--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:10:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsS/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -386.35          -389.92
2       -386.38          -389.80
--------------------------------------
TOTAL     -386.36          -389.86
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.896501    0.089263    0.335835    1.477724    0.864119   1355.72   1428.36    1.000
r(A<->C){all}   0.162306    0.019085    0.000122    0.442583    0.127266    199.05    208.79    1.000
r(A<->G){all}   0.165454    0.018664    0.000018    0.439914    0.132401    208.76    244.43    1.004
r(A<->T){all}   0.169710    0.020854    0.000078    0.459402    0.133615    214.48    237.54    1.004
r(C<->G){all}   0.165868    0.021280    0.000031    0.464043    0.125060    199.69    203.98    1.000
r(C<->T){all}   0.162087    0.018667    0.000098    0.445064    0.125207    242.03    281.84    1.002
r(G<->T){all}   0.174575    0.021546    0.000074    0.470894    0.136317    230.60    295.58    1.008
pi(A){all}      0.264301    0.000724    0.214151    0.319892    0.263747   1303.68   1315.62    1.000
pi(C){all}      0.271753    0.000708    0.219633    0.323654    0.270841   1264.13   1308.72    1.000
pi(G){all}      0.265008    0.000670    0.216336    0.317913    0.263951   1366.33   1433.66    1.000
pi(T){all}      0.198938    0.000550    0.154774    0.245083    0.198039   1330.04   1399.10    1.000
alpha{1,2}      0.400770    0.202227    0.000204    1.315972    0.246340   1228.53   1279.44    1.000
alpha{3}        0.448184    0.232293    0.000119    1.438954    0.281797   1215.67   1329.77    1.000
pinvar{all}     0.993785    0.000052    0.979491    0.999997    0.996202   1306.95   1391.59    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-367.512444
Model 2: PositiveSelection	-367.512343
Model 0: one-ratio	-367.512471
Model 7: beta	-367.512343
Model 8: beta&w>1	-367.512343


Model 0 vs 1	5.3999999977349944E-5

Model 2 vs 1	2.0200000005843322E-4

Model 8 vs 7	0.0
>C1
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C2
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C3
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C4
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C5
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C6
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=93 

C1              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C2              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C3              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C4              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C5              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C6              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
                **************************************************

C1              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C2              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C3              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C4              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C5              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C6              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
                *******************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length   93 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length   93 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [2790]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [2790]--->[2790]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.441 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C2              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C3              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C4              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C5              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C6              MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
                **************************************************

C1              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C2              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C3              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C4              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C5              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C6              VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
                *******************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C2              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C3              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C4              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C5              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C6              ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
                **************************************************

C1              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C2              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C3              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C4              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C5              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C6              GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
                **************************************************

C1              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C2              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C3              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C4              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C5              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C6              GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
                **************************************************

C1              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C2              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C3              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C4              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C5              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C6              GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
                **************************************************

C1              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C2              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C3              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C4              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C5              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C6              GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
                **************************************************

C1              TCAAGGATGACCGGAAGGCCAAACGACGA
C2              TCAAGGATGACCGGAAGGCCAAACGACGA
C3              TCAAGGATGACCGGAAGGCCAAACGACGA
C4              TCAAGGATGACCGGAAGGCCAAACGACGA
C5              TCAAGGATGACCGGAAGGCCAAACGACGA
C6              TCAAGGATGACCGGAAGGCCAAACGACGA
                *****************************



>C1
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C2
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C3
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C4
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C5
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C6
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C1
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C2
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C3
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C4
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C5
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C6
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 279 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788549
      Setting output file names to "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 2024459600
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0454929038
      Seed = 702443027
      Swapseed = 1579788549
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -624.415377 -- -24.965149
         Chain 2 -- -624.415377 -- -24.965149
         Chain 3 -- -624.415282 -- -24.965149
         Chain 4 -- -624.415342 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -624.415377 -- -24.965149
         Chain 2 -- -624.415342 -- -24.965149
         Chain 3 -- -624.415342 -- -24.965149
         Chain 4 -- -624.415377 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-624.415] (-624.415) (-624.415) (-624.415) * [-624.415] (-624.415) (-624.415) (-624.415) 
        500 -- (-393.434) (-400.251) (-397.532) [-395.171] * (-405.320) (-399.812) [-392.848] (-394.321) -- 0:00:00
       1000 -- (-398.934) [-396.786] (-397.664) (-393.213) * [-392.039] (-388.564) (-396.444) (-398.887) -- 0:00:00
       1500 -- (-399.311) (-398.167) [-389.964] (-394.920) * (-394.195) (-407.119) (-391.368) [-399.266] -- 0:00:00
       2000 -- (-393.169) (-396.573) [-390.978] (-396.244) * (-397.263) [-395.926] (-394.867) (-405.264) -- 0:00:00
       2500 -- (-394.196) (-406.574) (-394.001) [-401.152] * (-395.319) [-402.838] (-395.667) (-399.906) -- 0:00:00
       3000 -- (-396.022) [-392.668] (-395.489) (-394.214) * (-393.496) (-394.550) (-398.845) [-390.951] -- 0:00:00
       3500 -- [-392.709] (-404.300) (-395.620) (-399.467) * (-396.328) [-395.285] (-405.917) (-395.842) -- 0:00:00
       4000 -- (-391.554) (-399.700) [-395.220] (-403.098) * (-403.655) (-405.585) (-403.890) [-399.432] -- 0:00:00
       4500 -- [-391.337] (-392.194) (-396.283) (-398.078) * (-406.331) (-402.437) [-391.995] (-401.550) -- 0:00:00
       5000 -- (-401.679) (-396.428) [-393.788] (-397.866) * (-401.374) (-398.968) [-396.614] (-402.884) -- 0:00:00

      Average standard deviation of split frequencies: 0.102138

       5500 -- (-397.173) (-398.388) [-399.225] (-401.033) * (-392.893) (-404.548) (-398.620) [-396.595] -- 0:00:00
       6000 -- (-399.563) [-391.754] (-393.198) (-394.302) * (-398.022) (-395.140) [-400.972] (-395.687) -- 0:00:00
       6500 -- (-394.606) [-392.747] (-394.406) (-396.005) * (-398.360) [-393.633] (-397.787) (-395.754) -- 0:00:00
       7000 -- (-395.233) [-395.873] (-398.848) (-398.004) * (-405.146) [-390.623] (-392.037) (-392.284) -- 0:00:00
       7500 -- (-396.503) (-406.524) [-396.695] (-401.349) * (-403.044) (-392.449) [-396.173] (-392.819) -- 0:00:00
       8000 -- (-397.679) (-399.585) (-397.998) [-398.638] * (-386.865) (-393.937) [-397.256] (-397.406) -- 0:00:00
       8500 -- (-410.079) (-396.164) (-397.437) [-401.242] * [-388.042] (-399.017) (-401.045) (-399.780) -- 0:01:56
       9000 -- [-396.433] (-396.788) (-399.941) (-405.381) * [-388.118] (-401.453) (-397.741) (-409.469) -- 0:01:50
       9500 -- [-396.351] (-406.823) (-392.705) (-392.945) * (-386.508) [-393.403] (-397.556) (-404.028) -- 0:01:44
      10000 -- (-395.469) [-387.130] (-400.902) (-395.173) * (-385.374) (-401.943) [-398.233] (-409.142) -- 0:01:39

      Average standard deviation of split frequencies: 0.079550

      10500 -- [-395.814] (-384.810) (-391.048) (-398.455) * (-387.846) (-406.062) [-396.371] (-395.427) -- 0:01:34
      11000 -- (-395.874) [-386.284] (-406.181) (-389.862) * (-389.223) (-395.454) [-392.739] (-393.343) -- 0:01:29
      11500 -- [-405.363] (-385.176) (-400.169) (-395.949) * [-387.359] (-390.375) (-397.646) (-402.017) -- 0:01:25
      12000 -- (-399.024) (-386.264) (-397.994) [-396.535] * (-388.918) [-395.424] (-397.802) (-396.556) -- 0:01:22
      12500 -- [-388.266] (-386.183) (-404.651) (-398.895) * (-385.821) (-401.602) (-390.307) [-393.941] -- 0:01:19
      13000 -- (-385.899) (-388.681) (-400.686) [-397.914] * (-385.574) (-393.241) (-391.002) [-394.070] -- 0:01:15
      13500 -- [-388.410] (-385.294) (-397.464) (-397.574) * (-386.964) (-396.084) (-394.686) [-396.504] -- 0:01:13
      14000 -- (-385.170) (-392.998) (-393.771) [-392.809] * [-388.362] (-402.463) (-397.592) (-402.725) -- 0:01:10
      14500 -- [-385.810] (-386.464) (-407.171) (-401.686) * (-386.534) (-393.996) [-394.518] (-398.178) -- 0:01:07
      15000 -- (-387.704) (-388.111) (-397.489) [-402.803] * (-385.554) [-396.298] (-398.046) (-397.088) -- 0:01:05

      Average standard deviation of split frequencies: 0.058926

      15500 -- (-384.901) (-386.328) (-396.746) [-393.153] * [-385.546] (-398.221) (-403.249) (-398.700) -- 0:01:03
      16000 -- [-388.446] (-385.128) (-406.277) (-401.617) * [-387.175] (-404.139) (-390.990) (-411.880) -- 0:01:01
      16500 -- (-388.947) (-387.660) [-390.899] (-396.008) * (-386.506) (-407.742) [-400.545] (-406.167) -- 0:00:59
      17000 -- (-388.379) (-384.969) (-387.940) [-393.074] * (-387.257) (-394.399) [-396.034] (-397.268) -- 0:00:57
      17500 -- (-389.294) (-390.769) (-388.569) [-397.285] * (-384.783) (-403.199) [-398.341] (-390.868) -- 0:00:56
      18000 -- (-386.935) [-385.883] (-386.894) (-398.564) * (-386.353) (-391.899) [-399.763] (-392.125) -- 0:00:54
      18500 -- (-386.598) [-385.550] (-386.775) (-400.859) * (-386.592) [-388.089] (-397.400) (-391.136) -- 0:00:53
      19000 -- (-388.503) (-385.061) (-387.400) [-401.478] * [-386.862] (-390.666) (-401.783) (-388.157) -- 0:00:51
      19500 -- [-388.492] (-387.095) (-387.240) (-402.278) * (-388.105) [-387.398] (-412.205) (-391.806) -- 0:01:40
      20000 -- (-386.740) (-385.639) (-387.063) [-394.489] * (-390.782) [-385.592] (-392.819) (-385.721) -- 0:01:38

      Average standard deviation of split frequencies: 0.045620

      20500 -- (-385.593) (-385.685) (-385.110) [-398.661] * (-384.792) [-387.523] (-386.672) (-388.350) -- 0:01:35
      21000 -- (-387.578) [-385.954] (-386.034) (-405.727) * [-389.778] (-389.632) (-390.909) (-390.487) -- 0:01:33
      21500 -- (-386.911) (-386.012) [-386.814] (-396.834) * [-388.136] (-387.500) (-388.703) (-386.121) -- 0:01:31
      22000 -- (-386.655) [-387.565] (-385.579) (-396.387) * (-389.642) [-386.450] (-386.007) (-386.059) -- 0:01:28
      22500 -- (-392.089) (-385.171) (-386.208) [-397.728] * [-387.674] (-385.476) (-388.477) (-388.566) -- 0:01:26
      23000 -- (-388.432) (-389.533) (-387.975) [-392.144] * (-384.834) (-386.565) [-388.335] (-385.890) -- 0:01:24
      23500 -- (-387.535) (-386.222) (-385.447) [-397.216] * [-386.093] (-386.730) (-386.519) (-386.304) -- 0:01:23
      24000 -- (-385.796) (-388.536) [-389.317] (-397.880) * (-385.662) (-386.347) [-385.919] (-386.757) -- 0:01:21
      24500 -- (-389.950) [-388.361] (-389.609) (-406.575) * (-386.962) [-388.209] (-386.137) (-385.939) -- 0:01:19
      25000 -- (-388.093) [-386.988] (-387.192) (-395.177) * (-385.800) (-390.381) [-386.396] (-386.659) -- 0:01:18

