -- (-367.510) [-366.974] (-366.115) (-370.753) * (-365.159) (-364.849) (-367.024) [-364.980] -- 0:00:28
      510000 -- (-365.220) (-364.799) [-365.598] (-369.760) * (-367.151) [-364.498] (-365.854) (-367.049) -- 0:00:28

      Average standard deviation of split frequencies: 0.013458

      510500 -- [-367.085] (-365.872) (-365.972) (-367.265) * (-364.959) (-370.070) [-366.811] (-369.112) -- 0:00:28
      511000 -- (-365.840) (-370.409) (-367.843) [-364.786] * [-368.914] (-365.791) (-366.733) (-366.026) -- 0:00:28
      511500 -- [-366.539] (-369.725) (-367.973) (-365.419) * (-366.747) (-366.124) [-365.843] (-366.782) -- 0:00:28
      512000 -- (-366.694) (-367.537) [-366.510] (-365.837) * (-369.283) (-365.171) [-366.608] (-366.100) -- 0:00:29
      512500 -- (-366.393) (-365.046) [-371.659] (-366.856) * [-366.031] (-371.932) (-369.565) (-365.421) -- 0:00:29
      513000 -- [-369.263] (-369.619) (-365.466) (-373.377) * [-367.644] (-366.106) (-366.936) (-365.838) -- 0:00:29
      513500 -- (-370.273) (-369.482) (-364.882) [-370.688] * (-372.332) [-365.047] (-365.491) (-365.660) -- 0:00:29
      514000 -- [-367.015] (-365.331) (-365.484) (-368.246) * (-367.561) (-365.455) (-370.930) [-369.227] -- 0:00:29
      514500 -- (-365.550) (-369.959) (-370.625) [-364.813] * (-365.400) (-368.116) (-369.920) [-367.065] -- 0:00:29
      515000 -- (-367.265) (-368.018) (-367.981) [-366.255] * (-366.157) [-367.101] (-368.829) (-365.291) -- 0:00:29

      Average standard deviation of split frequencies: 0.013319

      515500 -- (-367.924) (-367.808) (-366.578) [-365.227] * (-367.450) (-368.334) [-366.184] (-367.173) -- 0:00:29
      516000 -- (-367.205) (-365.261) [-366.133] (-366.628) * [-367.225] (-367.490) (-367.094) (-365.474) -- 0:00:29
      516500 -- (-365.874) [-364.721] (-368.466) (-366.288) * (-366.290) [-365.800] (-366.204) (-366.985) -- 0:00:29
      517000 -- (-373.654) [-366.425] (-367.180) (-364.370) * (-367.741) [-366.637] (-366.128) (-365.746) -- 0:00:28
      517500 -- [-365.182] (-366.293) (-366.208) (-372.838) * (-366.328) (-369.170) (-365.709) [-367.829] -- 0:00:28
      518000 -- [-365.373] (-367.796) (-366.802) (-366.172) * [-366.214] (-366.333) (-365.337) (-369.660) -- 0:00:28
      518500 -- [-366.486] (-365.618) (-365.035) (-367.806) * (-369.246) (-365.318) [-365.570] (-367.930) -- 0:00:28
      519000 -- [-366.185] (-365.248) (-367.052) (-365.626) * (-365.203) (-368.450) [-368.827] (-367.210) -- 0:00:28
      519500 -- (-366.957) (-367.599) [-367.476] (-366.401) * (-366.414) (-371.919) [-365.901] (-366.845) -- 0:00:28
      520000 -- [-371.648] (-369.987) (-366.993) (-365.947) * (-369.940) (-366.937) (-367.723) [-366.386] -- 0:00:28

      Average standard deviation of split frequencies: 0.013247

      520500 -- (-366.461) (-373.983) (-367.931) [-365.743] * (-367.606) [-366.682] (-366.679) (-365.736) -- 0:00:28
      521000 -- (-367.897) [-365.652] (-368.247) (-371.500) * [-366.223] (-365.399) (-365.583) (-370.662) -- 0:00:28
      521500 -- (-367.659) (-367.032) (-369.386) [-368.431] * (-367.901) (-367.114) (-366.898) [-365.664] -- 0:00:28
      522000 -- [-369.858] (-366.052) (-366.283) (-365.700) * [-365.762] (-368.170) (-368.112) (-366.562) -- 0:00:28
      522500 -- [-367.710] (-369.701) (-369.532) (-369.882) * (-368.865) (-368.118) (-366.778) [-366.605] -- 0:00:28
      523000 -- (-368.613) (-370.698) [-364.914] (-366.259) * (-366.244) (-370.146) (-368.149) [-366.906] -- 0:00:28
      523500 -- (-367.511) (-367.079) [-365.727] (-367.293) * (-368.005) (-367.138) [-367.189] (-367.776) -- 0:00:28
      524000 -- (-365.241) (-366.068) [-365.838] (-366.134) * (-371.288) [-365.417] (-369.913) (-366.044) -- 0:00:28
      524500 -- [-365.743] (-367.337) (-371.565) (-365.572) * (-371.297) [-367.392] (-369.871) (-369.492) -- 0:00:28
      525000 -- (-366.683) (-367.510) [-367.124] (-364.992) * (-368.928) [-366.634] (-367.860) (-368.033) -- 0:00:28

      Average standard deviation of split frequencies: 0.014056

      525500 -- (-368.009) (-369.102) [-366.068] (-369.651) * (-369.125) (-370.254) (-367.501) [-365.516] -- 0:00:27
      526000 -- [-370.615] (-366.922) (-369.549) (-371.516) * (-367.236) (-366.710) (-366.507) [-365.636] -- 0:00:27
      526500 -- (-373.231) [-368.007] (-366.124) (-367.677) * (-368.133) (-364.992) (-368.550) [-365.459] -- 0:00:27
      527000 -- (-368.196) (-365.066) [-366.938] (-367.184) * (-369.642) (-365.166) (-368.703) [-365.691] -- 0:00:27
      527500 -- [-369.763] (-366.005) (-366.225) (-368.191) * (-366.290) (-376.181) [-366.682] (-366.373) -- 0:00:27
      528000 -- (-368.195) [-365.868] (-365.054) (-368.384) * (-378.310) (-368.329) (-367.590) [-368.214] -- 0:00:27
      528500 -- [-368.782] (-366.221) (-366.145) (-369.097) * [-365.334] (-365.256) (-364.536) (-367.103) -- 0:00:27
      529000 -- [-365.168] (-366.071) (-365.084) (-366.442) * (-365.450) (-371.571) (-365.326) [-366.784] -- 0:00:27
      529500 -- (-365.768) [-373.268] (-367.543) (-365.809) * [-365.979] (-369.181) (-366.500) (-365.558) -- 0:00:28
      530000 -- [-368.353] (-366.581) (-372.262) (-365.083) * (-365.788) (-365.108) [-364.796] (-366.260) -- 0:00:28

      Average standard deviation of split frequencies: 0.014868

      530500 -- (-366.035) (-365.217) [-366.139] (-366.568) * (-366.239) (-365.213) (-365.927) [-368.425] -- 0:00:28
      531000 -- (-365.375) (-365.105) (-366.483) [-370.503] * (-366.218) (-365.130) (-367.013) [-367.852] -- 0:00:28
      531500 -- (-369.042) (-373.565) [-364.953] (-368.144) * (-367.061) (-365.447) [-368.078] (-366.942) -- 0:00:28
      532000 -- (-364.711) (-365.286) [-366.865] (-368.073) * (-365.840) (-367.239) [-367.671] (-367.434) -- 0:00:28
      532500 -- (-367.668) (-366.286) (-366.385) [-373.396] * [-367.183] (-368.321) (-365.815) (-364.814) -- 0:00:28
      533000 -- [-366.681] (-365.873) (-365.365) (-368.884) * (-365.121) (-366.725) [-364.924] (-365.296) -- 0:00:28
      533500 -- (-366.997) (-365.118) [-366.413] (-367.543) * (-365.606) (-365.469) [-366.506] (-365.488) -- 0:00:27
      534000 -- [-369.004] (-366.537) (-367.233) (-366.589) * (-364.818) (-369.895) (-373.346) [-367.443] -- 0:00:27
      534500 -- (-366.026) (-364.685) (-366.777) [-366.790] * [-365.591] (-367.403) (-368.306) (-365.977) -- 0:00:27
      535000 -- (-366.853) (-365.427) [-366.922] (-367.796) * (-365.540) (-368.307) (-366.618) [-366.618] -- 0:00:27

      Average standard deviation of split frequencies: 0.014766

      535500 -- [-366.296] (-368.337) (-366.573) (-366.543) * (-370.443) (-369.014) [-370.216] (-365.742) -- 0:00:27
      536000 -- (-367.702) (-368.185) (-366.521) [-365.348] * [-369.575] (-365.902) (-367.500) (-365.109) -- 0:00:27
      536500 -- (-369.743) (-365.193) [-365.107] (-365.097) * (-365.173) (-367.361) [-365.841] (-366.938) -- 0:00:27
      537000 -- [-367.850] (-365.971) (-369.572) (-365.194) * (-366.216) [-366.557] (-370.277) (-369.904) -- 0:00:27
      537500 -- (-367.274) (-365.148) [-364.830] (-365.274) * (-366.587) [-369.958] (-365.452) (-367.275) -- 0:00:27
      538000 -- (-366.500) (-367.032) [-364.838] (-366.116) * (-366.974) (-367.080) [-365.457] (-365.743) -- 0:00:27
      538500 -- [-364.916] (-365.729) (-365.055) (-367.157) * (-371.271) (-365.476) [-365.202] (-365.524) -- 0:00:27
      539000 -- (-366.798) (-366.050) [-368.204] (-365.269) * (-365.054) (-368.495) [-365.205] (-364.583) -- 0:00:27
      539500 -- (-370.059) [-367.793] (-366.281) (-365.798) * (-365.656) (-367.039) [-365.678] (-364.975) -- 0:00:27
      540000 -- (-365.470) [-365.134] (-367.914) (-365.599) * (-365.209) [-367.919] (-368.979) (-368.005) -- 0:00:27

      Average standard deviation of split frequencies: 0.014338

      540500 -- (-366.962) (-365.446) (-368.699) [-365.322] * (-368.796) (-370.556) (-364.627) [-365.590] -- 0:00:27
      541000 -- (-368.032) (-365.828) [-369.153] (-367.244) * (-366.517) [-370.816] (-366.946) (-366.212) -- 0:00:27
      541500 -- (-367.801) [-365.132] (-365.802) (-365.266) * (-365.729) [-365.255] (-364.943) (-365.085) -- 0:00:27
      542000 -- [-368.053] (-367.550) (-367.675) (-365.537) * (-365.503) [-365.942] (-365.202) (-367.512) -- 0:00:27
      542500 -- (-369.862) [-366.256] (-371.288) (-367.792) * (-370.431) (-366.111) (-366.336) [-367.403] -- 0:00:26
      543000 -- (-370.851) (-366.026) (-368.654) [-367.189] * (-365.672) (-366.970) (-366.530) [-365.048] -- 0:00:26
      543500 -- (-369.656) (-365.118) (-367.017) [-366.803] * (-366.115) (-369.782) (-368.513) [-366.222] -- 0:00:26
      544000 -- (-366.397) (-366.935) (-370.446) [-368.183] * (-368.383) (-372.232) (-366.203) [-365.988] -- 0:00:26
      544500 -- (-366.495) [-366.707] (-366.921) (-371.320) * [-365.902] (-368.673) (-366.323) (-366.043) -- 0:00:26
      545000 -- (-365.754) (-366.638) (-365.654) [-367.852] * (-366.707) (-369.571) (-367.347) [-367.220] -- 0:00:26