      Average standard deviation of split frequencies: 0.036262

      25500 -- (-386.179) (-385.823) [-386.275] (-402.522) * [-385.570] (-389.041) (-385.589) (-388.932) -- 0:01:16
      26000 -- (-385.950) (-389.717) [-386.129] (-398.991) * [-387.686] (-385.752) (-387.642) (-389.136) -- 0:01:14
      26500 -- (-385.337) (-389.039) (-386.138) [-394.095] * (-395.557) [-387.936] (-389.158) (-387.858) -- 0:01:13
      27000 -- (-386.852) (-387.148) [-386.353] (-402.930) * (-387.922) (-387.754) [-386.941] (-388.514) -- 0:01:12
      27500 -- (-386.416) [-386.202] (-388.397) (-400.108) * [-387.516] (-392.382) (-386.020) (-385.210) -- 0:01:10
      28000 -- (-388.542) [-386.681] (-385.108) (-397.432) * [-387.819] (-388.649) (-388.451) (-386.690) -- 0:01:09
      28500 -- (-385.570) [-390.012] (-387.431) (-392.425) * (-386.904) (-385.117) (-389.389) [-385.939] -- 0:01:08
      29000 -- (-395.203) (-388.339) (-394.056) [-393.027] * (-385.867) (-385.124) (-389.042) [-386.424] -- 0:01:06
      29500 -- (-392.220) [-388.035] (-387.330) (-405.558) * (-387.117) [-385.698] (-388.624) (-384.881) -- 0:01:05
      30000 -- (-388.209) [-386.383] (-386.879) (-395.117) * (-388.087) (-385.492) (-386.532) [-388.780] -- 0:01:04

      Average standard deviation of split frequencies: 0.035355

      30500 -- (-390.858) (-387.107) [-385.961] (-387.478) * (-390.734) [-388.231] (-389.913) (-386.963) -- 0:01:35
      31000 -- [-385.878] (-388.236) (-390.583) (-389.743) * (-388.292) (-391.706) [-385.064] (-387.470) -- 0:01:33
      31500 -- [-385.943] (-389.499) (-386.662) (-391.586) * (-386.456) [-387.462] (-386.294) (-386.910) -- 0:01:32
      32000 -- [-390.878] (-388.845) (-388.416) (-387.576) * (-385.544) (-386.404) [-385.491] (-390.815) -- 0:01:30
      32500 -- [-388.317] (-387.858) (-387.436) (-389.453) * (-387.379) [-387.204] (-390.104) (-387.465) -- 0:01:29
      33000 -- (-386.424) (-388.348) (-388.914) [-386.238] * (-391.867) (-387.396) [-389.501] (-387.105) -- 0:01:27
      33500 -- (-392.215) [-386.458] (-386.407) (-387.417) * (-392.664) (-387.334) [-389.140] (-388.940) -- 0:01:26
      34000 -- (-385.800) (-385.539) [-387.026] (-387.060) * (-385.751) [-386.725] (-390.754) (-385.033) -- 0:01:25
      34500 -- (-385.926) (-386.643) (-387.101) [-385.583] * (-385.899) (-386.645) [-388.614] (-385.251) -- 0:01:23
      35000 -- (-388.046) (-385.538) (-387.877) [-385.849] * (-388.454) (-391.757) (-390.881) [-387.349] -- 0:01:22

      Average standard deviation of split frequencies: 0.039284

      35500 -- [-386.463] (-385.999) (-389.436) (-385.684) * (-388.714) (-387.419) (-385.712) [-387.984] -- 0:01:21
      36000 -- [-385.478] (-386.427) (-391.159) (-389.605) * (-387.637) (-390.305) [-386.575] (-387.873) -- 0:01:20
      36500 -- (-387.493) [-388.112] (-386.359) (-387.217) * (-387.232) [-389.582] (-386.968) (-386.270) -- 0:01:19
      37000 -- (-388.788) (-385.562) [-384.946] (-385.542) * (-387.039) (-389.611) (-387.222) [-387.005] -- 0:01:18
      37500 -- (-390.724) [-387.837] (-385.798) (-387.814) * (-385.396) [-388.658] (-386.930) (-388.531) -- 0:01:17
      38000 -- [-386.364] (-386.500) (-386.606) (-385.517) * (-387.179) (-386.348) [-387.830] (-387.862) -- 0:01:15
      38500 -- (-387.308) [-385.389] (-386.518) (-388.957) * (-387.396) (-385.976) (-387.742) [-388.771] -- 0:01:14
      39000 -- (-387.077) (-387.695) (-392.659) [-394.221] * [-386.983] (-387.286) (-388.113) (-388.214) -- 0:01:13
      39500 -- (-391.426) (-387.021) (-387.447) [-389.632] * (-386.726) (-389.430) (-386.602) [-388.798] -- 0:01:12
      40000 -- (-390.588) (-386.048) [-385.111] (-389.449) * (-385.392) [-387.653] (-385.030) (-386.627) -- 0:01:12

      Average standard deviation of split frequencies: 0.034776

      40500 -- (-388.311) (-387.061) [-388.640] (-388.953) * (-390.010) [-387.423] (-385.995) (-387.048) -- 0:01:11
      41000 -- (-390.496) (-386.819) (-388.229) [-386.283] * [-387.857] (-387.019) (-386.449) (-385.351) -- 0:01:10
      41500 -- (-387.833) (-387.939) (-385.932) [-385.609] * (-385.432) (-388.287) [-385.763] (-392.594) -- 0:01:32
      42000 -- [-388.593] (-386.499) (-388.655) (-385.614) * (-387.784) [-387.928] (-384.859) (-388.929) -- 0:01:31
      42500 -- (-385.601) (-388.948) [-385.515] (-386.070) * (-387.943) [-386.281] (-385.719) (-386.340) -- 0:01:30
      43000 -- (-384.943) (-390.240) [-388.459] (-389.049) * (-387.260) (-387.163) [-388.114] (-386.080) -- 0:01:29
      43500 -- (-386.617) [-391.465] (-386.640) (-390.866) * (-388.561) [-386.369] (-389.427) (-390.358) -- 0:01:27
      44000 -- [-390.372] (-392.201) (-390.579) (-385.284) * (-386.211) (-385.899) [-387.451] (-390.263) -- 0:01:26
      44500 -- [-386.681] (-385.736) (-386.118) (-389.125) * (-389.505) (-386.471) [-387.919] (-387.358) -- 0:01:25
      45000 -- (-387.122) (-386.404) [-386.939] (-386.681) * (-386.573) (-386.008) [-385.939] (-387.661) -- 0:01:24

      Average standard deviation of split frequencies: 0.025620

      45500 -- [-385.372] (-385.575) (-389.695) (-385.223) * (-390.351) [-385.363] (-388.034) (-389.900) -- 0:01:23
      46000 -- (-387.368) (-386.529) (-388.565) [-386.667] * [-385.709] (-386.133) (-388.136) (-387.616) -- 0:01:22
      46500 -- [-386.735] (-386.051) (-390.419) (-387.404) * (-387.338) (-386.097) [-386.563] (-388.841) -- 0:01:22
      47000 -- [-386.149] (-385.559) (-387.245) (-388.158) * [-386.033] (-386.903) (-386.449) (-388.946) -- 0:01:21
      47500 -- (-392.424) (-386.402) [-388.518] (-388.880) * (-390.229) (-387.048) [-388.096] (-388.096) -- 0:01:20
      48000 -- (-392.264) [-385.152] (-385.891) (-389.067) * [-386.269] (-387.078) (-385.410) (-386.902) -- 0:01:19
      48500 -- (-387.895) (-389.112) [-385.035] (-388.510) * [-390.074] (-388.514) (-385.995) (-389.263) -- 0:01:18
      49000 -- (-388.212) (-387.756) (-386.401) [-387.958] * [-386.939] (-387.973) (-389.785) (-391.593) -- 0:01:17
      49500 -- [-386.159] (-388.567) (-387.494) (-386.992) * [-386.339] (-386.839) (-387.315) (-387.427) -- 0:01:16
      50000 -- (-385.799) (-391.387) [-388.537] (-388.726) * [-386.322] (-387.054) (-387.069) (-386.325) -- 0:01:16

      Average standard deviation of split frequencies: 0.024294

      50500 -- [-387.794] (-390.169) (-387.860) (-386.588) * (-386.543) (-386.950) [-387.301] (-387.906) -- 0:01:15
      51000 -- (-386.356) (-385.272) [-387.329] (-386.457) * (-386.027) (-388.199) (-385.824) [-386.463] -- 0:01:14
      51500 -- [-386.208] (-385.137) (-388.433) (-390.514) * [-387.641] (-388.276) (-385.209) (-385.390) -- 0:01:13
      52000 -- (-389.408) (-384.939) [-386.155] (-389.047) * [-391.598] (-386.005) (-387.373) (-385.321) -- 0:01:12
      52500 -- (-389.138) [-386.649] (-387.566) (-385.222) * (-385.483) (-388.400) (-390.360) [-386.340] -- 0:01:12
      53000 -- (-388.607) (-387.100) (-389.633) [-388.884] * (-385.942) (-388.089) [-387.700] (-388.698) -- 0:01:11
      53500 -- (-386.407) (-385.412) (-388.330) [-385.704] * (-386.031) [-390.304] (-392.228) (-386.701) -- 0:01:10
      54000 -- (-384.798) [-385.439] (-392.197) (-386.044) * (-391.546) (-389.592) (-391.467) [-389.031] -- 0:01:10
      54500 -- [-386.262] (-387.223) (-389.372) (-386.115) * (-388.690) [-385.538] (-387.145) (-388.327) -- 0:01:26
      55000 -- [-386.283] (-387.931) (-389.521) (-387.571) * (-386.297) [-389.008] (-388.177) (-386.175) -- 0:01:25

      Average standard deviation of split frequencies: 0.022849

      55500 -- [-388.057] (-394.936) (-385.986) (-387.761) * (-386.279) (-385.855) (-386.680) [-385.196] -- 0:01:25
      56000 -- [-386.093] (-393.986) (-388.448) (-389.439) * (-387.761) (-389.792) [-388.256] (-385.479) -- 0:01:24
      56500 -- [-387.475] (-388.103) (-392.103) (-386.882) * [-385.816] (-387.003) (-385.791) (-387.634) -- 0:01:23
      57000 -- (-389.446) [-387.036] (-387.220) (-386.142) * (-386.314) (-391.886) [-384.932] (-386.790) -- 0:01:22
      57500 -- (-385.766) [-387.357] (-386.653) (-390.520) * (-386.711) (-392.862) (-391.543) [-385.119] -- 0:01:21
      58000 -- (-385.391) (-387.648) (-389.583) [-385.478] * (-388.140) (-386.179) [-389.015] (-387.868) -- 0:01:21
      58500 -- (-385.755) (-386.601) (-390.910) [-385.724] * [-386.729] (-387.629) (-385.075) (-385.608) -- 0:01:20
      59000 -- (-386.495) (-387.442) [-385.490] (-392.301) * [-386.099] (-385.934) (-387.109) (-385.572) -- 0:01:19
      59500 -- (-386.351) [-386.630] (-390.356) (-386.634) * (-387.316) (-387.334) [-386.461] (-385.914) -- 0:01:19
      60000 -- (-388.859) (-386.653) (-392.921) [-385.657] * (-386.447) [-388.540] (-386.750) (-385.550) -- 0:01:18