      Average standard deviation of split frequencies: 0.014390

      545500 -- (-367.081) (-368.057) (-367.139) [-364.960] * (-366.315) (-369.526) (-370.087) [-364.868] -- 0:00:26
      546000 -- (-365.951) (-372.334) [-365.923] (-367.754) * (-365.384) (-367.369) (-366.186) [-369.399] -- 0:00:26
      546500 -- [-367.099] (-369.792) (-370.717) (-365.151) * (-367.095) (-368.003) (-367.116) [-366.418] -- 0:00:27
      547000 -- (-368.445) (-366.596) (-368.339) [-365.512] * (-368.423) (-366.016) (-369.807) [-365.683] -- 0:00:27
      547500 -- [-365.853] (-367.933) (-366.507) (-365.652) * [-367.671] (-370.305) (-368.051) (-365.223) -- 0:00:27
      548000 -- (-365.063) (-366.123) [-366.461] (-368.579) * [-367.769] (-366.948) (-368.886) (-366.576) -- 0:00:27
      548500 -- (-367.800) [-365.326] (-369.066) (-366.872) * (-369.714) [-367.010] (-365.681) (-366.231) -- 0:00:27
      549000 -- (-366.433) (-365.932) [-364.954] (-369.120) * (-369.034) [-367.180] (-367.134) (-367.756) -- 0:00:27
      549500 -- [-368.322] (-366.253) (-366.390) (-366.288) * (-368.264) (-366.302) [-367.892] (-368.035) -- 0:00:27
      550000 -- (-365.469) [-366.953] (-369.121) (-369.915) * (-368.428) (-366.009) (-365.829) [-366.214] -- 0:00:27

      Average standard deviation of split frequencies: 0.014643

      550500 -- (-365.099) (-365.888) (-369.792) [-365.017] * (-369.794) (-371.055) [-364.806] (-367.472) -- 0:00:26
      551000 -- [-367.012] (-365.740) (-366.029) (-365.626) * [-368.175] (-370.018) (-366.919) (-370.748) -- 0:00:26
      551500 -- (-369.890) [-366.292] (-366.149) (-366.098) * (-369.759) [-365.833] (-366.379) (-365.683) -- 0:00:26
      552000 -- (-368.791) (-367.799) (-365.984) [-366.433] * (-368.840) (-368.060) [-365.686] (-367.310) -- 0:00:26
      552500 -- [-368.538] (-366.021) (-367.446) (-367.817) * (-366.285) (-370.272) (-368.805) [-367.739] -- 0:00:26
      553000 -- (-367.352) (-365.873) (-369.389) [-366.302] * [-365.879] (-365.805) (-364.994) (-368.284) -- 0:00:26
      553500 -- (-367.621) (-368.390) (-369.655) [-364.610] * (-365.547) (-366.174) [-365.839] (-366.103) -- 0:00:26
      554000 -- (-365.172) (-367.213) [-367.463] (-366.740) * (-366.786) (-375.305) [-366.102] (-366.525) -- 0:00:26
      554500 -- [-364.719] (-366.126) (-370.087) (-368.671) * [-366.400] (-371.660) (-366.149) (-365.333) -- 0:00:26
      555000 -- [-366.440] (-368.080) (-366.254) (-364.638) * (-366.218) [-367.479] (-365.889) (-365.415) -- 0:00:26

      Average standard deviation of split frequencies: 0.014726

      555500 -- [-365.622] (-371.886) (-366.881) (-369.776) * (-366.798) [-365.893] (-366.877) (-367.176) -- 0:00:26
      556000 -- [-365.112] (-364.919) (-364.914) (-365.612) * [-367.969] (-366.119) (-365.769) (-365.794) -- 0:00:26
      556500 -- [-366.057] (-368.266) (-368.246) (-367.253) * [-367.810] (-364.897) (-367.268) (-366.662) -- 0:00:26
      557000 -- (-365.707) (-372.097) [-368.862] (-371.135) * (-368.908) (-366.174) (-364.863) [-365.824] -- 0:00:26
      557500 -- (-366.845) [-368.717] (-369.234) (-371.376) * (-367.046) (-366.870) (-366.944) [-371.584] -- 0:00:26
      558000 -- [-367.079] (-364.866) (-365.504) (-365.570) * [-364.856] (-370.111) (-367.282) (-369.111) -- 0:00:26
      558500 -- [-366.859] (-366.680) (-364.753) (-365.196) * (-364.696) [-367.893] (-365.223) (-366.481) -- 0:00:26
      559000 -- (-367.507) (-366.066) (-364.951) [-364.852] * [-365.098] (-366.044) (-368.353) (-369.651) -- 0:00:26
      559500 -- (-369.933) (-368.613) (-367.265) [-367.423] * (-365.878) [-364.922] (-367.973) (-366.897) -- 0:00:25
      560000 -- (-367.175) (-375.117) [-365.753] (-369.706) * (-368.129) [-366.318] (-370.069) (-366.298) -- 0:00:25

      Average standard deviation of split frequencies: 0.014249

      560500 -- [-365.774] (-367.738) (-366.766) (-367.220) * (-365.215) (-365.127) (-366.351) [-365.556] -- 0:00:25
      561000 -- (-365.375) (-369.734) (-371.404) [-365.206] * (-367.879) (-366.824) [-367.887] (-366.453) -- 0:00:25
      561500 -- (-365.583) (-367.193) (-364.506) [-368.389] * (-369.783) (-365.472) (-365.653) [-366.310] -- 0:00:25
      562000 -- (-366.733) (-369.487) (-366.814) [-365.275] * [-367.935] (-366.155) (-368.107) (-368.523) -- 0:00:25
      562500 -- (-364.862) (-365.718) [-366.195] (-366.701) * (-366.879) (-367.360) [-366.837] (-369.427) -- 0:00:25
      563000 -- (-366.817) [-365.768] (-365.293) (-367.044) * [-367.155] (-366.180) (-364.651) (-369.423) -- 0:00:25
      563500 -- (-364.840) (-366.692) (-364.420) [-365.865] * (-369.516) [-365.355] (-367.419) (-365.416) -- 0:00:25
      564000 -- [-367.642] (-367.669) (-365.174) (-367.770) * (-368.137) [-367.287] (-368.653) (-367.715) -- 0:00:26
      564500 -- [-368.239] (-371.238) (-365.387) (-364.922) * (-365.709) (-368.485) [-365.245] (-366.162) -- 0:00:26
      565000 -- (-367.932) (-367.154) (-366.521) [-366.025] * (-368.112) (-367.745) [-366.763] (-370.090) -- 0:00:26

      Average standard deviation of split frequencies: 0.014203

      565500 -- (-365.840) [-366.399] (-365.239) (-365.797) * (-365.003) (-367.950) [-365.693] (-371.187) -- 0:00:26
      566000 -- (-366.673) (-366.354) (-366.796) [-366.720] * (-366.511) [-366.913] (-369.810) (-370.139) -- 0:00:26
      566500 -- (-368.325) (-366.259) [-369.049] (-365.334) * (-366.885) [-371.130] (-364.694) (-368.075) -- 0:00:26
      567000 -- [-365.979] (-367.863) (-366.490) (-366.814) * [-365.688] (-369.283) (-364.927) (-365.961) -- 0:00:25
      567500 -- [-369.902] (-366.985) (-365.977) (-367.340) * (-364.967) (-365.637) (-368.328) [-366.248] -- 0:00:25
      568000 -- [-364.577] (-366.988) (-366.534) (-367.819) * [-365.052] (-366.125) (-366.070) (-368.312) -- 0:00:25
      568500 -- (-365.255) [-366.883] (-370.594) (-364.825) * (-365.870) (-368.001) [-365.573] (-365.038) -- 0:00:25
      569000 -- (-365.069) (-369.234) [-366.826] (-367.494) * [-366.635] (-365.841) (-366.562) (-365.304) -- 0:00:25
      569500 -- [-365.169] (-366.842) (-365.731) (-366.790) * (-367.123) (-365.466) [-365.613] (-366.986) -- 0:00:25
      570000 -- (-365.914) [-365.236] (-370.706) (-368.780) * (-368.546) (-369.106) [-367.823] (-365.550) -- 0:00:25

      Average standard deviation of split frequencies: 0.013739

      570500 -- (-368.355) [-365.657] (-368.805) (-366.899) * (-370.009) (-370.218) (-367.900) [-366.515] -- 0:00:25
      571000 -- (-367.087) (-367.579) [-371.409] (-366.616) * (-368.804) (-368.726) [-366.406] (-364.494) -- 0:00:25
      571500 -- (-369.732) (-366.641) (-368.273) [-364.790] * (-367.717) [-364.687] (-366.779) (-365.061) -- 0:00:25
      572000 -- [-365.225] (-365.214) (-365.843) (-366.042) * (-368.162) (-366.280) [-365.431] (-365.350) -- 0:00:25
      572500 -- [-365.280] (-371.001) (-366.688) (-366.363) * [-366.426] (-368.229) (-371.065) (-366.317) -- 0:00:25
      573000 -- [-365.552] (-367.432) (-370.674) (-367.209) * (-365.432) (-371.136) [-365.944] (-366.720) -- 0:00:25
      573500 -- (-365.100) (-365.070) [-366.790] (-367.318) * (-368.055) (-365.289) (-366.315) [-367.635] -- 0:00:25
      574000 -- (-368.008) (-373.648) [-365.463] (-367.345) * (-364.972) (-366.556) [-366.580] (-371.921) -- 0:00:25
      574500 -- (-371.210) (-367.641) [-364.933] (-366.226) * (-366.656) (-368.171) [-365.957] (-369.806) -- 0:00:25
      575000 -- (-368.804) [-367.950] (-367.491) (-367.147) * (-367.605) (-366.117) [-365.950] (-372.871) -- 0:00:25

      Average standard deviation of split frequencies: 0.013353

      575500 -- (-368.411) (-366.859) (-367.552) [-365.799] * (-364.576) [-365.354] (-365.620) (-367.609) -- 0:00:25
      576000 -- (-369.168) (-366.489) (-365.638) [-366.500] * [-365.570] (-366.847) (-367.663) (-365.718) -- 0:00:25
      576500 -- (-366.693) [-366.236] (-368.091) (-369.092) * (-365.805) (-364.972) [-366.557] (-365.573) -- 0:00:24
      577000 -- (-367.273) [-370.384] (-369.124) (-375.628) * [-364.559] (-367.179) (-369.940) (-365.933) -- 0:00:24
      577500 -- (-366.071) (-368.156) (-367.390) [-367.513] * (-365.204) (-370.107) (-366.428) [-366.593] -- 0:00:24
      578000 -- (-373.618) [-367.147] (-367.835) (-365.697) * (-365.890) (-369.937) (-368.195) [-366.789] -- 0:00:24
      578500 -- (-369.875) [-365.651] (-368.729) (-364.873) * (-367.803) (-365.270) (-367.370) [-365.267] -- 0:00:24
      579000 -- (-366.434) [-367.198] (-368.896) (-367.864) * [-365.923] (-365.640) (-370.400) (-366.190) -- 0:00:24
      579500 -- [-366.570] (-366.841) (-368.921) (-368.074) * (-365.829) (-368.262) [-367.279] (-367.242) -- 0:00:24
      580000 -- (-365.739) (-368.237) (-366.763) [-364.981] * (-366.992) (-365.967) (-368.267) [-366.630] -- 0:00:24

      Average standard deviation of split frequencies: 0.012605

      580500 -- (-366.785) (-368.363) (-366.999) [-368.374] * (-367.714) [-366.809] (-365.612) (-367.344) -- 0:00:24
      581000 -- (-369.711) (-370.577) [-367.470] (-365.581) * (-368.825) (-367.406) [-366.111] (-365.441) -- 0:00:25
      581500 -- (-365.041) (-366.207) [-366.714] (-366.582) * (-368.031) (-368.178) (-367.034) [-368.190] -- 0:00:25
      582000 -- (-366.079) (-365.441) [-367.666] (-367.956) * (-365.795) (-370.469) (-367.098) [-369.481] -- 0:00:25
      582500 -- (-366.186) (-366.153) [-365.636] (-365.410) * (-366.175) (-365.294) (-369.796) [-366.157] -- 0:00:25
      583000 -- (-368.354) [-366.973] (-367.001) (-367.981) * (-367.672) (-366.655) (-375.382) [-365.617] -- 0:00:25
      583500 -- (-367.417) (-366.667) [-367.175] (-366.191) * (-366.961) (-367.045) [-367.172] (-365.495) -- 0:00:24
      584000 -- [-365.328] (-368.164) (-369.223) (-366.285) * (-366.204) (-371.024) [-366.186] (-367.514) -- 0:00:24
      584500 -- (-366.331) (-365.468) (-368.829) [-368.422] * (-366.745) [-368.229] (-367.538) (-365.165) -- 0:00:24
      585000 -- (-368.578) [-365.573] (-365.690) (-367.355) * (-368.251) (-366.184) (-367.549) [-367.147] -- 0:00:24

      Average standard deviation of split frequencies: 0.012321

      585500 -- (-367.436) (-367.180) [-365.330] (-369.534) * [-365.358] (-369.830) (-366.555) (-367.023) -- 0:00:24
      586000 -- [-367.117] (-366.829) (-365.313) (-369.961) * [-364.996] (-368.044) (-367.342) (-366.548) -- 0:00:24
      586500 -- (-366.384) [-367.701] (-365.095) (-366.385) * (-366.724) (-368.889) (-366.000) [-366.172] -- 0:00:24
      587000 -- (-366.708) (-365.103) [-368.580] (-365.339) * (-366.832) (-369.054) [-367.579] (-366.913) -- 0:00:24
      587500 -- (-365.234) (-366.193) [-365.763] (-368.134) * [-368.916] (-365.210) (-370.869) (-365.809) -- 0:00:24
      588000 -- (-364.777) [-365.689] (-370.398) (-366.153) * (-368.121) (-365.693) [-367.141] (-367.500) -- 0:00:24
      588500 -- (-365.446) [-366.735] (-369.591) (-372.534) * (-365.334) (-366.083) [-366.839] (-367.392) -- 0:00:24
      589000 -- (-366.526) (-367.825) (-370.679) [-372.312] * (-367.161) [-365.991] (-366.967) (-369.907) -- 0:00:24
      589500 -- (-367.118) [-365.662] (-368.421) (-365.618) * (-370.070) [-367.085] (-365.511) (-364.521) -- 0:00:24
      590000 -- (-365.790) [-366.827] (-370.715) (-369.488) * (-371.239) (-366.606) [-365.084] (-367.186) -- 0:00:24

      Average standard deviation of split frequencies: 0.012592

      590500 -- [-365.603] (-370.193) (-366.426) (-371.509) * (-371.115) (-365.091) (-365.242) [-367.394] -- 0:00:24
      591000 -- (-367.093) (-366.757) (-365.711) [-365.730] * [-366.130] (-365.745) (-366.483) (-365.568) -- 0:00:24
      591500 -- (-369.258) [-371.429] (-366.007) (-367.964) * (-366.450) [-365.007] (-367.739) (-367.087) -- 0:00:24
      592000 -- (-369.317) (-366.978) (-365.200) [-367.162] * [-365.538] (-365.325) (-367.825) (-369.663) -- 0:00:24
      592500 -- [-368.565] (-366.876) (-373.170) (-364.727) * [-367.523] (-367.029) (-366.410) (-370.332) -- 0:00:24
      593000 -- (-366.416) (-370.250) (-368.862) [-364.643] * [-365.211] (-368.403) (-368.260) (-373.731) -- 0:00:24
      593500 -- (-369.654) (-369.083) [-367.520] (-366.949) * [-365.106] (-366.911) (-370.156) (-371.038) -- 0:00:23
      594000 -- (-368.505) [-365.280] (-369.688) (-368.342) * (-364.877) (-365.342) (-369.426) [-366.719] -- 0:00:23
      594500 -- (-368.183) (-365.460) (-367.717) [-370.355] * (-364.769) [-366.118] (-365.869) (-366.728) -- 0:00:23
      595000 -- (-373.039) (-364.907) (-368.428) [-365.705] * (-365.994) (-367.054) (-366.718) [-367.904] -- 0:00:23

      Average standard deviation of split frequencies: 0.012702

      595500 -- [-367.484] (-364.564) (-368.462) (-368.615) * (-368.331) (-368.010) [-367.248] (-364.641) -- 0:00:23
      596000 -- (-367.491) (-366.198) (-365.092) [-368.543] * (-369.008) (-370.235) (-366.758) [-364.814] -- 0:00:23
      596500 -- (-364.826) (-365.684) (-366.507) [-368.171] * (-371.453) (-367.800) (-367.855) [-371.013] -- 0:00:23
      597000 -- (-365.423) (-365.534) [-366.084] (-364.959) * (-367.568) [-368.607] (-366.338) (-366.108) -- 0:00:23
      597500 -- (-365.927) [-365.820] (-366.017) (-367.666) * (-366.305) (-365.156) [-367.001] (-367.484) -- 0:00:23
      598000 -- (-367.545) (-365.363) [-365.553] (-365.519) * (-369.767) (-368.534) [-367.365] (-368.939) -- 0:00:24
      598500 -- (-367.399) [-369.300] (-367.888) (-368.241) * [-365.766] (-367.326) (-366.142) (-366.484) -- 0:00:24
      599000 -- (-367.392) (-371.807) (-366.606) [-372.864] * [-364.693] (-366.939) (-369.922) (-365.896) -- 0:00:24
      599500 -- [-368.578] (-369.720) (-368.363) (-370.825) * (-365.531) (-366.155) [-367.497] (-365.803) -- 0:00:24
      600000 -- (-368.271) [-365.793] (-365.723) (-365.154) * (-369.514) (-366.806) [-367.545] (-366.068) -- 0:00:24

      Average standard deviation of split frequencies: 0.013111

      600500 -- (-365.198) (-367.130) [-366.870] (-367.058) * (-366.208) (-369.260) (-365.730) [-366.165] -- 0:00:23
      601000 -- (-367.798) (-367.193) (-365.836) [-368.493] * (-367.896) [-368.725] (-368.648) (-370.355) -- 0:00:23
      601500 -- (-365.110) (-367.038) (-370.036) [-364.574] * (-365.251) [-367.142] (-366.789) (-367.742) -- 0:00:23
      602000 -- (-366.884) (-366.777) (-366.316) [-368.429] * (-365.505) (-369.203) (-366.221) [-371.582] -- 0:00:23
      602500 -- (-366.665) (-369.467) [-365.780] (-366.264) * (-368.242) (-367.969) [-365.359] (-368.347) -- 0:00:23
      603000 -- (-365.561) (-367.381) [-367.584] (-366.259) * [-367.210] (-365.828) (-365.152) (-371.104) -- 0:00:23
      603500 -- [-367.362] (-365.437) (-365.434) (-365.780) * (-366.271) (-365.605) [-367.881] (-369.217) -- 0:00:23
      604000 -- [-366.344] (-367.752) (-365.911) (-365.069) * [-365.530] (-365.060) (-369.795) (-366.085) -- 0:00:23
      604500 -- (-367.596) (-368.492) (-367.821) [-365.295] * [-365.899] (-367.853) (-374.483) (-366.663) -- 0:00:23
      605000 -- (-366.474) (-369.586) [-366.481] (-365.559) * (-369.520) (-370.861) (-369.786) [-366.470] -- 0:00:23

      Average standard deviation of split frequencies: 0.013270

      605500 -- [-366.263] (-370.841) (-370.853) (-365.559) * (-369.230) (-365.744) [-364.944] (-366.386) -- 0:00:23
      606000 -- (-372.961) (-369.604) (-366.503) [-366.525] * [-369.233] (-364.962) (-365.478) (-365.847) -- 0:00:23
      606500 -- (-368.628) (-365.935) (-368.825) [-366.141] * (-367.278) (-366.871) (-369.814) [-364.820] -- 0:00:23
      607000 -- (-366.887) [-365.545] (-367.399) (-368.020) * (-365.979) [-365.501] (-366.043) (-366.911) -- 0:00:23
      607500 -- (-368.794) (-369.316) [-365.630] (-368.471) * (-368.432) [-365.516] (-365.208) (-366.841) -- 0:00:23
      608000 -- (-366.662) (-366.905) [-370.262] (-369.795) * (-365.826) (-366.754) (-369.256) [-366.084] -- 0:00:23
      608500 -- (-366.184) [-366.372] (-367.993) (-366.158) * (-368.137) (-364.683) (-369.668) [-365.787] -- 0:00:23
      609000 -- (-369.700) (-366.127) (-371.768) [-366.313] * (-364.908) (-365.821) (-367.762) [-365.544] -- 0:00:23
      609500 -- (-365.086) (-366.586) (-368.017) [-367.240] * [-365.408] (-372.001) (-369.428) (-366.373) -- 0:00:23
      610000 -- [-368.174] (-365.604) (-365.077) (-368.759) * (-365.492) (-366.145) (-365.805) [-366.241] -- 0:00:23

      Average standard deviation of split frequencies: 0.012624

      610500 -- (-367.735) (-368.015) (-366.410) [-367.521] * (-365.019) (-366.517) [-366.423] (-368.371) -- 0:00:22
      611000 -- [-369.549] (-369.995) (-369.004) (-367.855) * [-364.950] (-371.458) (-365.193) (-364.615) -- 0:00:22
      611500 -- (-364.992) [-365.812] (-369.832) (-366.497) * (-367.290) (-372.095) [-364.501] (-364.807) -- 0:00:22
      612000 -- (-366.310) (-365.910) (-365.934) [-367.064] * (-365.984) (-367.329) (-365.522) [-366.055] -- 0:00:22
      612500 -- (-364.797) (-366.688) (-367.326) [-364.685] * (-366.297) (-365.676) (-364.910) [-369.498] -- 0:00:22
      613000 -- (-365.679) [-366.516] (-371.242) (-368.839) * (-365.574) (-366.006) [-365.246] (-368.466) -- 0:00:22
      613500 -- [-365.822] (-364.612) (-369.145) (-366.032) * (-365.098) (-367.419) (-368.162) [-365.021] -- 0:00:22
      614000 -- [-367.324] (-367.282) (-365.752) (-365.543) * (-366.770) (-367.370) [-369.333] (-366.449) -- 0:00:22
      614500 -- (-366.995) [-365.871] (-365.256) (-376.050) * (-367.288) [-368.490] (-369.292) (-373.125) -- 0:00:22
      615000 -- [-365.730] (-366.767) (-365.141) (-366.760) * (-366.379) [-365.935] (-370.513) (-366.389) -- 0:00:22

      Average standard deviation of split frequencies: 0.013105

      615500 -- [-368.993] (-364.921) (-365.997) (-367.342) * [-366.017] (-366.462) (-373.106) (-366.291) -- 0:00:23
      616000 -- [-365.250] (-371.210) (-365.727) (-370.651) * (-365.862) (-367.119) (-367.607) [-368.522] -- 0:00:23
      616500 -- (-366.394) (-365.556) (-367.719) [-368.713] * (-366.423) (-373.319) (-366.400) [-366.001] -- 0:00:23
      617000 -- (-365.646) (-365.772) (-366.874) [-368.436] * (-366.839) (-365.571) [-367.086] (-365.156) -- 0:00:22
      617500 -- (-366.093) (-365.865) (-367.995) [-365.671] * (-365.204) (-366.756) [-369.401] (-366.265) -- 0:00:22
      618000 -- (-365.742) (-367.544) (-365.204) [-366.288] * (-369.706) (-367.840) (-370.151) [-372.425] -- 0:00:22
      618500 -- [-366.294] (-366.626) (-365.161) (-364.941) * (-368.294) (-367.792) [-366.092] (-366.663) -- 0:00:22
      619000 -- (-365.598) [-365.929] (-367.994) (-368.943) * (-368.295) (-366.350) [-367.584] (-366.064) -- 0:00:22
      619500 -- (-366.096) (-369.089) [-367.242] (-367.258) * (-364.703) [-367.024] (-368.521) (-370.057) -- 0:00:22
      620000 -- (-369.301) [-367.236] (-365.927) (-373.476) * (-366.454) (-367.737) [-369.731] (-369.121) -- 0:00:22