      Average standard deviation of split frequencies: 0.018404

      60500 -- (-385.709) (-389.702) (-387.194) [-387.056] * (-386.220) (-387.871) [-385.359] (-390.690) -- 0:01:17
      61000 -- [-386.407] (-390.045) (-389.707) (-386.124) * (-385.688) (-392.781) (-385.533) [-388.101] -- 0:01:16
      61500 -- (-385.697) (-388.710) [-389.768] (-386.422) * (-386.629) (-387.495) [-385.953] (-386.739) -- 0:01:16
      62000 -- (-386.820) [-384.862] (-385.688) (-388.429) * [-386.526] (-387.934) (-386.562) (-385.821) -- 0:01:15
      62500 -- (-389.894) (-388.067) (-387.226) [-387.081] * [-385.071] (-387.047) (-386.092) (-387.647) -- 0:01:15
      63000 -- (-391.227) (-387.856) [-388.420] (-386.883) * [-388.899] (-387.318) (-387.159) (-385.277) -- 0:01:14
      63500 -- [-386.262] (-386.909) (-388.431) (-387.501) * (-385.633) (-387.933) (-387.317) [-386.169] -- 0:01:13
      64000 -- (-385.024) (-387.161) [-388.341] (-385.712) * (-387.221) (-387.038) (-386.275) [-385.714] -- 0:01:13
      64500 -- [-386.587] (-387.188) (-387.539) (-386.175) * (-385.555) (-386.789) [-385.743] (-387.575) -- 0:01:12
      65000 -- (-389.825) (-387.050) [-387.060] (-385.635) * [-385.650] (-386.718) (-385.325) (-387.464) -- 0:01:11

      Average standard deviation of split frequencies: 0.015079

      65500 -- (-385.939) (-390.915) (-390.356) [-388.228] * [-385.057] (-387.154) (-386.376) (-385.141) -- 0:01:11
      66000 -- (-387.066) (-390.407) (-387.065) [-384.928] * [-387.998] (-386.811) (-387.145) (-390.255) -- 0:01:10
      66500 -- (-387.505) (-391.756) [-387.840] (-390.942) * (-387.079) (-386.050) [-386.614] (-389.870) -- 0:01:10
      67000 -- (-388.459) (-387.222) (-386.149) [-387.289] * (-385.561) (-385.761) (-387.476) [-386.471] -- 0:01:09
      67500 -- (-385.883) (-387.445) (-385.851) [-387.709] * (-392.777) (-386.471) [-388.731] (-391.909) -- 0:01:09
      68000 -- [-390.770] (-391.658) (-395.290) (-386.868) * (-386.253) [-386.799] (-387.440) (-385.642) -- 0:01:08
      68500 -- (-389.858) (-386.742) (-391.478) [-387.540] * (-385.412) (-390.118) (-388.299) [-386.333] -- 0:01:21
      69000 -- (-388.220) [-387.156] (-390.392) (-388.975) * (-388.589) (-388.503) (-389.771) [-386.415] -- 0:01:20
      69500 -- [-386.601] (-385.595) (-387.443) (-386.318) * [-387.230] (-387.494) (-393.175) (-386.619) -- 0:01:20
      70000 -- (-385.103) (-385.589) (-388.441) [-388.221] * (-386.544) (-387.060) [-389.465] (-392.340) -- 0:01:19

      Average standard deviation of split frequencies: 0.013342

      70500 -- (-385.073) (-385.712) [-386.159] (-386.310) * [-385.707] (-387.056) (-386.966) (-388.294) -- 0:01:19
      71000 -- (-388.923) (-385.752) [-385.745] (-387.105) * (-388.134) (-387.467) [-385.507] (-386.413) -- 0:01:18
      71500 -- [-386.839] (-386.817) (-385.749) (-389.592) * [-387.333] (-394.525) (-385.728) (-385.252) -- 0:01:17
      72000 -- (-388.707) [-386.446] (-385.943) (-387.614) * (-386.655) (-385.634) (-385.755) [-390.366] -- 0:01:17
      72500 -- (-390.248) (-386.107) [-386.056] (-386.771) * (-385.898) (-388.666) [-388.461] (-390.425) -- 0:01:16
      73000 -- (-387.372) [-388.953] (-386.993) (-385.864) * [-386.366] (-389.753) (-385.637) (-387.922) -- 0:01:16
      73500 -- [-386.705] (-386.421) (-386.333) (-386.658) * [-385.741] (-385.095) (-385.667) (-387.552) -- 0:01:15
      74000 -- (-387.561) [-388.203] (-386.471) (-386.920) * (-386.960) [-386.408] (-385.418) (-386.321) -- 0:01:15
      74500 -- (-389.100) [-385.597] (-387.500) (-388.123) * (-387.794) (-385.771) [-387.113] (-386.264) -- 0:01:14
      75000 -- (-386.187) [-386.674] (-388.912) (-385.708) * (-386.123) (-387.472) (-387.286) [-386.564] -- 0:01:14

      Average standard deviation of split frequencies: 0.015507

      75500 -- (-384.778) (-385.411) [-387.406] (-387.188) * (-387.636) (-387.610) [-387.230] (-391.012) -- 0:01:13
      76000 -- (-387.089) [-385.978] (-389.016) (-387.287) * (-390.606) [-385.936] (-389.224) (-389.593) -- 0:01:12
      76500 -- (-387.089) (-386.481) [-391.469] (-386.718) * (-389.221) [-388.068] (-388.055) (-390.551) -- 0:01:12
      77000 -- (-385.903) (-388.644) [-385.913] (-386.886) * (-386.750) [-386.234] (-387.123) (-386.836) -- 0:01:11
      77500 -- (-385.933) (-388.018) (-391.498) [-388.888] * (-385.922) [-387.443] (-391.284) (-386.265) -- 0:01:11
      78000 -- (-386.548) (-389.207) (-387.354) [-385.931] * (-389.166) [-386.150] (-388.634) (-388.701) -- 0:01:10
      78500 -- (-388.490) (-388.725) (-387.911) [-386.870] * (-387.890) (-385.592) [-388.298] (-387.005) -- 0:01:10
      79000 -- [-385.075] (-385.571) (-385.227) (-386.812) * (-387.523) (-385.960) [-388.128] (-386.378) -- 0:01:09
      79500 -- (-390.739) (-385.362) [-385.554] (-387.118) * (-388.231) [-386.935] (-386.340) (-385.368) -- 0:01:09
      80000 -- (-387.293) (-389.890) [-387.290] (-386.221) * (-389.486) (-385.520) [-385.474] (-385.197) -- 0:01:09

      Average standard deviation of split frequencies: 0.015340

      80500 -- [-385.827] (-385.974) (-386.649) (-390.403) * (-384.871) [-386.519] (-385.585) (-385.854) -- 0:01:08
      81000 -- (-384.875) (-388.729) [-386.242] (-389.778) * (-385.464) [-385.563] (-385.432) (-386.392) -- 0:01:08
      81500 -- (-385.013) (-386.245) (-385.539) [-388.585] * (-385.144) [-388.825] (-387.169) (-388.494) -- 0:01:07
      82000 -- (-386.254) (-385.374) [-388.191] (-387.220) * [-385.040] (-385.450) (-386.879) (-386.522) -- 0:01:18
      82500 -- (-386.736) (-385.637) [-387.660] (-385.076) * (-390.484) [-386.804] (-387.902) (-387.107) -- 0:01:17
      83000 -- (-386.092) [-386.172] (-386.533) (-385.824) * (-387.744) (-388.212) [-387.347] (-385.673) -- 0:01:17
      83500 -- (-392.771) (-386.158) (-388.031) [-389.915] * (-388.865) (-386.007) [-384.841] (-387.295) -- 0:01:16
      84000 -- (-387.011) [-388.730] (-395.081) (-390.441) * (-387.478) (-387.271) [-384.799] (-387.093) -- 0:01:16
      84500 -- [-384.903] (-386.405) (-385.176) (-388.259) * (-385.476) (-386.702) (-385.579) [-385.380] -- 0:01:15
      85000 -- (-386.499) [-390.079] (-386.102) (-389.003) * (-385.410) (-388.880) [-388.032] (-387.982) -- 0:01:15

      Average standard deviation of split frequencies: 0.016733

      85500 -- (-386.812) [-386.824] (-387.308) (-387.348) * [-385.784] (-385.191) (-387.861) (-390.350) -- 0:01:14
      86000 -- (-386.891) (-385.288) [-388.413] (-389.534) * (-388.749) (-387.849) [-386.736] (-389.901) -- 0:01:14
      86500 -- (-385.598) (-390.985) [-391.573] (-386.387) * [-388.374] (-387.044) (-386.966) (-388.516) -- 0:01:13
      87000 -- [-386.408] (-387.413) (-387.221) (-387.454) * (-388.056) [-385.092] (-388.163) (-386.715) -- 0:01:13
      87500 -- [-385.344] (-387.037) (-385.009) (-385.552) * (-389.317) (-384.999) [-388.240] (-388.705) -- 0:01:13
      88000 -- (-387.167) (-386.913) [-390.366] (-385.614) * (-386.531) (-384.873) [-386.986] (-385.073) -- 0:01:12
      88500 -- (-386.605) (-386.295) (-388.534) [-388.532] * (-388.820) (-385.919) [-386.282] (-387.401) -- 0:01:12
      89000 -- (-387.209) (-391.322) (-387.819) [-386.841] * (-385.690) (-385.856) (-387.392) [-387.601] -- 0:01:11
      89500 -- (-387.351) (-388.942) (-389.176) [-386.051] * (-386.071) (-386.123) [-389.131] (-385.893) -- 0:01:11
      90000 -- (-387.186) (-388.950) (-390.176) [-385.703] * (-385.143) (-385.776) (-388.468) [-384.931] -- 0:01:10

      Average standard deviation of split frequencies: 0.015020

      90500 -- (-390.386) (-386.561) (-388.902) [-384.931] * (-385.048) (-387.012) [-387.893] (-388.404) -- 0:01:10
      91000 -- (-389.463) (-386.634) (-387.637) [-389.143] * (-387.667) (-390.217) [-386.687] (-386.847) -- 0:01:09
      91500 -- (-388.251) (-391.658) (-385.671) [-388.779] * (-385.539) (-388.108) (-386.211) [-386.381] -- 0:01:09
      92000 -- [-385.590] (-386.465) (-386.685) (-387.627) * (-388.505) [-387.786] (-385.731) (-385.260) -- 0:01:09
      92500 -- (-386.652) (-385.080) (-387.067) [-388.322] * (-386.050) [-390.686] (-387.754) (-385.499) -- 0:01:08
      93000 -- (-387.123) (-385.302) (-385.628) [-387.152] * (-386.094) (-388.107) [-386.430] (-387.317) -- 0:01:08
      93500 -- (-385.422) [-386.529] (-386.272) (-389.677) * (-386.449) (-386.630) [-385.470] (-387.462) -- 0:01:07
      94000 -- (-384.901) (-387.363) [-385.941] (-390.408) * (-389.248) [-385.168] (-388.262) (-387.767) -- 0:01:07
      94500 -- [-386.694] (-386.357) (-388.266) (-387.333) * (-388.576) (-386.580) [-387.211] (-391.002) -- 0:01:07
      95000 -- [-386.976] (-390.553) (-387.716) (-390.060) * (-386.543) (-386.530) [-387.033] (-387.354) -- 0:01:06

      Average standard deviation of split frequencies: 0.014186

      95500 -- (-388.565) [-387.440] (-387.442) (-388.754) * (-386.594) [-387.180] (-387.392) (-386.683) -- 0:01:06
      96000 -- (-388.279) [-387.207] (-385.080) (-385.661) * (-386.826) [-387.012] (-385.524) (-386.978) -- 0:01:15
      96500 -- (-395.303) (-385.442) (-385.656) [-386.950] * (-386.233) (-388.688) (-385.916) [-384.605] -- 0:01:14
      97000 -- [-386.261] (-386.898) (-388.444) (-388.167) * (-387.004) (-384.888) [-386.463] (-385.965) -- 0:01:14
      97500 -- (-385.833) (-385.864) [-390.052] (-387.221) * (-388.505) (-388.255) [-387.037] (-385.666) -- 0:01:14
      98000 -- (-386.695) (-385.694) (-386.547) [-387.609] * (-390.265) (-387.608) [-385.874] (-386.397) -- 0:01:13
      98500 -- (-391.191) (-389.344) (-386.085) [-386.085] * (-389.032) (-388.225) (-392.136) [-386.403] -- 0:01:13
      99000 -- (-385.885) (-388.780) (-386.584) [-386.386] * (-389.546) [-385.026] (-389.545) (-390.775) -- 0:01:12
      99500 -- [-386.382] (-388.206) (-386.422) (-386.007) * (-385.563) [-385.516] (-387.789) (-387.372) -- 0:01:12
      100000 -- [-388.608] (-389.020) (-388.426) (-385.924) * (-386.855) [-387.443] (-386.954) (-387.017) -- 0:01:12

      Average standard deviation of split frequencies: 0.014569

      100500 -- (-386.115) (-392.259) (-386.445) [-385.078] * (-387.361) (-386.576) (-387.398) [-390.133] -- 0:01:11
      101000 -- [-385.224] (-388.181) (-386.280) (-387.417) * (-388.793) (-386.372) (-386.382) [-388.678] -- 0:01:11
      101500 -- (-386.391) [-385.757] (-387.294) (-384.995) * (-389.570) [-385.590] (-384.907) (-387.550) -- 0:01:10
      102000 -- (-386.345) [-387.110] (-387.142) (-385.680) * [-385.920] (-386.454) (-387.639) (-389.375) -- 0:01:10
      102500 -- (-384.816) (-387.222) [-387.114] (-387.449) * (-385.895) (-388.147) (-386.964) [-386.028] -- 0:01:10
      103000 -- (-385.141) (-389.026) [-388.613] (-386.125) * (-386.978) (-387.353) [-385.944] (-387.174) -- 0:01:09
      103500 -- (-386.012) (-386.147) [-385.470] (-388.669) * (-387.122) (-387.294) (-385.456) [-386.611] -- 0:01:09
      104000 -- [-386.021] (-386.770) (-385.935) (-387.023) * (-387.391) (-390.263) [-386.371] (-391.937) -- 0:01:08
      104500 -- (-389.182) (-386.236) [-386.443] (-387.720) * (-384.971) (-390.090) [-387.426] (-386.484) -- 0:01:08
      105000 -- (-388.203) [-387.939] (-387.311) (-387.727) * (-385.861) (-392.907) [-385.548] (-389.675) -- 0:01:08

      Average standard deviation of split frequencies: 0.013108

      105500 -- (-385.508) (-388.727) [-388.863] (-387.029) * (-387.537) (-384.793) [-387.523] (-386.538) -- 0:01:07
      106000 -- (-387.021) (-392.488) [-387.186] (-387.340) * (-386.769) (-384.875) (-387.122) [-385.588] -- 0:01:07
      106500 -- (-385.523) (-386.339) (-386.101) [-387.485] * (-388.185) (-387.170) [-385.211] (-385.182) -- 0:01:07
      107000 -- (-387.288) (-386.568) [-388.865] (-385.154) * (-389.732) [-386.827] (-386.592) (-385.615) -- 0:01:06
      107500 -- (-386.983) [-386.767] (-390.740) (-386.212) * (-388.676) (-388.304) [-389.247] (-387.060) -- 0:01:06
      108000 -- (-386.585) (-386.429) (-388.738) [-385.882] * (-387.470) [-386.901] (-387.623) (-386.337) -- 0:01:06
      108500 -- [-386.713] (-386.205) (-386.821) (-385.582) * (-389.348) (-389.059) [-387.360] (-388.081) -- 0:01:05
      109000 -- (-385.907) [-385.425] (-390.053) (-384.778) * (-386.268) [-388.161] (-386.368) (-387.472) -- 0:01:05
      109500 -- (-387.894) (-385.173) [-388.751] (-385.758) * (-386.468) (-386.380) [-386.088] (-385.075) -- 0:01:13
      110000 -- (-388.406) [-385.678] (-388.741) (-388.542) * (-388.735) (-385.166) [-387.197] (-388.183) -- 0:01:12

      Average standard deviation of split frequencies: 0.013676

      110500 -- (-386.957) [-388.580] (-387.079) (-387.413) * (-388.702) (-390.770) (-386.987) [-385.479] -- 0:01:12
      111000 -- (-388.366) [-387.479] (-388.994) (-387.927) * (-395.218) [-386.105] (-385.522) (-385.801) -- 0:01:12
      111500 -- (-388.055) (-389.764) [-387.275] (-386.737) * (-387.079) [-387.928] (-386.063) (-386.046) -- 0:01:11
      112000 -- (-389.169) [-387.784] (-387.491) (-389.288) * [-389.013] (-387.459) (-388.059) (-387.046) -- 0:01:11
      112500 -- (-388.963) (-387.400) (-385.790) [-391.011] * (-388.208) (-385.640) [-387.027] (-387.312) -- 0:01:11
      113000 -- (-386.915) [-387.274] (-387.547) (-393.586) * (-386.365) (-393.645) (-389.171) [-385.625] -- 0:01:10
      113500 -- (-392.820) (-391.787) [-386.260] (-387.927) * (-387.035) [-387.676] (-387.292) (-390.423) -- 0:01:10
      114000 -- (-387.626) [-391.038] (-389.690) (-389.860) * (-388.493) [-386.190] (-387.789) (-388.210) -- 0:01:09
      114500 -- (-386.557) [-388.896] (-388.458) (-389.444) * (-386.404) [-386.261] (-387.699) (-386.318) -- 0:01:09
      115000 -- (-388.442) (-385.363) (-386.942) [-386.221] * [-386.870] (-388.691) (-386.484) (-388.856) -- 0:01:09

      Average standard deviation of split frequencies: 0.013095

      115500 -- (-385.891) (-388.383) (-394.130) [-386.536] * [-386.532] (-385.587) (-385.950) (-385.947) -- 0:01:08
      116000 -- (-387.635) (-386.547) (-392.487) [-385.312] * (-385.862) (-388.382) [-385.258] (-386.395) -- 0:01:08
      116500 -- (-385.662) [-385.884] (-386.898) (-386.929) * (-390.481) (-387.335) (-386.106) [-387.252] -- 0:01:08
      117000 -- (-389.263) (-385.665) (-389.294) [-386.907] * [-386.681] (-385.528) (-393.583) (-385.278) -- 0:01:07
      117500 -- (-389.589) (-387.927) (-386.098) [-390.197] * [-386.969] (-386.578) (-386.005) (-389.547) -- 0:01:07
      118000 -- (-388.786) [-388.730] (-387.659) (-387.508) * (-388.016) [-386.086] (-387.538) (-386.266) -- 0:01:07
      118500 -- [-385.708] (-385.710) (-389.201) (-386.541) * (-386.973) (-387.234) (-387.072) [-386.277] -- 0:01:06
      119000 -- [-386.282] (-385.928) (-389.303) (-388.116) * (-386.057) [-385.913] (-386.678) (-386.892) -- 0:01:06
      119500 -- (-385.939) [-385.415] (-387.508) (-386.198) * (-387.496) [-385.930] (-387.047) (-387.953) -- 0:01:06
      120000 -- (-385.175) (-388.145) (-387.498) [-386.251] * (-386.819) [-386.090] (-386.931) (-385.324) -- 0:01:06

      Average standard deviation of split frequencies: 0.015627

      120500 -- (-385.794) (-388.104) (-386.923) [-387.075] * (-396.278) (-389.762) [-389.050] (-385.784) -- 0:01:05
      121000 -- (-386.873) (-385.383) (-385.268) [-389.313] * [-386.076] (-385.987) (-386.558) (-387.174) -- 0:01:05
      121500 -- (-385.263) [-386.041] (-388.436) (-389.547) * [-386.221] (-386.929) (-387.069) (-392.775) -- 0:01:05
      122000 -- [-385.420] (-385.629) (-387.827) (-391.378) * (-385.345) [-385.944] (-390.060) (-390.823) -- 0:01:04
      122500 -- [-386.921] (-385.942) (-386.345) (-388.096) * (-386.887) (-388.029) (-391.074) [-386.886] -- 0:01:04
      123000 -- (-387.820) (-386.857) (-388.475) [-386.183] * (-387.014) (-385.998) [-387.044] (-387.847) -- 0:01:04
      123500 -- (-387.163) (-385.422) [-386.240] (-385.127) * (-388.217) (-385.804) [-388.672] (-388.663) -- 0:01:03
      124000 -- (-387.954) (-386.810) [-388.501] (-389.960) * [-386.812] (-385.100) (-388.459) (-390.133) -- 0:01:10
      124500 -- (-387.222) (-386.442) [-386.446] (-389.160) * (-387.084) (-387.117) [-386.278] (-385.927) -- 0:01:10
      125000 -- (-386.208) (-387.831) (-386.756) [-388.393] * (-387.195) (-385.044) [-385.461] (-388.204) -- 0:01:10

      Average standard deviation of split frequencies: 0.012996

      125500 -- (-386.953) (-386.476) [-385.600] (-386.064) * (-389.038) (-385.899) [-385.149] (-385.596) -- 0:01:09
      126000 -- (-385.907) (-387.216) [-387.820] (-385.184) * (-388.533) [-387.935] (-388.365) (-386.070) -- 0:01:09
      126500 -- (-387.248) [-388.308] (-385.626) (-386.589) * (-386.270) (-390.565) (-386.614) [-386.756] -- 0:01:09
      127000 -- [-387.218] (-386.997) (-387.583) (-387.560) * (-386.365) (-385.662) (-386.686) [-386.945] -- 0:01:08
      127500 -- (-385.814) [-389.324] (-388.870) (-387.546) * (-384.985) (-387.451) [-389.358] (-387.799) -- 0:01:08
      128000 -- (-386.129) (-386.817) (-387.384) [-386.804] * (-385.082) (-388.821) [-387.437] (-387.419) -- 0:01:08
      128500 -- (-387.766) (-386.019) [-387.192] (-387.072) * [-384.680] (-385.474) (-393.795) (-387.346) -- 0:01:07
      129000 -- (-385.537) (-387.059) [-386.052] (-386.036) * [-386.441] (-385.512) (-388.472) (-386.692) -- 0:01:07
      129500 -- [-386.611] (-387.966) (-385.609) (-388.513) * (-387.058) (-387.586) (-387.242) [-384.987] -- 0:01:07
      130000 -- (-386.495) (-388.153) (-385.723) [-385.732] * [-389.540] (-385.201) (-387.167) (-388.148) -- 0:01:06