      Average standard deviation of split frequencies: 0.012376

      620500 -- [-365.890] (-366.684) (-368.398) (-365.946) * (-365.702) [-364.921] (-370.396) (-366.678) -- 0:00:22
      621000 -- (-366.360) (-368.328) [-365.445] (-369.006) * (-365.483) [-367.458] (-366.920) (-371.957) -- 0:00:22
      621500 -- (-368.522) [-367.177] (-365.308) (-369.307) * (-367.083) [-366.309] (-369.091) (-369.739) -- 0:00:22
      622000 -- [-367.519] (-371.067) (-368.962) (-367.239) * (-368.671) [-365.516] (-370.960) (-368.441) -- 0:00:22
      622500 -- (-365.458) [-366.561] (-372.627) (-366.564) * (-368.416) (-368.826) [-367.014] (-366.388) -- 0:00:22
      623000 -- [-367.416] (-364.670) (-367.433) (-367.802) * [-366.390] (-366.861) (-367.315) (-368.488) -- 0:00:22
      623500 -- (-369.666) (-365.839) (-368.122) [-367.478] * (-365.343) [-368.999] (-365.791) (-369.947) -- 0:00:22
      624000 -- (-366.318) (-366.137) [-370.886] (-366.502) * [-365.245] (-367.527) (-367.688) (-365.306) -- 0:00:22
      624500 -- [-365.313] (-366.257) (-368.946) (-367.963) * (-365.837) [-367.272] (-371.891) (-370.300) -- 0:00:22
      625000 -- [-364.992] (-365.478) (-367.437) (-366.467) * (-364.912) (-365.972) (-367.521) [-371.988] -- 0:00:22

      Average standard deviation of split frequencies: 0.012580

      625500 -- (-365.645) (-367.296) [-367.146] (-371.325) * (-365.462) (-367.549) [-368.890] (-368.980) -- 0:00:22
      626000 -- (-365.549) (-367.804) [-367.543] (-371.131) * [-364.732] (-367.739) (-367.491) (-365.880) -- 0:00:22
      626500 -- (-369.181) (-370.135) [-364.731] (-368.167) * (-366.234) (-368.251) (-367.195) [-366.073] -- 0:00:22
      627000 -- [-365.735] (-365.783) (-367.360) (-367.403) * (-373.985) [-364.791] (-368.638) (-367.606) -- 0:00:22
      627500 -- (-366.600) (-366.220) [-366.115] (-364.882) * (-369.435) (-366.132) (-367.573) [-367.339] -- 0:00:21
      628000 -- [-367.055] (-367.041) (-366.602) (-368.325) * (-365.176) (-367.656) (-367.097) [-367.249] -- 0:00:21
      628500 -- (-368.606) (-369.831) [-364.368] (-366.232) * (-365.085) (-367.214) [-365.612] (-366.093) -- 0:00:21
      629000 -- [-366.426] (-367.359) (-366.739) (-367.632) * (-368.249) (-367.935) (-367.364) [-367.512] -- 0:00:21
      629500 -- [-365.364] (-365.511) (-366.479) (-365.581) * (-365.530) (-368.869) (-365.627) [-367.433] -- 0:00:21
      630000 -- (-365.622) [-364.676] (-365.619) (-366.291) * [-366.642] (-367.348) (-365.284) (-365.063) -- 0:00:21

      Average standard deviation of split frequencies: 0.012707

      630500 -- (-372.553) [-364.861] (-367.853) (-372.140) * (-366.112) (-365.715) (-366.736) [-367.526] -- 0:00:21
      631000 -- (-365.944) [-366.701] (-368.759) (-366.067) * (-365.124) [-366.808] (-364.469) (-367.413) -- 0:00:21
      631500 -- (-365.984) (-365.869) (-368.082) [-365.353] * (-365.471) (-370.597) [-365.825] (-365.329) -- 0:00:21
      632000 -- (-366.170) [-365.690] (-365.148) (-368.924) * [-365.459] (-368.930) (-367.988) (-372.408) -- 0:00:21
      632500 -- [-364.940] (-366.014) (-368.034) (-370.405) * [-365.887] (-365.205) (-368.160) (-365.112) -- 0:00:22
      633000 -- [-364.596] (-366.943) (-370.290) (-366.237) * (-366.749) (-368.183) (-366.422) [-367.135] -- 0:00:22
      633500 -- (-371.026) [-369.432] (-371.840) (-369.581) * (-366.702) (-367.949) (-364.942) [-369.222] -- 0:00:21
      634000 -- (-365.186) [-365.285] (-373.017) (-370.202) * [-368.383] (-367.035) (-370.038) (-369.061) -- 0:00:21
      634500 -- (-365.168) (-365.932) (-367.735) [-366.838] * (-365.806) (-368.171) [-367.045] (-365.778) -- 0:00:21
      635000 -- (-367.397) (-367.080) (-365.775) [-365.879] * (-366.890) (-369.525) [-368.236] (-370.171) -- 0:00:21

      Average standard deviation of split frequencies: 0.012862

      635500 -- (-366.860) [-366.532] (-368.213) (-365.651) * [-367.159] (-366.837) (-368.980) (-368.585) -- 0:00:21
      636000 -- (-368.174) (-368.869) (-365.717) [-366.846] * [-367.671] (-365.196) (-367.006) (-371.448) -- 0:00:21
      636500 -- (-373.944) (-370.219) (-369.823) [-367.475] * (-365.046) (-364.859) (-367.970) [-365.522] -- 0:00:21
      637000 -- (-369.207) [-365.336] (-368.588) (-365.865) * (-369.352) [-367.305] (-369.253) (-366.191) -- 0:00:21
      637500 -- (-370.251) (-367.432) (-369.637) [-365.566] * (-367.830) [-367.407] (-366.098) (-368.822) -- 0:00:21
      638000 -- (-366.560) (-367.813) (-371.704) [-369.849] * [-365.548] (-368.961) (-365.746) (-366.715) -- 0:00:21
      638500 -- (-365.465) [-366.281] (-368.615) (-365.776) * (-365.877) (-365.175) [-367.287] (-367.417) -- 0:00:21
      639000 -- (-366.508) [-365.467] (-368.577) (-369.580) * (-369.300) (-366.028) [-365.696] (-366.238) -- 0:00:21
      639500 -- (-372.335) (-370.330) [-367.924] (-366.375) * (-370.492) (-371.024) (-367.520) [-367.146] -- 0:00:21
      640000 -- [-365.307] (-369.002) (-367.180) (-368.271) * (-364.647) (-367.213) (-367.369) [-368.337] -- 0:00:21

      Average standard deviation of split frequencies: 0.012249

      640500 -- (-369.483) (-368.273) [-366.845] (-368.565) * (-364.792) (-366.508) (-368.474) [-365.097] -- 0:00:21
      641000 -- (-368.726) [-368.355] (-366.698) (-368.233) * (-367.269) [-367.638] (-366.550) (-365.846) -- 0:00:21
      641500 -- (-367.694) (-366.223) [-368.174] (-366.527) * (-365.330) (-367.386) [-368.052] (-365.767) -- 0:00:21
      642000 -- (-364.600) (-366.772) (-369.621) [-365.685] * (-367.526) [-366.170] (-365.554) (-366.938) -- 0:00:21
      642500 -- (-364.697) [-367.454] (-368.741) (-368.224) * (-366.499) [-366.306] (-366.566) (-365.282) -- 0:00:21
      643000 -- (-367.653) (-372.335) (-368.513) [-368.149] * [-366.498] (-370.581) (-365.232) (-365.608) -- 0:00:21
      643500 -- [-366.820] (-369.381) (-369.420) (-371.242) * (-366.753) (-366.366) (-366.729) [-365.369] -- 0:00:21
      644000 -- (-368.171) (-369.585) [-367.622] (-366.714) * (-367.411) (-365.416) [-366.220] (-369.562) -- 0:00:21
      644500 -- (-366.482) [-365.903] (-366.865) (-367.351) * [-369.081] (-368.157) (-364.542) (-367.307) -- 0:00:20
      645000 -- (-366.851) (-366.298) [-365.130] (-369.122) * (-372.478) (-368.369) (-365.689) [-366.391] -- 0:00:20

      Average standard deviation of split frequencies: 0.011847

      645500 -- [-367.204] (-366.293) (-369.372) (-367.698) * (-367.849) (-370.882) (-366.576) [-366.157] -- 0:00:20
      646000 -- [-368.440] (-368.028) (-368.202) (-366.936) * (-365.763) [-367.391] (-365.428) (-365.775) -- 0:00:20
      646500 -- (-366.313) (-367.972) [-366.294] (-370.868) * (-365.099) (-367.031) [-367.385] (-366.475) -- 0:00:20
      647000 -- (-368.461) [-365.920] (-366.167) (-366.665) * (-370.364) (-366.154) [-368.470] (-366.866) -- 0:00:20
      647500 -- (-367.211) (-365.292) (-368.334) [-364.842] * (-366.457) (-364.909) (-366.503) [-366.120] -- 0:00:20
      648000 -- [-367.802] (-369.132) (-366.114) (-366.143) * (-366.204) [-365.931] (-368.055) (-366.720) -- 0:00:20
      648500 -- (-366.692) (-369.659) [-367.426] (-367.165) * (-372.530) (-367.874) (-366.479) [-366.616] -- 0:00:20
      649000 -- (-366.963) [-366.526] (-367.315) (-367.766) * (-366.105) [-366.188] (-366.923) (-369.419) -- 0:00:20
      649500 -- (-369.608) (-370.243) [-367.264] (-367.117) * (-369.736) (-366.739) [-366.489] (-367.982) -- 0:00:21
      650000 -- [-368.857] (-366.224) (-367.330) (-365.232) * (-365.177) (-367.084) [-367.510] (-365.364) -- 0:00:21

      Average standard deviation of split frequencies: 0.011677

      650500 -- (-366.104) (-367.093) [-371.138] (-365.978) * [-366.305] (-368.953) (-366.988) (-365.979) -- 0:00:20
      651000 -- (-367.241) [-367.804] (-368.640) (-365.469) * (-364.684) (-367.686) [-366.639] (-364.609) -- 0:00:20
      651500 -- (-366.080) [-366.822] (-368.583) (-365.609) * (-369.166) (-370.504) [-368.195] (-368.959) -- 0:00:20
      652000 -- (-366.084) (-366.578) (-367.944) [-366.766] * [-365.477] (-366.038) (-369.477) (-367.307) -- 0:00:20
      652500 -- (-366.737) [-365.600] (-367.161) (-365.783) * (-365.486) (-365.180) (-370.408) [-364.723] -- 0:00:20
      653000 -- (-367.809) (-367.070) (-366.957) [-365.765] * (-365.148) (-368.247) [-366.258] (-368.472) -- 0:00:20
      653500 -- (-368.500) (-367.248) [-366.767] (-364.953) * [-366.113] (-370.364) (-368.482) (-365.520) -- 0:00:20
      654000 -- (-367.823) [-365.925] (-368.017) (-365.537) * [-367.348] (-366.494) (-368.012) (-366.211) -- 0:00:20
      654500 -- [-365.874] (-368.050) (-368.520) (-365.214) * (-369.552) (-366.035) [-365.554] (-367.415) -- 0:00:20
      655000 -- (-368.470) (-367.033) (-368.088) [-365.626] * [-367.108] (-372.914) (-365.512) (-369.357) -- 0:00:20