      Average standard deviation of split frequencies: 0.016140

      130500 -- (-387.252) (-385.798) (-384.982) [-392.977] * (-386.866) (-385.403) [-387.576] (-387.662) -- 0:01:06
      131000 -- (-385.892) [-385.947] (-385.433) (-386.417) * (-387.210) (-385.467) (-386.795) [-387.162] -- 0:01:06
      131500 -- [-386.549] (-385.468) (-386.395) (-391.820) * (-386.133) (-387.462) (-387.815) [-385.503] -- 0:01:06
      132000 -- (-386.055) [-385.742] (-388.189) (-388.571) * (-388.400) [-387.783] (-388.021) (-385.856) -- 0:01:05
      132500 -- (-385.373) (-386.375) (-390.106) [-386.491] * (-388.184) (-388.728) (-389.152) [-387.040] -- 0:01:05
      133000 -- (-386.045) (-386.658) [-387.369] (-386.013) * (-385.189) (-386.364) [-388.123] (-388.129) -- 0:01:05
      133500 -- (-386.683) [-388.167] (-386.035) (-387.686) * (-386.412) (-389.505) (-388.549) [-385.569] -- 0:01:04
      134000 -- (-385.305) (-386.699) [-386.201] (-391.291) * (-386.877) (-386.655) [-386.681] (-386.948) -- 0:01:04
      134500 -- (-386.866) (-386.590) [-386.043] (-387.669) * (-385.860) (-388.018) [-386.209] (-387.850) -- 0:01:04
      135000 -- (-384.936) (-387.985) [-386.257] (-388.580) * (-386.199) (-387.027) (-390.638) [-386.010] -- 0:01:04

      Average standard deviation of split frequencies: 0.014412

      135500 -- [-388.046] (-388.542) (-389.312) (-391.732) * (-385.067) (-388.529) (-387.055) [-385.770] -- 0:01:03
      136000 -- (-387.562) (-385.177) [-385.969] (-391.009) * (-384.871) [-386.839] (-390.203) (-387.060) -- 0:01:03
      136500 -- [-386.397] (-386.296) (-385.687) (-385.573) * (-386.835) (-385.825) [-390.159] (-388.802) -- 0:01:03
      137000 -- (-387.193) [-384.888] (-386.559) (-388.511) * [-386.589] (-387.696) (-386.179) (-385.777) -- 0:01:02
      137500 -- (-388.306) [-385.052] (-385.724) (-387.807) * (-389.649) (-391.527) (-387.634) [-389.424] -- 0:01:02
      138000 -- (-387.187) [-389.368] (-385.864) (-385.498) * [-385.130] (-385.911) (-388.609) (-387.164) -- 0:01:08
      138500 -- (-385.464) (-389.322) (-385.861) [-386.313] * (-387.116) (-386.638) (-385.036) [-387.188] -- 0:01:08
      139000 -- (-388.861) [-387.908] (-387.702) (-392.281) * (-385.511) [-391.746] (-387.036) (-393.264) -- 0:01:08
      139500 -- (-390.493) (-388.264) [-386.604] (-388.196) * (-386.177) [-386.642] (-386.226) (-391.910) -- 0:01:07
      140000 -- (-388.393) [-385.532] (-386.571) (-388.787) * (-385.380) (-386.648) [-387.379] (-385.725) -- 0:01:07

      Average standard deviation of split frequencies: 0.015709

      140500 -- (-385.355) [-385.485] (-386.549) (-386.886) * (-388.173) (-386.204) [-386.574] (-385.549) -- 0:01:07
      141000 -- (-386.092) (-386.680) (-387.060) [-387.279] * (-393.003) [-386.564] (-386.575) (-388.765) -- 0:01:07
      141500 -- (-386.425) (-386.177) [-387.437] (-387.498) * (-392.760) (-386.055) [-387.036] (-386.317) -- 0:01:06
      142000 -- (-387.802) [-386.861] (-385.443) (-388.538) * (-390.101) (-387.409) [-385.491] (-386.034) -- 0:01:06
      142500 -- [-386.711] (-387.430) (-387.802) (-391.043) * [-387.736] (-388.220) (-386.466) (-388.378) -- 0:01:06
      143000 -- [-385.109] (-389.243) (-387.225) (-389.507) * [-388.757] (-385.379) (-387.289) (-389.596) -- 0:01:05
      143500 -- (-385.346) (-387.770) (-384.928) [-390.389] * (-389.733) (-390.029) (-387.521) [-387.474] -- 0:01:05
      144000 -- (-386.746) (-389.062) (-385.224) [-388.562] * (-390.065) (-387.953) [-389.130] (-386.598) -- 0:01:05
      144500 -- [-387.522] (-386.836) (-387.557) (-393.785) * (-386.904) [-386.146] (-391.170) (-386.819) -- 0:01:05
      145000 -- (-387.410) (-386.716) (-385.612) [-390.271] * (-386.659) (-386.206) [-386.033] (-386.537) -- 0:01:04

      Average standard deviation of split frequencies: 0.011966

      145500 -- (-386.867) (-385.056) (-389.807) [-388.042] * (-388.458) (-387.184) (-386.538) [-385.672] -- 0:01:04
      146000 -- (-389.758) (-385.855) [-386.528] (-389.608) * [-387.716] (-388.088) (-386.593) (-392.746) -- 0:01:04
      146500 -- (-389.757) (-390.493) [-387.429] (-385.270) * [-387.705] (-389.872) (-386.997) (-387.294) -- 0:01:04
      147000 -- (-386.547) (-387.971) (-392.030) [-385.414] * (-387.040) (-385.613) [-390.322] (-388.144) -- 0:01:03
      147500 -- [-385.711] (-386.449) (-388.785) (-385.775) * (-390.213) (-389.206) [-390.124] (-385.548) -- 0:01:03
      148000 -- (-388.748) [-386.726] (-387.106) (-385.984) * (-389.185) (-387.942) [-390.555] (-386.268) -- 0:01:03
      148500 -- (-385.876) (-386.855) (-385.510) [-387.214] * (-391.236) (-387.001) [-387.494] (-385.800) -- 0:01:03
      149000 -- (-387.513) (-386.251) (-386.458) [-386.196] * [-386.021] (-387.839) (-386.794) (-385.516) -- 0:01:02
      149500 -- [-386.160] (-389.249) (-387.451) (-387.913) * (-387.412) (-388.567) [-387.560] (-387.796) -- 0:01:02
      150000 -- (-386.884) [-387.003] (-386.338) (-385.361) * (-385.700) (-387.880) (-387.656) [-386.318] -- 0:01:02

      Average standard deviation of split frequencies: 0.011595

      150500 -- (-385.901) (-387.416) (-385.191) [-385.279] * (-384.752) [-387.513] (-386.213) (-386.443) -- 0:01:02
      151000 -- (-386.911) [-387.000] (-384.713) (-386.336) * [-388.155] (-389.435) (-387.621) (-389.626) -- 0:01:01
      151500 -- (-386.926) (-386.946) [-386.064] (-387.763) * (-389.235) (-386.407) (-389.399) [-387.364] -- 0:01:07
      152000 -- [-385.793] (-391.007) (-387.317) (-389.754) * (-387.872) (-385.142) [-385.788] (-385.798) -- 0:01:06
      152500 -- [-385.412] (-385.811) (-387.050) (-387.618) * [-386.227] (-386.614) (-387.777) (-387.261) -- 0:01:06
      153000 -- [-386.749] (-386.096) (-388.216) (-396.028) * (-385.502) [-384.923] (-385.606) (-387.551) -- 0:01:06
      153500 -- (-386.831) [-385.502] (-388.682) (-392.037) * (-393.553) (-385.128) [-387.107] (-387.991) -- 0:01:06
      154000 -- (-386.332) (-389.615) [-385.963] (-387.702) * [-390.953] (-385.566) (-388.358) (-388.258) -- 0:01:05
      154500 -- (-386.960) [-386.507] (-388.251) (-387.050) * (-386.409) (-387.873) [-386.326] (-385.624) -- 0:01:05
      155000 -- (-391.733) (-385.488) (-389.716) [-388.272] * (-385.371) (-386.371) (-386.570) [-386.064] -- 0:01:05

      Average standard deviation of split frequencies: 0.011332

      155500 -- [-385.751] (-385.896) (-388.488) (-385.261) * (-386.809) (-388.813) [-386.756] (-386.327) -- 0:01:05
      156000 -- (-385.359) (-386.783) (-384.921) [-387.715] * (-386.919) (-387.511) [-386.963] (-386.681) -- 0:01:04
      156500 -- (-393.234) (-385.765) (-385.083) [-386.758] * (-387.902) [-385.602] (-384.974) (-385.368) -- 0:01:04
      157000 -- (-400.897) [-387.694] (-389.079) (-388.278) * [-388.572] (-386.335) (-390.888) (-386.902) -- 0:01:04
      157500 -- (-388.173) (-386.877) (-386.543) [-384.902] * (-394.807) (-385.943) [-388.461] (-389.426) -- 0:01:04
      158000 -- (-387.490) (-386.625) (-386.011) [-386.811] * (-387.747) (-385.483) [-387.454] (-390.018) -- 0:01:03
      158500 -- (-387.198) (-386.089) [-387.575] (-390.324) * (-387.475) (-385.971) [-385.378] (-385.088) -- 0:01:03
      159000 -- (-385.368) [-388.792] (-386.743) (-388.053) * [-386.449] (-386.113) (-385.800) (-385.573) -- 0:01:03
      159500 -- [-385.246] (-387.440) (-385.187) (-386.646) * [-388.189] (-386.387) (-385.043) (-385.055) -- 0:01:03
      160000 -- (-385.874) [-385.714] (-385.385) (-387.171) * [-388.657] (-385.364) (-385.696) (-385.090) -- 0:01:02

      Average standard deviation of split frequencies: 0.010269

      160500 -- (-385.466) [-388.536] (-384.923) (-386.372) * (-390.363) (-386.248) [-385.808] (-386.092) -- 0:01:02
      161000 -- (-387.351) (-386.359) (-386.873) [-387.250] * (-388.329) (-386.457) (-386.300) [-388.582] -- 0:01:02
      161500 -- (-388.473) [-384.922] (-385.375) (-385.298) * [-385.928] (-386.303) (-392.622) (-387.041) -- 0:01:02
      162000 -- (-389.465) (-386.345) [-385.866] (-385.971) * (-388.938) (-386.135) (-388.195) [-387.775] -- 0:01:02
      162500 -- [-387.671] (-385.504) (-386.447) (-385.515) * [-386.568] (-387.226) (-386.867) (-390.627) -- 0:01:01
      163000 -- (-385.581) (-385.038) [-387.872] (-388.956) * (-386.816) (-389.786) (-391.899) [-391.915] -- 0:01:01
      163500 -- (-386.025) (-385.405) (-386.776) [-391.482] * (-389.082) (-388.216) (-392.470) [-387.853] -- 0:01:01
      164000 -- (-385.160) (-386.446) [-386.446] (-389.470) * [-390.049] (-389.257) (-388.654) (-387.877) -- 0:01:01
      164500 -- (-385.257) (-389.870) [-390.707] (-386.465) * (-386.618) (-388.260) (-386.822) [-388.576] -- 0:01:00
      165000 -- [-386.156] (-386.561) (-385.431) (-389.894) * [-386.453] (-387.106) (-388.240) (-390.886) -- 0:01:05