      Average standard deviation of split frequencies: 0.011540

      655500 -- (-367.061) (-366.483) (-366.074) [-366.638] * [-368.144] (-366.923) (-365.405) (-365.474) -- 0:00:20
      656000 -- (-368.360) (-364.797) (-367.789) [-366.220] * (-365.983) [-367.529] (-365.539) (-365.004) -- 0:00:20
      656500 -- (-367.678) (-365.897) (-368.187) [-366.165] * (-364.814) (-366.631) [-366.352] (-367.000) -- 0:00:20
      657000 -- [-371.362] (-365.526) (-367.826) (-365.377) * (-365.637) [-367.028] (-365.669) (-369.032) -- 0:00:20
      657500 -- (-366.869) (-365.645) (-366.853) [-366.065] * (-365.501) (-365.480) (-367.335) [-365.571] -- 0:00:20
      658000 -- (-368.582) [-367.768] (-364.839) (-368.609) * (-368.136) (-366.504) (-366.552) [-367.014] -- 0:00:20
      658500 -- [-366.145] (-367.168) (-365.918) (-366.347) * (-367.837) (-366.396) (-366.145) [-367.036] -- 0:00:20
      659000 -- [-364.916] (-366.375) (-367.392) (-366.298) * (-368.763) (-364.765) [-364.825] (-368.190) -- 0:00:20
      659500 -- (-367.892) (-369.423) [-365.278] (-364.571) * [-368.541] (-367.175) (-365.503) (-365.941) -- 0:00:20
      660000 -- (-367.145) [-373.285] (-365.549) (-366.394) * (-367.195) (-369.919) [-364.899] (-366.850) -- 0:00:20

      Average standard deviation of split frequencies: 0.012130

      660500 -- (-366.867) (-366.254) [-366.161] (-369.326) * [-370.159] (-370.502) (-367.051) (-370.119) -- 0:00:20
      661000 -- (-367.046) (-364.515) [-365.843] (-366.064) * [-365.668] (-369.188) (-364.648) (-369.860) -- 0:00:20
      661500 -- [-367.723] (-364.750) (-369.054) (-367.750) * (-366.910) [-366.271] (-365.650) (-364.733) -- 0:00:19
      662000 -- [-366.086] (-367.405) (-369.292) (-367.522) * (-366.956) [-367.148] (-366.800) (-365.477) -- 0:00:19
      662500 -- (-367.423) (-366.060) (-368.593) [-367.333] * [-369.077] (-365.794) (-365.147) (-364.993) -- 0:00:19
      663000 -- (-365.205) [-365.780] (-369.346) (-365.157) * (-365.407) (-365.564) [-365.746] (-366.584) -- 0:00:19
      663500 -- (-365.462) (-366.215) [-368.250] (-367.600) * (-367.674) (-365.341) (-365.552) [-366.768] -- 0:00:19
      664000 -- [-365.869] (-373.055) (-366.497) (-366.615) * (-368.723) [-365.142] (-368.874) (-367.233) -- 0:00:19
      664500 -- [-368.716] (-369.521) (-367.544) (-369.155) * [-367.511] (-369.488) (-365.737) (-366.159) -- 0:00:19
      665000 -- (-367.160) [-367.836] (-365.143) (-368.148) * (-368.347) (-366.756) [-365.028] (-366.123) -- 0:00:19

      Average standard deviation of split frequencies: 0.012324

      665500 -- (-368.841) (-369.298) (-365.180) [-367.669] * [-366.531] (-366.904) (-366.130) (-366.905) -- 0:00:19
      666000 -- [-364.768] (-366.295) (-365.279) (-366.637) * (-369.779) [-366.468] (-369.269) (-366.536) -- 0:00:19
      666500 -- (-366.622) (-365.654) [-367.046] (-367.500) * (-367.457) [-367.393] (-365.391) (-366.447) -- 0:00:20
      667000 -- [-366.739] (-367.572) (-366.532) (-367.396) * (-367.011) (-367.420) (-366.464) [-365.692] -- 0:00:19
      667500 -- (-369.467) [-370.087] (-366.207) (-367.649) * (-368.252) (-367.458) (-365.456) [-366.151] -- 0:00:19
      668000 -- [-365.377] (-368.428) (-365.687) (-367.693) * (-369.722) [-367.798] (-367.494) (-367.130) -- 0:00:19
      668500 -- [-369.881] (-366.617) (-367.616) (-368.400) * (-365.749) [-368.080] (-366.196) (-366.294) -- 0:00:19
      669000 -- [-366.417] (-366.330) (-365.480) (-367.627) * (-366.990) (-365.003) [-364.853] (-365.671) -- 0:00:19
      669500 -- [-366.593] (-367.421) (-368.171) (-368.090) * [-366.467] (-366.290) (-365.421) (-365.725) -- 0:00:19
      670000 -- (-368.465) (-370.825) [-366.431] (-369.275) * (-365.383) (-368.402) (-365.382) [-366.628] -- 0:00:19

      Average standard deviation of split frequencies: 0.012652

      670500 -- [-368.792] (-365.361) (-365.610) (-365.662) * (-366.007) (-365.581) [-365.993] (-365.286) -- 0:00:19
      671000 -- [-366.804] (-366.077) (-369.891) (-366.285) * (-367.099) (-366.554) (-367.057) [-364.883] -- 0:00:19
      671500 -- (-371.425) (-369.901) (-367.801) [-365.668] * (-371.388) [-366.914] (-369.037) (-373.839) -- 0:00:19
      672000 -- (-371.767) [-367.035] (-365.826) (-366.331) * (-366.147) (-367.196) [-367.885] (-365.050) -- 0:00:19
      672500 -- (-373.678) (-365.650) [-365.070] (-366.513) * [-365.238] (-366.073) (-366.758) (-365.524) -- 0:00:19
      673000 -- (-369.559) [-365.963] (-367.634) (-365.513) * (-366.564) (-366.033) (-364.879) [-365.907] -- 0:00:19
      673500 -- (-370.056) (-367.262) [-368.711] (-369.444) * (-368.788) (-365.031) (-364.982) [-365.174] -- 0:00:19
      674000 -- (-368.821) (-367.708) [-365.655] (-369.171) * (-365.194) (-369.218) (-367.074) [-365.825] -- 0:00:19
      674500 -- [-365.245] (-365.731) (-367.293) (-368.391) * (-367.520) [-372.500] (-365.299) (-369.287) -- 0:00:19
      675000 -- (-366.288) (-368.058) [-364.830] (-365.949) * (-365.275) (-366.482) [-364.724] (-367.125) -- 0:00:19

      Average standard deviation of split frequencies: 0.012429

      675500 -- (-367.580) (-366.647) [-368.430] (-368.243) * (-366.466) [-369.154] (-366.324) (-367.489) -- 0:00:19
      676000 -- [-368.739] (-367.295) (-364.566) (-368.125) * (-365.058) [-367.047] (-365.833) (-365.455) -- 0:00:19
      676500 -- (-366.733) (-368.811) (-367.440) [-366.020] * (-364.542) [-368.727] (-365.511) (-365.889) -- 0:00:19
      677000 -- [-367.619] (-365.065) (-368.357) (-365.616) * (-366.401) (-368.634) [-366.901] (-365.308) -- 0:00:19
      677500 -- (-367.601) (-365.168) [-367.918] (-368.034) * (-365.002) (-368.465) [-367.957] (-367.405) -- 0:00:19
      678000 -- [-365.192] (-368.770) (-367.594) (-365.264) * (-365.045) (-366.341) (-366.223) [-366.713] -- 0:00:18
      678500 -- (-366.559) [-366.410] (-366.619) (-368.675) * [-364.886] (-366.049) (-368.171) (-366.122) -- 0:00:18
      679000 -- [-366.244] (-365.721) (-367.852) (-368.159) * (-368.547) [-366.486] (-366.148) (-366.309) -- 0:00:18
      679500 -- (-366.359) [-366.172] (-367.287) (-365.112) * (-367.848) (-367.915) (-370.933) [-366.513] -- 0:00:18
      680000 -- (-368.072) (-367.007) (-366.421) [-365.638] * (-367.165) [-365.112] (-372.054) (-369.065) -- 0:00:18

      Average standard deviation of split frequencies: 0.012385

      680500 -- (-367.280) (-365.556) (-365.480) [-367.041] * [-366.965] (-366.854) (-367.869) (-368.276) -- 0:00:18
      681000 -- (-368.792) (-365.810) (-366.682) [-365.593] * [-371.981] (-366.208) (-371.421) (-368.011) -- 0:00:18
      681500 -- (-365.213) (-366.094) [-365.953] (-373.646) * [-367.426] (-367.604) (-370.632) (-369.030) -- 0:00:18
      682000 -- (-370.900) (-368.410) [-367.499] (-369.700) * (-365.724) [-365.224] (-370.744) (-368.729) -- 0:00:18
      682500 -- (-369.990) (-364.892) [-367.681] (-366.617) * (-367.063) (-367.525) (-369.173) [-367.420] -- 0:00:18
      683000 -- (-366.178) [-367.456] (-366.284) (-367.808) * (-366.723) [-367.756] (-367.775) (-366.505) -- 0:00:18
      683500 -- (-368.573) (-366.617) [-367.492] (-367.687) * [-366.494] (-366.575) (-364.891) (-366.753) -- 0:00:18
      684000 -- (-371.160) (-364.720) [-369.191] (-367.489) * (-369.424) [-366.906] (-369.986) (-367.197) -- 0:00:18
      684500 -- (-365.520) [-365.057] (-367.268) (-367.790) * (-369.649) (-367.782) (-366.733) [-367.191] -- 0:00:18
      685000 -- (-369.032) (-366.652) [-368.166] (-367.855) * (-366.467) (-366.262) [-364.822] (-366.922) -- 0:00:18

      Average standard deviation of split frequencies: 0.012652

      685500 -- (-368.762) [-366.248] (-365.188) (-366.768) * (-371.911) [-366.838] (-365.657) (-371.678) -- 0:00:18
      686000 -- (-372.832) (-368.198) [-367.255] (-367.098) * (-370.054) (-373.965) (-368.572) [-367.067] -- 0:00:18
      686500 -- [-367.543] (-366.147) (-369.538) (-365.363) * (-371.832) [-366.513] (-371.381) (-366.766) -- 0:00:18
      687000 -- (-368.839) (-366.634) [-367.953] (-365.363) * (-365.230) (-370.828) (-365.932) [-365.925] -- 0:00:18
      687500 -- [-367.334] (-366.217) (-369.733) (-364.975) * (-369.405) (-365.932) [-364.531] (-366.110) -- 0:00:18
      688000 -- (-367.046) [-364.559] (-371.019) (-371.315) * (-367.173) [-366.478] (-366.630) (-367.878) -- 0:00:18
      688500 -- (-365.846) (-365.150) [-365.831] (-368.236) * [-367.751] (-372.078) (-364.725) (-366.199) -- 0:00:18
      689000 -- (-365.344) (-365.214) (-365.585) [-365.497] * (-368.094) (-366.810) (-365.974) [-366.356] -- 0:00:18
      689500 -- (-365.561) (-368.818) (-368.926) [-365.328] * [-365.528] (-366.450) (-366.113) (-367.296) -- 0:00:18
      690000 -- (-367.475) [-365.946] (-368.046) (-365.081) * (-367.112) [-365.539] (-368.662) (-366.871) -- 0:00:18

      Average standard deviation of split frequencies: 0.012366

      690500 -- (-366.491) [-368.699] (-367.558) (-366.180) * (-364.961) [-364.914] (-365.419) (-369.291) -- 0:00:18
      691000 -- [-365.556] (-366.050) (-367.729) (-364.707) * (-365.451) (-365.694) (-371.325) [-367.331] -- 0:00:18
      691500 -- [-365.865] (-365.343) (-368.757) (-365.507) * (-368.118) [-364.495] (-368.670) (-364.643) -- 0:00:18
      692000 -- (-365.232) (-367.309) [-366.871] (-368.082) * [-367.834] (-365.900) (-370.554) (-365.165) -- 0:00:18
      692500 -- (-366.868) (-367.734) [-366.230] (-368.906) * (-365.851) (-366.541) [-366.662] (-366.674) -- 0:00:18
      693000 -- (-366.050) (-366.647) (-367.371) [-370.896] * (-366.500) (-367.136) (-365.820) [-367.739] -- 0:00:18
      693500 -- (-366.984) (-366.170) (-365.988) [-365.337] * (-366.675) [-369.175] (-369.270) (-368.854) -- 0:00:18
      694000 -- [-369.863] (-369.072) (-365.939) (-367.309) * (-367.134) (-366.003) [-366.762] (-368.564) -- 0:00:18
      694500 -- (-367.137) [-367.930] (-367.299) (-365.378) * (-365.218) [-365.628] (-373.997) (-366.454) -- 0:00:18
      695000 -- (-365.215) [-365.066] (-365.786) (-368.076) * (-364.938) (-368.076) (-371.803) [-368.522] -- 0:00:17

      Average standard deviation of split frequencies: 0.012568

      695500 -- [-366.327] (-365.994) (-366.119) (-365.059) * [-365.590] (-368.478) (-369.752) (-368.592) -- 0:00:17
      696000 -- (-367.554) (-367.045) [-365.579] (-366.195) * [-365.525] (-368.268) (-372.061) (-367.698) -- 0:00:17
      696500 -- (-368.189) [-368.622] (-366.138) (-367.887) * [-366.349] (-365.485) (-372.971) (-365.179) -- 0:00:17
      697000 -- (-369.939) [-367.763] (-365.251) (-366.831) * (-366.151) (-365.550) [-370.056] (-365.234) -- 0:00:17
      697500 -- (-366.114) (-368.906) (-367.240) [-366.050] * (-371.658) (-364.484) (-369.810) [-366.569] -- 0:00:17
      698000 -- (-364.839) (-368.785) (-367.429) [-366.450] * [-367.375] (-366.103) (-366.178) (-365.158) -- 0:00:17
      698500 -- [-370.963] (-365.006) (-366.167) (-367.413) * (-366.990) (-366.769) [-364.996] (-366.565) -- 0:00:17
      699000 -- (-366.140) [-365.641] (-366.050) (-367.570) * [-366.792] (-366.121) (-367.124) (-367.779) -- 0:00:17
      699500 -- (-365.658) (-366.017) (-369.091) [-367.832] * (-365.400) (-368.577) (-366.622) [-365.681] -- 0:00:17
      700000 -- (-366.107) (-366.266) [-365.791] (-369.503) * (-367.010) (-365.564) (-371.740) [-368.720] -- 0:00:17

      Average standard deviation of split frequencies: 0.012372

      700500 -- (-370.482) [-366.902] (-368.653) (-368.021) * [-364.686] (-364.984) (-368.285) (-365.887) -- 0:00:17
      701000 -- (-370.771) (-368.028) [-368.192] (-365.537) * [-365.983] (-364.791) (-368.972) (-370.812) -- 0:00:17
      701500 -- (-369.870) [-365.798] (-366.926) (-367.365) * (-365.814) (-369.446) (-368.505) [-366.747] -- 0:00:17
      702000 -- (-367.075) (-370.116) [-366.107] (-366.419) * (-366.135) (-368.150) [-370.178] (-366.450) -- 0:00:17
      702500 -- (-366.468) (-368.964) [-366.350] (-372.045) * (-364.797) (-366.096) (-373.073) [-365.388] -- 0:00:17
      703000 -- [-365.286] (-368.290) (-365.735) (-370.985) * (-365.855) (-366.160) (-368.295) [-365.524] -- 0:00:17
      703500 -- (-364.911) (-368.880) [-367.192] (-366.140) * [-364.596] (-366.295) (-365.274) (-366.443) -- 0:00:17
      704000 -- (-364.557) (-366.660) (-369.094) [-364.622] * (-367.133) (-365.647) (-366.952) [-365.635] -- 0:00:17
      704500 -- (-369.487) (-367.310) (-369.133) [-365.012] * (-366.383) [-365.311] (-366.497) (-368.146) -- 0:00:17
      705000 -- (-364.820) [-369.384] (-365.146) (-365.176) * [-367.750] (-365.302) (-366.148) (-366.975) -- 0:00:17

      Average standard deviation of split frequencies: 0.012909

      705500 -- (-365.213) (-368.564) [-364.787] (-366.007) * [-366.262] (-365.797) (-366.127) (-366.429) -- 0:00:17
      706000 -- (-365.602) (-367.226) (-368.481) [-370.063] * (-366.815) (-367.590) [-365.869] (-366.951) -- 0:00:17
      706500 -- [-366.076] (-369.095) (-364.773) (-365.790) * (-365.747) (-364.969) [-366.366] (-369.086) -- 0:00:17
      707000 -- (-366.185) (-367.231) [-367.000] (-368.371) * (-368.386) (-367.374) (-367.615) [-368.782] -- 0:00:17
      707500 -- (-365.701) (-368.931) [-365.411] (-367.614) * (-365.523) (-365.094) (-368.669) [-368.008] -- 0:00:17
      708000 -- (-368.426) (-366.283) (-367.476) [-366.031] * (-367.540) [-366.827] (-368.658) (-371.253) -- 0:00:17
      708500 -- (-368.528) [-365.434] (-367.821) (-369.913) * (-366.466) (-365.295) [-367.259] (-367.547) -- 0:00:17
      709000 -- [-367.975] (-366.157) (-366.469) (-368.877) * (-367.148) (-366.553) [-366.388] (-367.401) -- 0:00:17
      709500 -- (-370.863) (-371.314) [-367.429] (-367.671) * [-365.797] (-365.744) (-367.509) (-368.496) -- 0:00:17
      710000 -- (-365.774) (-370.644) (-365.717) [-365.534] * [-365.707] (-368.630) (-366.477) (-366.306) -- 0:00:17

      Average standard deviation of split frequencies: 0.012493

      710500 -- (-367.389) (-365.050) (-366.009) [-365.813] * (-365.828) (-369.246) (-366.797) [-365.930] -- 0:00:17
      711000 -- [-365.921] (-367.055) (-369.141) (-365.317) * (-370.259) (-369.287) [-364.957] (-366.134) -- 0:00:17
      711500 -- [-365.334] (-366.617) (-369.017) (-368.505) * (-369.275) (-365.677) [-365.016] (-366.833) -- 0:00:17
      712000 -- [-370.136] (-366.891) (-376.105) (-370.342) * (-367.308) [-365.547] (-370.004) (-366.683) -- 0:00:16
      712500 -- (-372.051) (-365.534) [-367.182] (-366.805) * [-370.199] (-365.415) (-368.011) (-368.817) -- 0:00:16
      713000 -- (-371.484) (-366.051) (-367.154) [-364.839] * (-366.589) (-365.613) (-364.761) [-365.709] -- 0:00:16
      713500 -- (-368.332) (-371.308) (-364.953) [-364.990] * [-366.042] (-365.060) (-366.024) (-365.713) -- 0:00:16
      714000 -- (-368.697) (-370.949) (-367.435) [-368.018] * (-367.259) [-366.070] (-366.334) (-366.143) -- 0:00:16
      714500 -- (-368.478) (-369.966) [-367.068] (-370.313) * (-367.571) (-365.486) [-372.396] (-365.917) -- 0:00:16
      715000 -- (-366.107) (-367.778) [-366.456] (-366.886) * [-366.230] (-368.421) (-377.697) (-367.673) -- 0:00:16

      Average standard deviation of split frequencies: 0.012070

      715500 -- (-365.847) [-366.712] (-367.535) (-367.775) * (-370.767) [-366.566] (-366.017) (-366.873) -- 0:00:16
      716000 -- (-365.852) [-367.945] (-366.017) (-370.148) * (-368.281) (-364.915) (-366.877) [-365.757] -- 0:00:16
      716500 -- (-366.291) (-366.786) [-369.221] (-366.579) * (-365.836) (-366.485) (-369.718) [-367.188] -- 0:00:16
      717000 -- [-366.089] (-365.571) (-364.640) (-366.683) * [-366.077] (-367.644) (-366.199) (-367.335) -- 0:00:16
      717500 -- (-368.716) [-367.255] (-365.199) (-365.340) * [-366.203] (-366.341) (-367.456) (-366.876) -- 0:00:16
      718000 -- [-369.408] (-366.246) (-367.081) (-366.704) * [-366.771] (-366.406) (-366.241) (-371.091) -- 0:00:16
      718500 -- [-370.159] (-366.849) (-367.150) (-366.741) * (-365.510) (-367.287) (-365.858) [-368.806] -- 0:00:16
      719000 -- (-365.803) (-369.094) (-371.034) [-367.315] * (-366.355) (-366.568) [-365.302] (-368.999) -- 0:00:16
      719500 -- (-365.915) (-366.685) [-365.772] (-366.553) * (-366.023) [-367.200] (-369.353) (-365.040) -- 0:00:16
      720000 -- (-368.101) (-370.209) [-366.938] (-368.039) * (-366.281) (-365.633) [-370.199] (-367.044) -- 0:00:16

      Average standard deviation of split frequencies: 0.012390

      720500 -- (-368.781) (-367.722) [-364.951] (-368.664) * [-368.061] (-366.963) (-366.875) (-369.687) -- 0:00:16
      721000 -- [-367.520] (-367.456) (-368.550) (-366.691) * (-366.445) (-367.048) (-366.045) [-366.516] -- 0:00:16
      721500 -- (-366.028) [-366.793] (-368.706) (-367.162) * (-369.227) (-368.160) (-366.636) [-368.280] -- 0:00:16
      722000 -- (-369.133) (-366.072) [-367.087] (-366.700) * [-366.617] (-365.996) (-367.747) (-367.298) -- 0:00:16
      722500 -- (-366.143) [-365.554] (-368.377) (-367.343) * [-365.612] (-368.519) (-367.601) (-368.137) -- 0:00:16
      723000 -- (-368.429) (-371.421) [-367.272] (-365.550) * (-365.967) (-369.438) [-367.519] (-367.544) -- 0:00:16
      723500 -- [-366.308] (-366.701) (-366.042) (-366.774) * [-364.661] (-368.668) (-365.606) (-368.401) -- 0:00:16
      724000 -- (-365.026) [-368.942] (-364.974) (-368.107) * (-366.307) (-366.175) [-369.606] (-367.324) -- 0:00:16
      724500 -- [-365.685] (-365.070) (-366.990) (-366.769) * [-364.856] (-367.189) (-371.248) (-365.866) -- 0:00:16
      725000 -- (-366.563) (-368.121) (-367.321) [-366.785] * (-369.475) (-368.495) [-365.686] (-364.947) -- 0:00:16

      Average standard deviation of split frequencies: 0.011940

      725500 -- (-368.461) (-366.634) (-366.491) [-366.774] * (-369.004) [-365.418] (-365.445) (-365.019) -- 0:00:16
      726000 -- (-368.287) (-369.871) [-368.188] (-366.833) * (-368.055) (-365.859) [-367.077] (-366.560) -- 0:00:16
      726500 -- (-367.386) (-370.598) [-368.457] (-366.371) * [-366.343] (-370.859) (-365.593) (-370.886) -- 0:00:16
      727000 -- (-365.807) (-366.804) (-368.729) [-365.117] * (-370.120) (-369.222) (-366.103) [-366.633] -- 0:00:16
      727500 -- [-365.379] (-367.273) (-367.470) (-369.088) * (-371.095) [-366.801] (-365.164) (-366.163) -- 0:00:16
      728000 -- (-369.202) (-370.280) [-365.640] (-369.167) * (-368.997) [-368.887] (-365.371) (-366.254) -- 0:00:16
      728500 -- (-364.860) (-371.380) [-365.824] (-370.659) * (-366.644) [-367.663] (-368.344) (-370.819) -- 0:00:16
      729000 -- (-365.560) (-371.878) [-365.273] (-367.681) * (-367.774) (-369.258) [-365.517] (-366.410) -- 0:00:15
      729500 -- [-369.468] (-371.221) (-366.501) (-365.856) * [-371.629] (-377.160) (-365.913) (-367.672) -- 0:00:15
      730000 -- (-364.776) (-368.512) [-365.230] (-373.777) * [-368.624] (-368.758) (-365.433) (-364.999) -- 0:00:15