      Average standard deviation of split frequencies: 0.011004

      165500 -- (-386.598) [-387.069] (-387.476) (-390.428) * [-388.173] (-387.335) (-387.031) (-392.125) -- 0:01:05
      166000 -- (-386.051) (-388.263) (-389.069) [-386.691] * (-388.082) (-387.266) [-385.403] (-388.322) -- 0:01:05
      166500 -- (-388.101) [-389.402] (-387.913) (-387.106) * (-388.016) (-386.493) (-386.977) [-386.621] -- 0:01:05
      167000 -- (-385.911) (-385.294) [-385.227] (-386.039) * [-387.238] (-387.025) (-386.373) (-388.423) -- 0:01:04
      167500 -- (-386.969) (-385.849) (-387.423) [-388.002] * (-390.986) (-386.466) [-388.274] (-387.696) -- 0:01:04
      168000 -- (-386.926) [-386.133] (-386.363) (-387.293) * (-385.912) (-384.970) [-386.251] (-386.736) -- 0:01:04
      168500 -- (-391.896) (-388.514) [-388.607] (-390.670) * [-385.804] (-386.878) (-387.544) (-386.596) -- 0:01:04
      169000 -- (-387.214) (-390.100) (-385.069) [-387.443] * [-388.732] (-386.015) (-387.098) (-386.658) -- 0:01:03
      169500 -- (-389.381) [-387.266] (-385.245) (-386.786) * [-385.834] (-386.060) (-386.856) (-387.659) -- 0:01:03
      170000 -- (-387.923) (-388.408) [-386.224] (-387.446) * [-385.237] (-389.785) (-392.439) (-394.013) -- 0:01:03

      Average standard deviation of split frequencies: 0.010876

      170500 -- (-389.161) (-389.984) [-387.229] (-385.500) * (-387.393) [-391.544] (-387.642) (-386.976) -- 0:01:03
      171000 -- [-386.626] (-384.789) (-389.109) (-388.286) * (-387.524) (-385.269) (-388.881) [-390.657] -- 0:01:03
      171500 -- (-386.933) (-386.687) [-388.681] (-386.298) * (-388.866) (-386.745) [-386.688] (-390.466) -- 0:01:02
      172000 -- (-388.751) (-386.479) [-390.253] (-387.509) * (-392.965) [-385.413] (-386.924) (-385.346) -- 0:01:02
      172500 -- (-386.746) [-385.779] (-389.363) (-385.772) * (-386.986) (-385.333) (-386.337) [-387.712] -- 0:01:02
      173000 -- [-385.512] (-387.337) (-390.078) (-386.574) * (-385.434) [-387.604] (-386.516) (-388.409) -- 0:01:02
      173500 -- (-385.980) [-388.684] (-387.920) (-387.614) * [-386.309] (-391.773) (-386.534) (-385.841) -- 0:01:01
      174000 -- (-387.464) (-390.020) (-386.578) [-386.989] * [-388.077] (-391.262) (-387.519) (-387.585) -- 0:01:01
      174500 -- (-389.924) (-387.569) (-388.022) [-389.009] * (-387.157) [-386.977] (-387.376) (-385.850) -- 0:01:01
      175000 -- (-387.449) (-387.689) [-384.839] (-386.962) * [-388.954] (-389.427) (-388.726) (-391.652) -- 0:01:01

      Average standard deviation of split frequencies: 0.011049

      175500 -- (-385.153) (-386.509) [-389.163] (-386.629) * [-385.114] (-388.674) (-386.030) (-387.956) -- 0:01:01
      176000 -- (-387.667) (-386.573) [-388.762] (-393.079) * (-388.947) (-387.448) [-385.917] (-388.550) -- 0:01:00
      176500 -- [-387.148] (-387.560) (-386.863) (-389.579) * (-386.284) [-385.973] (-387.076) (-386.670) -- 0:01:00
      177000 -- (-392.889) (-387.214) [-387.789] (-395.097) * (-386.060) (-389.914) [-386.857] (-385.739) -- 0:01:00
      177500 -- (-388.141) (-386.631) [-386.514] (-390.375) * (-387.148) (-384.994) (-386.258) [-386.516] -- 0:01:00
      178000 -- [-385.812] (-385.913) (-388.122) (-386.103) * (-387.296) (-387.493) (-386.430) [-388.429] -- 0:01:00
      178500 -- (-386.965) [-387.546] (-386.145) (-385.855) * [-387.779] (-385.782) (-384.844) (-385.310) -- 0:00:59
      179000 -- (-387.736) [-389.471] (-391.055) (-391.789) * (-388.577) [-386.960] (-386.687) (-386.535) -- 0:01:04
      179500 -- [-388.230] (-390.754) (-384.814) (-386.806) * (-391.435) (-386.804) (-386.184) [-388.773] -- 0:01:03
      180000 -- (-389.349) (-386.087) (-388.493) [-385.326] * (-386.188) [-386.177] (-388.841) (-385.724) -- 0:01:03

      Average standard deviation of split frequencies: 0.011481

      180500 -- [-387.944] (-387.033) (-387.244) (-386.195) * (-386.249) (-387.057) (-388.535) [-386.548] -- 0:01:03
      181000 -- (-386.274) [-389.252] (-388.406) (-387.700) * [-387.301] (-386.345) (-388.408) (-386.550) -- 0:01:03
      181500 -- (-391.428) (-385.659) (-386.634) [-385.718] * (-387.969) (-385.982) [-385.764] (-390.244) -- 0:01:03
      182000 -- (-398.923) (-387.455) [-386.542] (-386.202) * (-386.765) (-386.975) (-385.171) [-387.281] -- 0:01:02
      182500 -- (-396.614) [-392.980] (-385.715) (-389.285) * (-385.831) [-388.050] (-387.624) (-385.755) -- 0:01:02
      183000 -- (-389.221) (-388.554) (-386.771) [-387.115] * [-385.284] (-387.050) (-386.992) (-386.195) -- 0:01:02
      183500 -- (-386.033) (-385.026) [-386.798] (-386.599) * (-386.181) (-385.873) (-386.244) [-387.376] -- 0:01:02
      184000 -- (-387.497) (-385.072) [-389.342] (-385.263) * (-387.214) [-389.202] (-385.485) (-390.485) -- 0:01:02
      184500 -- [-386.412] (-385.961) (-387.330) (-385.713) * (-388.491) [-390.500] (-387.756) (-385.740) -- 0:01:01
      185000 -- (-388.303) (-388.650) (-389.334) [-387.214] * (-389.254) [-389.594] (-385.393) (-389.696) -- 0:01:01

      Average standard deviation of split frequencies: 0.009504

      185500 -- [-386.150] (-390.466) (-385.957) (-385.936) * (-393.427) (-392.732) (-385.785) [-387.542] -- 0:01:01
      186000 -- (-388.645) (-388.294) [-388.353] (-387.408) * (-389.054) [-388.588] (-385.948) (-386.789) -- 0:01:01
      186500 -- [-385.723] (-385.799) (-386.987) (-387.644) * (-390.676) (-387.010) (-389.667) [-387.944] -- 0:01:01
      187000 -- (-386.246) (-385.734) [-386.616] (-393.247) * (-387.293) (-388.223) (-385.754) [-388.742] -- 0:01:00
      187500 -- (-392.519) [-386.129] (-388.090) (-385.972) * (-387.825) (-386.081) (-388.748) [-387.504] -- 0:01:00
      188000 -- (-390.827) (-385.143) [-385.675] (-385.874) * [-388.411] (-392.766) (-392.366) (-387.725) -- 0:01:00
      188500 -- [-386.815] (-385.957) (-388.467) (-385.707) * (-387.818) [-386.988] (-386.875) (-389.096) -- 0:01:00
      189000 -- (-395.076) (-385.859) [-389.348] (-386.231) * (-388.302) [-384.873] (-389.167) (-386.180) -- 0:01:00
      189500 -- [-388.593] (-385.761) (-388.174) (-391.550) * [-386.821] (-386.041) (-386.930) (-387.131) -- 0:00:59
      190000 -- (-385.005) [-385.094] (-390.144) (-389.319) * (-386.524) [-387.345] (-387.710) (-389.985) -- 0:00:59

      Average standard deviation of split frequencies: 0.009426

      190500 -- (-385.004) (-386.532) (-387.530) [-385.405] * [-388.301] (-387.506) (-387.226) (-387.624) -- 0:00:59
      191000 -- [-387.320] (-389.598) (-386.055) (-388.878) * (-387.141) (-390.981) (-391.007) [-386.737] -- 0:00:59
      191500 -- (-392.614) (-387.472) (-386.382) [-385.315] * (-386.068) (-392.195) (-386.763) [-387.293] -- 0:00:59
      192000 -- (-386.993) (-388.609) (-388.854) [-385.425] * (-386.911) (-385.927) (-386.720) [-385.877] -- 0:00:58
      192500 -- [-385.290] (-391.206) (-392.223) (-385.045) * (-387.395) [-386.095] (-387.929) (-387.632) -- 0:00:58
      193000 -- (-388.441) (-386.567) (-388.096) [-385.941] * (-388.743) [-386.076] (-388.666) (-387.439) -- 0:01:02
      193500 -- (-386.829) [-385.463] (-385.997) (-390.287) * (-387.908) (-386.588) (-387.229) [-385.907] -- 0:01:02
      194000 -- (-385.951) (-386.311) [-387.349] (-386.562) * [-386.466] (-384.781) (-388.734) (-388.103) -- 0:01:02
      194500 -- [-385.746] (-390.765) (-391.592) (-388.080) * (-387.338) (-384.865) [-389.417] (-387.961) -- 0:01:02
      195000 -- [-388.626] (-387.590) (-384.927) (-388.301) * [-388.090] (-385.334) (-386.915) (-386.376) -- 0:01:01

      Average standard deviation of split frequencies: 0.010222

      195500 -- (-388.051) (-388.468) [-385.466] (-386.331) * (-392.306) (-386.269) (-387.127) [-388.417] -- 0:01:01
      196000 -- (-385.253) [-386.242] (-387.137) (-386.443) * [-386.971] (-387.673) (-387.865) (-388.499) -- 0:01:01
      196500 -- [-386.372] (-385.635) (-389.247) (-389.770) * [-387.396] (-385.571) (-390.005) (-386.652) -- 0:01:01
      197000 -- [-385.422] (-390.631) (-384.933) (-386.009) * [-386.861] (-385.275) (-391.525) (-386.401) -- 0:01:01
      197500 -- (-385.750) (-386.085) [-387.808] (-386.886) * (-386.400) (-389.841) (-388.227) [-389.082] -- 0:01:00
      198000 -- (-390.628) (-387.702) (-384.922) [-386.927] * [-387.196] (-389.722) (-389.448) (-386.937) -- 0:01:00
      198500 -- (-385.653) (-387.733) (-387.192) [-387.948] * (-385.480) [-384.894] (-391.084) (-388.441) -- 0:01:00
      199000 -- (-386.756) (-392.825) [-386.630] (-385.599) * [-389.060] (-385.963) (-387.609) (-387.276) -- 0:01:00
      199500 -- (-388.925) [-386.372] (-387.686) (-386.309) * [-386.279] (-386.510) (-386.394) (-388.258) -- 0:01:00
      200000 -- (-385.427) (-387.229) (-385.538) [-386.847] * (-386.362) (-387.413) (-386.041) [-388.888] -- 0:00:59

      Average standard deviation of split frequencies: 0.011305

      200500 -- [-385.078] (-386.839) (-386.586) (-388.670) * (-386.795) (-387.528) [-386.509] (-385.860) -- 0:00:59
      201000 -- (-387.513) [-392.198] (-386.564) (-390.485) * (-388.167) (-387.360) (-388.765) [-386.830] -- 0:00:59
      201500 -- (-386.998) [-389.291] (-388.410) (-387.009) * (-388.118) (-385.887) [-386.849] (-385.844) -- 0:00:59
      202000 -- (-385.290) [-386.787] (-388.350) (-386.029) * [-386.898] (-390.034) (-386.690) (-389.058) -- 0:00:59
      202500 -- (-388.060) (-387.950) [-388.728] (-386.883) * [-386.066] (-391.069) (-386.622) (-387.499) -- 0:00:59
      203000 -- (-390.179) (-387.922) [-385.206] (-387.369) * [-386.996] (-386.128) (-385.853) (-386.251) -- 0:00:58
      203500 -- (-387.926) (-388.447) (-390.564) [-388.068] * (-387.416) [-388.136] (-387.846) (-387.494) -- 0:00:58
      204000 -- [-385.509] (-386.198) (-392.553) (-390.803) * (-386.585) (-388.827) [-386.415] (-388.497) -- 0:00:58
      204500 -- (-390.793) (-387.645) (-387.678) [-391.573] * (-385.051) [-387.725] (-386.877) (-386.809) -- 0:00:58
      205000 -- [-387.740] (-386.872) (-394.134) (-398.178) * (-386.482) [-385.475] (-388.286) (-385.493) -- 0:00:58