      Average standard deviation of split frequencies: 0.012258

      730500 -- (-369.782) (-368.839) (-367.579) [-366.074] * (-366.083) [-365.455] (-371.289) (-368.193) -- 0:00:15
      731000 -- (-378.894) (-367.494) [-366.199] (-367.323) * (-365.796) [-365.762] (-374.749) (-368.853) -- 0:00:15
      731500 -- (-367.930) (-364.974) [-365.746] (-365.925) * (-369.797) (-366.626) (-372.382) [-369.170] -- 0:00:15
      732000 -- [-366.175] (-367.013) (-365.171) (-365.792) * [-366.665] (-365.709) (-368.657) (-366.389) -- 0:00:15
      732500 -- (-367.153) (-368.029) (-368.199) [-365.012] * (-366.861) (-370.047) (-366.469) [-367.461] -- 0:00:15
      733000 -- (-365.917) [-368.015] (-370.717) (-366.257) * (-366.185) (-372.052) [-365.607] (-368.317) -- 0:00:15
      733500 -- [-365.253] (-367.894) (-368.373) (-369.679) * [-365.226] (-368.149) (-369.125) (-366.431) -- 0:00:15
      734000 -- (-366.605) (-368.502) [-370.436] (-367.368) * (-365.907) (-367.983) [-367.000] (-367.859) -- 0:00:15
      734500 -- [-366.357] (-367.553) (-367.101) (-367.670) * (-366.132) [-367.848] (-368.779) (-367.948) -- 0:00:15
      735000 -- (-365.169) (-367.010) [-366.123] (-370.697) * (-369.159) [-367.928] (-365.053) (-364.714) -- 0:00:15

      Average standard deviation of split frequencies: 0.011169

      735500 -- (-366.556) (-367.934) (-369.150) [-367.577] * [-365.308] (-366.467) (-366.271) (-366.431) -- 0:00:15
      736000 -- [-365.201] (-367.613) (-365.549) (-364.694) * (-369.995) (-366.849) (-367.972) [-365.118] -- 0:00:15
      736500 -- [-367.541] (-365.092) (-367.207) (-367.114) * (-366.034) (-367.100) [-366.465] (-364.918) -- 0:00:15
      737000 -- (-365.421) [-368.568] (-368.118) (-367.481) * (-365.622) (-365.132) [-365.532] (-365.938) -- 0:00:15
      737500 -- (-366.211) (-366.810) [-367.580] (-368.705) * (-366.842) (-370.267) (-367.849) [-365.685] -- 0:00:15
      738000 -- [-365.049] (-367.470) (-366.413) (-365.329) * (-366.582) [-366.177] (-368.581) (-368.375) -- 0:00:15
      738500 -- (-370.184) (-366.116) (-367.595) [-369.239] * (-368.594) (-365.185) (-366.864) [-365.723] -- 0:00:15
      739000 -- (-366.482) (-366.973) [-365.403] (-367.689) * (-366.997) (-366.478) (-367.616) [-366.800] -- 0:00:15
      739500 -- (-366.051) (-369.902) [-365.248] (-366.996) * (-366.284) (-369.165) [-365.453] (-367.785) -- 0:00:15
      740000 -- (-367.389) (-366.779) [-365.859] (-366.761) * (-365.824) (-368.879) [-367.225] (-365.133) -- 0:00:15

      Average standard deviation of split frequencies: 0.011615

      740500 -- [-365.690] (-366.417) (-366.319) (-370.875) * (-364.843) (-369.033) (-368.689) [-366.187] -- 0:00:15
      741000 -- (-370.309) [-366.368] (-367.119) (-365.479) * (-364.833) (-367.116) [-365.499] (-369.020) -- 0:00:15
      741500 -- (-368.417) (-364.374) [-367.535] (-366.961) * (-366.398) [-366.785] (-369.958) (-366.954) -- 0:00:15
      742000 -- (-366.752) (-365.702) (-368.452) [-372.113] * (-365.452) [-365.412] (-365.737) (-366.839) -- 0:00:15
      742500 -- [-365.109] (-367.662) (-365.783) (-364.900) * (-368.590) (-366.016) [-365.254] (-365.655) -- 0:00:15
      743000 -- (-369.171) (-365.239) [-365.096] (-368.628) * [-367.354] (-369.706) (-364.770) (-367.448) -- 0:00:15
      743500 -- (-369.961) (-364.539) (-365.909) [-365.706] * (-366.018) (-365.560) (-366.390) [-366.046] -- 0:00:15
      744000 -- (-367.162) (-365.890) (-365.282) [-366.389] * (-367.978) [-365.198] (-370.245) (-367.841) -- 0:00:15
      744500 -- (-368.374) (-366.276) [-366.311] (-368.055) * (-366.825) (-366.689) [-366.774] (-370.250) -- 0:00:15
      745000 -- (-371.680) [-365.936] (-370.285) (-365.710) * [-364.740] (-365.126) (-365.576) (-364.608) -- 0:00:15

      Average standard deviation of split frequencies: 0.011523

      745500 -- (-366.065) [-365.501] (-369.704) (-370.147) * (-368.784) (-367.986) (-366.118) [-367.966] -- 0:00:15
      746000 -- [-366.272] (-366.506) (-370.458) (-370.300) * (-366.550) [-368.083] (-365.852) (-364.815) -- 0:00:14
      746500 -- [-368.941] (-365.413) (-372.967) (-367.745) * (-369.197) [-365.399] (-365.835) (-364.671) -- 0:00:14
      747000 -- (-366.063) (-365.956) (-370.663) [-365.096] * (-366.528) (-373.503) (-365.936) [-366.006] -- 0:00:14
      747500 -- (-366.199) (-366.364) (-368.813) [-365.186] * (-366.306) (-366.252) (-368.381) [-367.891] -- 0:00:14
      748000 -- (-366.725) (-366.068) (-367.646) [-368.607] * (-365.806) (-366.928) (-368.711) [-365.866] -- 0:00:14
      748500 -- (-367.367) (-365.028) [-366.799] (-364.551) * (-366.002) [-370.472] (-369.327) (-371.401) -- 0:00:14
      749000 -- [-368.412] (-366.518) (-364.979) (-365.251) * (-366.998) (-366.801) [-365.541] (-367.987) -- 0:00:14
      749500 -- (-368.073) (-368.986) (-371.466) [-366.392] * (-367.110) (-366.970) (-365.116) [-366.185] -- 0:00:14
      750000 -- [-365.025] (-367.141) (-365.607) (-365.507) * (-370.903) (-365.572) (-370.347) [-366.946] -- 0:00:14

      Average standard deviation of split frequencies: 0.012225

      750500 -- (-364.996) [-366.779] (-365.272) (-366.094) * (-367.581) (-365.618) [-365.940] (-368.113) -- 0:00:14
      751000 -- (-368.188) [-368.155] (-369.322) (-366.641) * (-365.993) (-365.134) (-369.063) [-367.523] -- 0:00:14
      751500 -- (-364.902) [-365.546] (-368.071) (-368.117) * (-365.756) (-366.777) [-371.441] (-373.971) -- 0:00:14
      752000 -- [-366.646] (-366.797) (-366.331) (-371.078) * (-366.577) [-366.909] (-368.346) (-366.564) -- 0:00:14
      752500 -- (-368.332) [-365.206] (-369.132) (-370.737) * [-367.173] (-372.044) (-371.713) (-367.541) -- 0:00:14
      753000 -- (-367.302) (-369.466) [-369.640] (-367.222) * [-367.237] (-368.949) (-367.517) (-367.320) -- 0:00:14
      753500 -- (-365.809) (-368.792) (-366.030) [-364.715] * (-366.862) [-364.835] (-365.868) (-366.342) -- 0:00:14
      754000 -- (-365.000) (-370.248) [-369.551] (-365.604) * (-366.264) (-367.317) [-365.135] (-370.324) -- 0:00:14
      754500 -- (-366.743) [-365.334] (-374.836) (-369.479) * (-366.612) (-368.763) (-368.882) [-365.836] -- 0:00:14
      755000 -- [-366.961] (-369.179) (-366.688) (-365.168) * [-369.978] (-365.557) (-368.985) (-365.004) -- 0:00:14

      Average standard deviation of split frequencies: 0.011536

      755500 -- (-372.613) [-367.274] (-369.710) (-368.019) * (-371.015) (-367.773) [-366.946] (-368.825) -- 0:00:14
      756000 -- (-367.747) [-365.708] (-367.144) (-365.967) * (-378.196) (-367.509) [-368.602] (-368.434) -- 0:00:14
      756500 -- (-367.428) (-367.773) [-367.196] (-366.374) * (-369.183) [-365.295] (-365.362) (-369.096) -- 0:00:14
      757000 -- (-368.046) (-367.874) [-365.542] (-370.000) * (-365.525) (-365.993) (-365.688) [-367.016] -- 0:00:14
      757500 -- (-367.550) (-365.806) [-365.041] (-368.222) * (-365.483) [-365.842] (-366.047) (-367.294) -- 0:00:14
      758000 -- [-366.889] (-370.627) (-365.737) (-365.518) * [-365.353] (-367.628) (-366.710) (-365.145) -- 0:00:14
      758500 -- [-366.150] (-365.912) (-368.100) (-367.566) * [-367.520] (-367.150) (-365.022) (-364.793) -- 0:00:14
      759000 -- (-365.015) (-367.595) (-369.111) [-368.753] * [-367.000] (-366.794) (-369.280) (-365.553) -- 0:00:14
      759500 -- [-367.100] (-368.913) (-373.256) (-368.447) * (-367.038) (-366.672) [-368.692] (-369.776) -- 0:00:14
      760000 -- [-365.580] (-370.399) (-370.470) (-365.454) * (-365.308) (-371.145) [-366.224] (-367.308) -- 0:00:14

      Average standard deviation of split frequencies: 0.011082

      760500 -- (-368.498) (-369.515) [-365.958] (-373.011) * (-366.954) (-367.088) (-373.722) [-367.959] -- 0:00:14
      761000 -- (-367.287) (-371.987) [-365.543] (-367.765) * [-366.604] (-369.292) (-367.632) (-367.428) -- 0:00:14
      761500 -- (-367.315) (-366.342) (-365.668) [-368.181] * (-366.598) (-372.438) (-370.886) [-368.914] -- 0:00:14
      762000 -- (-368.860) [-369.437] (-365.657) (-366.763) * (-369.127) [-368.867] (-368.501) (-370.872) -- 0:00:14
      762500 -- (-370.109) (-368.896) [-364.737] (-369.581) * (-367.160) (-368.318) [-364.435] (-367.562) -- 0:00:14
      763000 -- (-374.201) (-364.744) [-366.839] (-371.627) * (-366.803) [-369.116] (-366.932) (-368.087) -- 0:00:13
      763500 -- (-370.710) [-365.793] (-376.261) (-366.852) * [-366.888] (-368.058) (-366.343) (-368.593) -- 0:00:13
      764000 -- [-369.448] (-367.189) (-368.402) (-364.779) * [-365.801] (-366.287) (-367.822) (-368.849) -- 0:00:13
      764500 -- (-366.833) (-368.007) (-370.030) [-364.951] * (-365.837) [-367.768] (-368.100) (-370.549) -- 0:00:13
      765000 -- (-366.505) (-365.594) [-366.303] (-370.212) * (-372.521) (-369.704) [-367.075] (-365.939) -- 0:00:13

      Average standard deviation of split frequencies: 0.010896

      765500 -- (-370.116) (-365.812) [-365.765] (-366.563) * (-367.851) (-369.586) [-367.191] (-365.744) -- 0:00:13
      766000 -- (-366.614) (-368.578) [-365.432] (-366.128) * (-366.233) (-367.247) (-366.968) [-366.393] -- 0:00:13
      766500 -- (-368.311) (-367.672) (-368.571) [-366.690] * [-367.796] (-368.620) (-370.522) (-366.937) -- 0:00:13
      767000 -- (-366.586) (-366.713) (-368.444) [-367.543] * (-364.974) (-370.511) (-369.313) [-367.063] -- 0:00:13
      767500 -- (-364.825) [-366.592] (-366.331) (-366.165) * [-365.109] (-367.695) (-366.184) (-369.595) -- 0:00:13
      768000 -- (-366.733) (-369.183) (-368.131) [-365.054] * (-365.173) (-367.640) (-368.223) [-371.943] -- 0:00:13
      768500 -- (-365.510) (-367.821) [-367.087] (-366.253) * (-367.171) [-370.195] (-366.977) (-368.918) -- 0:00:13
      769000 -- (-369.667) (-372.971) [-364.751] (-367.547) * (-366.192) (-369.358) [-368.138] (-368.841) -- 0:00:13
      769500 -- [-367.857] (-370.975) (-366.530) (-370.967) * [-365.120] (-366.377) (-366.275) (-366.752) -- 0:00:13
      770000 -- [-367.165] (-366.214) (-365.679) (-371.911) * [-368.558] (-369.622) (-367.298) (-368.418) -- 0:00:13