      Average standard deviation of split frequencies: 0.011711

      205500 -- (-387.416) (-385.289) [-392.485] (-389.473) * (-388.048) [-384.679] (-389.080) (-386.677) -- 0:00:57
      206000 -- [-387.319] (-385.039) (-387.991) (-388.442) * [-386.541] (-385.861) (-386.704) (-390.137) -- 0:00:57
      206500 -- (-387.927) (-385.756) (-386.990) [-385.414] * [-385.953] (-385.386) (-386.665) (-389.118) -- 0:01:01
      207000 -- (-389.578) (-389.370) [-385.889] (-386.828) * [-385.302] (-385.550) (-385.621) (-385.782) -- 0:01:01
      207500 -- [-387.588] (-387.362) (-388.503) (-385.248) * (-388.904) [-389.390] (-387.961) (-386.846) -- 0:01:01
      208000 -- (-386.597) [-390.516] (-387.572) (-386.333) * (-387.441) (-389.870) (-385.802) [-387.104] -- 0:01:00
      208500 -- (-386.608) (-387.372) (-385.662) [-385.528] * [-389.724] (-387.035) (-385.968) (-385.010) -- 0:01:00
      209000 -- [-386.848] (-388.667) (-389.989) (-386.596) * (-385.201) (-385.382) [-385.991] (-387.522) -- 0:01:00
      209500 -- (-388.964) (-386.404) (-388.693) [-388.697] * (-388.556) (-386.085) (-387.490) [-386.796] -- 0:01:00
      210000 -- (-386.833) (-386.666) [-384.777] (-385.399) * (-387.103) (-386.901) (-386.155) [-386.437] -- 0:01:00

      Average standard deviation of split frequencies: 0.013053

      210500 -- (-386.345) (-388.634) (-385.303) [-389.200] * (-385.486) [-385.249] (-390.212) (-385.895) -- 0:01:00
      211000 -- (-387.739) [-388.527] (-385.314) (-387.511) * (-386.834) [-385.025] (-387.888) (-386.610) -- 0:00:59
      211500 -- [-385.285] (-387.225) (-385.611) (-386.149) * (-387.218) [-385.583] (-386.225) (-385.536) -- 0:00:59
      212000 -- (-387.438) (-386.442) (-385.895) [-386.102] * [-385.722] (-385.944) (-385.440) (-385.428) -- 0:00:59
      212500 -- (-385.032) [-387.388] (-386.039) (-388.752) * (-386.978) (-385.690) (-386.371) [-386.168] -- 0:00:59
      213000 -- (-385.738) [-386.975] (-386.044) (-392.600) * (-387.037) [-385.637] (-386.690) (-386.963) -- 0:00:59
      213500 -- (-389.153) (-385.560) (-387.475) [-389.365] * [-385.705] (-385.580) (-387.725) (-388.363) -- 0:00:58
      214000 -- (-389.853) (-385.574) (-387.954) [-386.022] * (-388.492) (-387.146) (-386.497) [-387.527] -- 0:00:58
      214500 -- (-390.730) [-388.685] (-385.601) (-386.202) * [-389.811] (-385.255) (-386.138) (-386.618) -- 0:00:58
      215000 -- (-386.981) (-386.429) [-385.779] (-386.697) * (-387.801) (-386.780) [-386.842] (-386.390) -- 0:00:58

      Average standard deviation of split frequencies: 0.012980

      215500 -- (-390.251) [-385.407] (-388.316) (-387.541) * [-385.238] (-386.615) (-390.125) (-386.801) -- 0:00:58
      216000 -- [-385.711] (-388.512) (-386.353) (-388.896) * [-385.592] (-391.710) (-389.022) (-388.950) -- 0:00:58
      216500 -- (-386.956) (-386.220) [-388.925] (-394.679) * (-384.894) (-385.448) (-388.251) [-389.721] -- 0:00:57
      217000 -- [-387.697] (-387.578) (-387.527) (-386.114) * [-389.890] (-387.336) (-386.798) (-386.691) -- 0:00:57
      217500 -- (-387.149) (-388.845) (-389.592) [-387.777] * (-387.975) (-386.827) [-386.411] (-388.763) -- 0:00:57
      218000 -- (-386.981) (-385.297) [-389.996] (-385.569) * [-385.013] (-388.277) (-385.405) (-387.030) -- 0:00:57
      218500 -- (-387.600) (-387.779) (-391.611) [-385.316] * (-384.915) (-387.546) [-387.318] (-385.133) -- 0:00:57
      219000 -- [-387.206] (-386.621) (-385.263) (-391.982) * (-385.876) [-385.876] (-387.592) (-388.332) -- 0:00:57
      219500 -- (-386.265) (-387.902) [-385.538] (-388.888) * (-389.412) [-385.461] (-389.403) (-387.985) -- 0:00:56
      220000 -- (-385.639) [-386.719] (-385.130) (-387.841) * (-385.304) (-385.985) (-386.438) [-388.140] -- 0:00:56

      Average standard deviation of split frequencies: 0.012951

      220500 -- [-385.004] (-386.548) (-386.497) (-389.515) * (-386.768) (-387.099) (-386.985) [-385.863] -- 0:01:00
      221000 -- (-391.371) (-387.822) (-385.828) [-387.334] * (-388.079) (-387.091) (-386.568) [-386.100] -- 0:00:59
      221500 -- [-386.218] (-386.729) (-390.075) (-387.542) * [-388.140] (-392.044) (-386.303) (-389.592) -- 0:00:59
      222000 -- (-387.088) (-387.387) (-387.818) [-391.045] * [-387.724] (-385.020) (-387.238) (-389.167) -- 0:00:59
      222500 -- [-386.800] (-387.194) (-386.506) (-385.953) * (-387.618) (-386.137) [-385.462] (-387.903) -- 0:00:59
      223000 -- (-389.378) (-386.575) [-386.541] (-389.294) * [-387.396] (-386.868) (-385.452) (-386.985) -- 0:00:59
      223500 -- (-386.036) (-384.999) (-386.384) [-386.083] * [-388.681] (-387.182) (-389.201) (-393.113) -- 0:00:59
      224000 -- (-387.228) (-385.647) (-387.345) [-388.350] * [-386.426] (-389.221) (-385.419) (-388.920) -- 0:00:58
      224500 -- (-392.641) [-385.496] (-385.181) (-387.276) * (-386.345) (-385.500) [-386.780] (-386.835) -- 0:00:58
      225000 -- (-386.971) [-386.060] (-388.921) (-385.724) * (-388.284) (-385.135) (-386.162) [-390.499] -- 0:00:58

      Average standard deviation of split frequencies: 0.013442

      225500 -- [-388.444] (-384.964) (-387.807) (-388.810) * (-388.822) (-386.926) (-386.590) [-389.712] -- 0:00:58
      226000 -- (-385.614) (-386.615) (-386.169) [-386.339] * (-391.949) (-389.719) [-385.719] (-387.838) -- 0:00:58
      226500 -- (-386.929) (-388.155) [-384.835] (-387.318) * (-385.513) [-390.486] (-385.246) (-385.777) -- 0:00:58
      227000 -- (-387.955) (-387.496) [-385.243] (-389.456) * (-386.702) [-389.424] (-385.613) (-384.896) -- 0:00:57
      227500 -- (-387.455) (-387.632) (-386.294) [-385.948] * (-388.621) [-385.277] (-386.423) (-387.586) -- 0:00:57
      228000 -- [-385.040] (-388.105) (-387.146) (-387.550) * (-385.712) (-386.367) [-386.221] (-388.573) -- 0:00:57
      228500 -- (-386.687) [-390.043] (-385.943) (-386.665) * (-387.225) (-386.803) (-387.282) [-388.020] -- 0:00:57
      229000 -- (-389.543) [-386.610] (-386.622) (-386.655) * (-389.455) [-387.039] (-387.759) (-388.194) -- 0:00:57
      229500 -- (-387.464) (-386.231) [-386.900] (-387.892) * (-389.323) (-386.028) [-385.208] (-385.139) -- 0:00:57
      230000 -- (-385.793) (-387.670) [-388.861] (-389.125) * [-388.181] (-385.049) (-389.352) (-386.852) -- 0:00:56

      Average standard deviation of split frequencies: 0.012376

      230500 -- (-385.310) [-386.113] (-385.386) (-388.234) * (-387.242) [-386.010] (-387.934) (-385.695) -- 0:00:56
      231000 -- [-386.595] (-385.192) (-390.251) (-390.262) * (-387.258) [-386.471] (-387.577) (-385.941) -- 0:00:56
      231500 -- (-387.952) (-392.375) [-385.653] (-387.903) * [-389.356] (-385.092) (-388.387) (-386.945) -- 0:00:56
      232000 -- [-385.667] (-389.091) (-386.448) (-390.205) * [-387.181] (-390.793) (-389.754) (-385.770) -- 0:00:56
      232500 -- (-386.095) (-388.400) [-388.511] (-385.816) * (-387.847) (-389.069) [-387.724] (-388.251) -- 0:00:56
      233000 -- (-386.303) [-386.694] (-390.081) (-386.226) * [-388.125] (-387.581) (-394.058) (-385.984) -- 0:00:55
      233500 -- (-386.923) (-387.098) [-388.089] (-389.545) * [-386.214] (-390.539) (-386.887) (-387.441) -- 0:00:55
      234000 -- (-386.200) [-388.262] (-388.545) (-389.774) * (-391.828) (-389.422) [-386.186] (-388.188) -- 0:00:58
      234500 -- (-388.031) [-387.835] (-388.177) (-386.604) * (-391.949) (-388.985) [-385.887] (-391.194) -- 0:00:58
      235000 -- (-385.772) (-386.675) (-386.724) [-392.464] * (-390.741) [-388.395] (-387.892) (-391.059) -- 0:00:58

      Average standard deviation of split frequencies: 0.012807

      235500 -- (-384.708) [-386.789] (-387.404) (-385.691) * (-385.757) (-387.412) [-389.113] (-386.608) -- 0:00:58
      236000 -- (-386.996) [-387.377] (-386.816) (-387.089) * (-385.506) (-388.376) (-385.986) [-386.880] -- 0:00:58
      236500 -- (-390.379) (-388.181) [-386.688] (-385.484) * [-384.823] (-386.754) (-385.360) (-387.035) -- 0:00:58
      237000 -- (-386.476) (-384.966) (-386.451) [-386.542] * (-386.604) (-387.787) (-387.503) [-385.440] -- 0:00:57
      237500 -- (-385.880) [-387.194] (-391.640) (-385.414) * (-386.559) (-386.326) [-387.920] (-385.989) -- 0:00:57
      238000 -- [-387.850] (-386.746) (-385.736) (-386.340) * [-386.150] (-390.122) (-388.534) (-386.296) -- 0:00:57
      238500 -- (-387.195) [-385.476] (-385.255) (-385.682) * (-389.401) (-390.611) (-384.802) [-385.728] -- 0:00:57
      239000 -- (-387.749) (-389.108) (-387.763) [-385.102] * [-387.209] (-386.244) (-388.628) (-388.534) -- 0:00:57
      239500 -- (-387.718) (-394.596) (-388.308) [-386.033] * [-388.549] (-385.482) (-385.196) (-389.282) -- 0:00:57
      240000 -- (-386.954) (-386.873) (-386.313) [-390.047] * (-387.211) [-386.250] (-389.972) (-387.696) -- 0:00:56