      Average standard deviation of split frequencies: 0.011226

      770500 -- (-367.100) (-366.197) [-369.231] (-367.712) * (-367.159) (-365.549) (-369.712) [-368.392] -- 0:00:13
      771000 -- (-366.343) [-367.946] (-366.749) (-366.290) * [-366.162] (-367.894) (-368.310) (-365.489) -- 0:00:13
      771500 -- [-364.876] (-369.087) (-365.793) (-365.685) * (-364.646) (-367.808) [-367.180] (-365.927) -- 0:00:13
      772000 -- (-365.603) (-366.232) [-365.280] (-366.006) * (-369.027) (-367.883) (-365.094) [-369.823] -- 0:00:13
      772500 -- (-366.538) (-365.013) (-367.144) [-366.470] * [-368.555] (-368.311) (-364.717) (-367.198) -- 0:00:13
      773000 -- (-365.704) [-365.380] (-365.067) (-367.893) * [-366.241] (-366.132) (-365.471) (-367.069) -- 0:00:13
      773500 -- (-366.469) [-366.865] (-365.262) (-367.137) * (-367.572) (-367.641) [-366.679] (-365.017) -- 0:00:13
      774000 -- (-365.712) (-366.297) [-367.280] (-367.577) * (-366.384) [-365.784] (-366.133) (-369.767) -- 0:00:13
      774500 -- (-365.944) (-365.653) (-365.239) [-367.346] * (-365.984) (-366.492) [-368.338] (-366.103) -- 0:00:13
      775000 -- [-367.224] (-367.010) (-365.756) (-366.999) * (-366.427) [-366.430] (-366.494) (-368.126) -- 0:00:13

      Average standard deviation of split frequencies: 0.011328

      775500 -- (-366.711) (-367.651) (-366.525) [-367.460] * (-365.710) (-367.508) (-367.220) [-368.137] -- 0:00:13
      776000 -- (-365.122) (-365.830) [-366.202] (-369.382) * (-366.364) (-365.331) (-365.667) [-367.229] -- 0:00:13
      776500 -- (-365.727) [-367.302] (-365.830) (-364.950) * (-370.080) (-366.313) (-368.918) [-369.562] -- 0:00:13
      777000 -- (-367.628) (-366.633) [-366.664] (-368.657) * [-368.683] (-368.991) (-367.899) (-367.329) -- 0:00:13
      777500 -- (-368.955) (-367.600) (-366.940) [-369.301] * (-369.596) (-365.821) (-371.418) [-369.978] -- 0:00:13
      778000 -- (-365.594) [-366.556] (-371.106) (-366.247) * (-374.870) (-367.709) (-368.144) [-366.036] -- 0:00:13
      778500 -- (-366.927) [-365.924] (-367.069) (-365.034) * (-366.386) (-368.178) (-366.873) [-368.317] -- 0:00:13
      779000 -- (-365.848) (-367.544) (-364.863) [-366.486] * (-367.098) [-367.837] (-365.384) (-366.341) -- 0:00:13
      779500 -- [-366.653] (-367.046) (-366.424) (-365.382) * (-369.932) (-366.289) (-364.912) [-365.352] -- 0:00:13
      780000 -- (-367.550) (-366.805) [-367.213] (-366.062) * (-365.458) (-367.470) [-365.078] (-364.971) -- 0:00:12

      Average standard deviation of split frequencies: 0.011284

      780500 -- (-367.224) [-365.778] (-370.688) (-366.097) * (-366.272) (-370.485) (-367.136) [-365.244] -- 0:00:12
      781000 -- [-365.743] (-365.872) (-370.681) (-365.461) * (-365.704) (-369.514) (-369.971) [-365.687] -- 0:00:12
      781500 -- (-366.867) [-365.412] (-369.935) (-366.362) * [-366.135] (-367.165) (-368.621) (-366.681) -- 0:00:12
      782000 -- [-367.879] (-366.527) (-368.071) (-364.959) * (-365.982) (-368.873) (-369.554) [-368.218] -- 0:00:12
      782500 -- (-366.230) (-366.669) [-371.310] (-368.865) * [-365.581] (-367.292) (-366.156) (-365.357) -- 0:00:12
      783000 -- (-364.707) (-365.696) [-366.524] (-372.003) * (-368.287) (-368.432) [-367.009] (-367.100) -- 0:00:12
      783500 -- (-367.142) (-366.367) [-368.790] (-367.698) * [-368.408] (-370.697) (-368.697) (-367.361) -- 0:00:12
      784000 -- (-366.474) [-365.305] (-367.141) (-367.056) * (-366.931) (-366.245) [-367.118] (-366.127) -- 0:00:12
      784500 -- (-369.678) (-365.873) [-368.429] (-366.384) * (-369.248) (-369.610) [-368.825] (-366.453) -- 0:00:12
      785000 -- (-368.415) [-365.708] (-368.938) (-367.943) * (-365.701) [-365.627] (-367.933) (-365.596) -- 0:00:12

      Average standard deviation of split frequencies: 0.011678

      785500 -- (-368.438) (-368.988) [-368.260] (-370.330) * (-366.294) (-365.985) (-367.059) [-368.957] -- 0:00:12
      786000 -- (-368.271) (-365.986) (-364.722) [-371.074] * (-367.808) [-365.592] (-365.768) (-365.504) -- 0:00:12
      786500 -- (-365.642) [-368.454] (-365.243) (-368.642) * (-368.368) [-366.128] (-366.940) (-368.464) -- 0:00:12
      787000 -- (-365.148) (-365.909) [-367.137] (-368.300) * (-367.183) [-367.433] (-367.291) (-365.807) -- 0:00:12
      787500 -- [-368.260] (-364.805) (-366.370) (-364.925) * (-367.205) (-367.827) (-366.333) [-366.541] -- 0:00:12
      788000 -- [-366.054] (-365.597) (-368.142) (-367.466) * (-366.419) (-366.717) (-369.222) [-365.989] -- 0:00:12
      788500 -- [-365.347] (-365.795) (-365.540) (-365.484) * [-365.336] (-367.906) (-369.587) (-369.027) -- 0:00:12
      789000 -- (-368.813) (-365.044) (-367.964) [-366.206] * (-366.808) (-365.538) (-365.857) [-367.539] -- 0:00:12
      789500 -- [-364.832] (-365.011) (-370.320) (-364.930) * (-365.711) (-365.552) [-366.561] (-368.698) -- 0:00:12
      790000 -- (-365.422) [-365.664] (-368.008) (-365.845) * (-365.937) [-366.944] (-364.478) (-365.483) -- 0:00:12

      Average standard deviation of split frequencies: 0.011959

      790500 -- [-367.789] (-366.760) (-368.540) (-367.130) * (-365.442) [-366.213] (-366.488) (-367.911) -- 0:00:12
      791000 -- (-370.301) (-365.929) [-368.498] (-368.795) * (-369.351) (-366.361) (-365.242) [-366.853] -- 0:00:12
      791500 -- (-368.169) [-368.842] (-364.997) (-368.233) * (-365.416) [-368.842] (-366.872) (-370.579) -- 0:00:12
      792000 -- (-366.658) (-367.403) (-364.863) [-367.445] * [-367.732] (-371.711) (-366.167) (-370.724) -- 0:00:12
      792500 -- [-367.455] (-369.956) (-366.449) (-378.774) * [-369.942] (-368.871) (-371.410) (-367.836) -- 0:00:12
      793000 -- (-366.598) (-367.162) (-371.597) [-366.126] * [-366.852] (-365.788) (-367.565) (-365.746) -- 0:00:12
      793500 -- (-368.368) (-373.004) (-369.831) [-365.421] * (-368.219) [-372.470] (-366.211) (-364.574) -- 0:00:12
      794000 -- (-369.848) (-365.598) [-370.400] (-365.472) * (-366.788) (-367.297) (-365.863) [-366.548] -- 0:00:12
      794500 -- (-369.681) (-369.729) (-369.898) [-366.741] * (-366.759) (-367.676) [-367.299] (-371.058) -- 0:00:12
      795000 -- (-370.117) [-365.238] (-366.436) (-368.357) * (-365.515) [-368.843] (-365.515) (-365.303) -- 0:00:12

      Average standard deviation of split frequencies: 0.012053

      795500 -- (-367.944) [-367.074] (-365.351) (-366.771) * [-364.781] (-369.691) (-366.487) (-365.911) -- 0:00:12
      796000 -- (-367.093) [-367.992] (-366.875) (-368.717) * [-365.178] (-365.623) (-366.883) (-368.124) -- 0:00:12
      796500 -- (-368.905) (-369.118) (-367.064) [-367.443] * (-364.886) (-366.968) (-366.831) [-368.089] -- 0:00:12
      797000 -- (-370.577) (-369.762) [-366.491] (-368.583) * (-366.084) (-366.128) (-372.260) [-366.408] -- 0:00:11
      797500 -- (-367.803) (-370.812) [-364.819] (-365.119) * (-366.338) (-365.462) (-370.159) [-365.342] -- 0:00:11
      798000 -- (-368.180) (-370.579) [-364.833] (-365.766) * [-367.723] (-365.662) (-366.881) (-364.877) -- 0:00:11
      798500 -- [-367.419] (-367.486) (-365.931) (-366.981) * (-366.678) (-365.997) (-366.999) [-366.519] -- 0:00:11
      799000 -- (-369.031) (-367.801) (-368.197) [-369.915] * [-364.813] (-366.953) (-366.182) (-368.705) -- 0:00:11
      799500 -- [-365.542] (-366.111) (-366.678) (-364.418) * (-365.266) [-367.441] (-366.465) (-366.893) -- 0:00:11
      800000 -- (-369.043) (-364.757) [-367.344] (-365.584) * [-367.724] (-369.139) (-368.591) (-366.286) -- 0:00:11

      Average standard deviation of split frequencies: 0.012329

      800500 -- (-367.191) (-364.995) [-369.497] (-364.723) * (-367.016) (-366.099) [-368.489] (-367.564) -- 0:00:11
      801000 -- (-364.739) (-366.794) (-365.725) [-365.721] * (-366.717) (-364.572) (-367.315) [-365.358] -- 0:00:11
      801500 -- (-365.711) (-367.532) [-367.004] (-375.421) * (-366.750) (-367.853) (-368.236) [-366.903] -- 0:00:11
      802000 -- (-368.471) (-366.307) [-366.727] (-369.496) * (-367.475) (-366.073) (-365.969) [-366.209] -- 0:00:11
      802500 -- (-368.767) (-366.406) (-367.855) [-367.637] * (-367.315) (-369.790) (-370.749) [-368.587] -- 0:00:11
      803000 -- (-367.046) (-368.761) [-367.001] (-368.725) * (-366.941) (-366.182) (-368.051) [-364.791] -- 0:00:11
      803500 -- (-370.000) [-370.002] (-369.698) (-369.769) * (-367.132) (-368.864) (-366.116) [-365.952] -- 0:00:11
      804000 -- (-370.260) [-367.328] (-367.826) (-365.167) * [-366.477] (-365.570) (-365.987) (-367.274) -- 0:00:11
      804500 -- (-364.947) (-367.708) (-369.429) [-368.371] * [-366.839] (-365.956) (-368.614) (-370.052) -- 0:00:11
      805000 -- [-366.557] (-364.830