      Average standard deviation of split frequencies: 0.014038

      240500 -- (-391.783) (-385.240) (-388.055) [-387.638] * (-385.314) (-386.490) (-387.786) [-386.562] -- 0:00:56
      241000 -- (-395.294) (-387.437) [-386.643] (-387.198) * [-387.182] (-387.177) (-386.515) (-388.083) -- 0:00:56
      241500 -- (-387.642) [-387.509] (-391.766) (-387.510) * (-387.489) [-388.427] (-387.390) (-387.033) -- 0:00:56
      242000 -- (-388.455) (-386.570) (-389.549) [-388.015] * [-386.025] (-385.793) (-386.288) (-387.642) -- 0:00:56
      242500 -- [-385.215] (-390.155) (-387.194) (-390.254) * [-388.364] (-387.344) (-387.334) (-392.472) -- 0:00:56
      243000 -- [-385.922] (-388.563) (-387.856) (-393.429) * (-388.786) [-385.486] (-386.914) (-385.609) -- 0:00:56
      243500 -- [-385.478] (-389.531) (-387.080) (-390.646) * (-389.797) [-386.487] (-385.751) (-384.913) -- 0:00:55
      244000 -- [-387.539] (-391.340) (-388.940) (-385.447) * (-386.185) [-385.964] (-385.022) (-385.534) -- 0:00:55
      244500 -- (-391.577) [-387.856] (-386.529) (-388.996) * [-386.670] (-391.788) (-385.807) (-390.702) -- 0:00:55
      245000 -- (-385.691) [-386.248] (-385.852) (-388.375) * (-389.615) [-385.460] (-385.638) (-388.233) -- 0:00:55

      Average standard deviation of split frequencies: 0.014523

      245500 -- [-388.230] (-387.843) (-386.768) (-389.750) * [-387.899] (-386.997) (-385.497) (-387.243) -- 0:00:55
      246000 -- [-386.564] (-386.919) (-386.741) (-385.019) * (-387.310) (-387.160) [-385.144] (-390.326) -- 0:00:55
      246500 -- [-387.470] (-389.384) (-387.588) (-387.311) * [-385.148] (-386.812) (-387.546) (-391.030) -- 0:00:55
      247000 -- (-385.033) [-388.072] (-390.933) (-387.980) * (-385.633) [-385.761] (-386.909) (-387.244) -- 0:00:54
      247500 -- (-387.404) (-385.173) (-390.011) [-387.325] * [-386.554] (-386.792) (-387.284) (-386.463) -- 0:00:54
      248000 -- (-385.598) [-385.287] (-387.880) (-388.183) * (-387.644) (-387.579) (-387.547) [-385.935] -- 0:00:57
      248500 -- [-386.186] (-386.780) (-386.018) (-387.861) * (-386.447) (-388.399) [-390.513] (-388.734) -- 0:00:57
      249000 -- (-389.969) (-386.765) (-389.256) [-385.505] * (-388.281) (-394.531) (-385.997) [-386.922] -- 0:00:57
      249500 -- (-388.483) (-389.879) [-387.827] (-387.079) * (-387.535) (-386.930) (-386.523) [-385.858] -- 0:00:57
      250000 -- (-385.522) (-388.274) [-385.640] (-386.788) * (-387.855) (-384.863) [-387.454] (-385.742) -- 0:00:57

      Average standard deviation of split frequencies: 0.014313

      250500 -- (-385.503) (-385.845) (-386.275) [-387.319] * (-386.713) [-385.719] (-386.236) (-385.872) -- 0:00:56
      251000 -- [-386.157] (-389.926) (-385.353) (-386.270) * (-387.586) (-386.894) [-385.575] (-385.966) -- 0:00:56
      251500 -- (-385.817) (-389.003) (-388.222) [-385.937] * (-386.112) [-386.278] (-385.303) (-385.937) -- 0:00:56
      252000 -- (-385.789) (-388.263) [-386.840] (-386.802) * (-386.707) (-387.686) (-388.678) [-387.060] -- 0:00:56
      252500 -- (-387.231) (-387.733) (-393.207) [-386.009] * (-386.999) (-389.743) (-388.494) [-386.119] -- 0:00:56
      253000 -- (-386.224) [-388.840] (-389.714) (-387.044) * (-390.331) (-388.275) [-385.567] (-385.862) -- 0:00:56
      253500 -- (-388.404) [-385.378] (-386.906) (-389.068) * [-385.136] (-389.427) (-386.586) (-385.246) -- 0:00:55
      254000 -- (-388.303) (-385.869) [-386.360] (-387.195) * (-390.112) [-387.073] (-387.988) (-385.696) -- 0:00:55
      254500 -- (-388.001) [-385.833] (-388.172) (-392.124) * (-387.410) (-386.309) (-386.590) [-392.901] -- 0:00:55
      255000 -- (-386.515) (-385.380) [-388.893] (-389.772) * (-392.116) [-388.446] (-386.041) (-391.257) -- 0:00:55

      Average standard deviation of split frequencies: 0.014220

      255500 -- (-385.475) (-385.280) (-388.327) [-385.250] * (-387.159) (-387.588) (-387.524) [-387.632] -- 0:00:55
      256000 -- [-391.983] (-390.677) (-390.092) (-390.576) * (-390.294) [-390.947] (-387.499) (-386.591) -- 0:00:55
      256500 -- (-386.536) [-386.297] (-387.048) (-386.791) * (-388.152) (-385.817) [-386.567] (-388.831) -- 0:00:55
      257000 -- [-387.234] (-387.795) (-386.385) (-386.463) * (-387.109) (-387.437) (-390.938) [-385.189] -- 0:00:54
      257500 -- [-388.309] (-384.836) (-387.773) (-386.570) * (-388.215) [-386.904] (-388.422) (-388.848) -- 0:00:54
      258000 -- [-388.888] (-386.832) (-386.423) (-385.877) * (-386.315) [-386.157] (-387.933) (-388.821) -- 0:00:54
      258500 -- (-387.920) [-384.815] (-387.722) (-390.687) * (-389.223) [-386.041] (-386.010) (-388.654) -- 0:00:54
      259000 -- (-390.060) (-387.050) [-384.952] (-385.246) * (-387.077) (-387.529) [-389.202] (-387.758) -- 0:00:54
      259500 -- (-387.517) (-385.830) [-386.603] (-388.488) * (-385.391) (-387.548) [-389.206] (-386.500) -- 0:00:54
      260000 -- (-390.395) (-386.028) (-387.039) [-387.984] * (-385.288) (-387.695) (-387.060) [-385.233] -- 0:00:54

      Average standard deviation of split frequencies: 0.012320

      260500 -- [-386.534] (-387.886) (-386.920) (-390.733) * [-387.079] (-386.028) (-387.422) (-386.811) -- 0:00:53
      261000 -- [-386.897] (-385.496) (-386.710) (-387.210) * (-386.533) (-388.023) (-386.338) [-385.507] -- 0:00:53
      261500 -- (-386.068) [-387.921] (-395.159) (-389.958) * (-387.279) [-386.548] (-385.744) (-386.081) -- 0:00:56
      262000 -- (-388.118) (-395.452) [-391.599] (-388.742) * (-386.550) (-385.510) [-390.169] (-386.109) -- 0:00:56
      262500 -- [-386.115] (-386.919) (-392.701) (-389.155) * [-385.655] (-386.633) (-388.706) (-388.212) -- 0:00:56
      263000 -- (-387.355) (-386.300) [-389.559] (-385.934) * (-388.730) (-386.137) (-391.338) [-386.486] -- 0:00:56
      263500 -- (-387.172) (-387.078) (-387.351) [-386.424] * (-390.532) (-389.595) [-385.949] (-387.496) -- 0:00:55
      264000 -- (-389.127) (-386.959) (-386.182) [-387.178] * (-389.988) [-389.357] (-386.819) (-386.298) -- 0:00:55
      264500 -- (-387.218) [-388.333] (-387.265) (-391.056) * (-386.894) (-396.384) [-389.967] (-385.799) -- 0:00:55
      265000 -- [-388.916] (-391.388) (-389.638) (-386.689) * (-384.773) (-389.240) [-387.194] (-387.221) -- 0:00:55

      Average standard deviation of split frequencies: 0.011780

      265500 -- [-385.714] (-392.981) (-386.984) (-385.308) * (-387.811) (-387.116) (-385.975) [-386.054] -- 0:00:55
      266000 -- [-391.652] (-387.579) (-386.229) (-388.050) * (-385.285) [-386.938] (-385.907) (-386.258) -- 0:00:55
      266500 -- [-386.264] (-388.130) (-385.781) (-385.505) * (-386.128) [-388.045] (-387.878) (-389.237) -- 0:00:55
      267000 -- (-391.409) (-385.251) (-385.962) [-390.189] * (-386.416) [-386.891] (-389.520) (-386.171) -- 0:00:54
      267500 -- (-391.638) (-386.659) (-384.828) [-386.200] * (-387.787) [-388.890] (-389.731) (-386.058) -- 0:00:54
      268000 -- (-387.708) [-387.509] (-386.500) (-388.256) * [-387.004] (-387.668) (-386.721) (-386.301) -- 0:00:54
      268500 -- (-385.721) (-386.556) (-385.069) [-387.878] * (-386.163) (-389.810) (-388.339) [-385.403] -- 0:00:54
      269000 -- [-387.721] (-386.024) (-386.507) (-386.869) * [-385.589] (-387.810) (-389.026) (-385.628) -- 0:00:54
      269500 -- (-387.096) (-386.305) (-388.611) [-390.796] * [-386.585] (-387.847) (-390.655) (-386.136) -- 0:00:54
      270000 -- (-388.989) [-387.341] (-387.133) (-392.205) * [-385.303] (-387.539) (-389.530) (-386.485) -- 0:00:54

      Average standard deviation of split frequencies: 0.013498

      270500 -- (-387.172) [-386.266] (-390.446) (-388.762) * (-385.581) [-386.153] (-391.014) (-387.253) -- 0:00:53
      271000 -- (-387.571) [-386.463] (-386.411) (-391.867) * (-388.414) (-384.876) [-388.076] (-386.602) -- 0:00:53
      271500 -- (-387.578) (-388.125) (-387.349) [-389.895] * [-389.597] (-385.306) (-386.391) (-385.934) -- 0:00:53
      272000 -- [-385.740] (-390.385) (-388.856) (-391.547) * (-390.469) [-385.498] (-391.750) (-387.831) -- 0:00:53
      272500 -- [-388.928] (-387.592) (-387.183) (-388.470) * [-385.580] (-392.015) (-387.637) (-386.042) -- 0:00:53
      273000 -- (-388.582) [-386.104] (-389.834) (-389.072) * (-395.577) (-390.003) [-384.990] (-386.305) -- 0:00:53
      273500 -- (-389.996) [-387.954] (-388.903) (-387.355) * (-392.512) (-387.896) (-386.005) [-392.439] -- 0:00:53
      274000 -- [-386.178] (-391.925) (-386.492) (-389.167) * [-387.567] (-386.414) (-386.356) (-386.624) -- 0:00:52
      274500 -- (-390.663) (-388.385) (-386.619) [-387.853] * [-387.975] (-387.317) (-388.573) (-386.277) -- 0:00:52
      275000 -- (-386.704) (-389.146) (-385.648) [-386.016] * [-388.193] (-388.965) (-388.517) (-385.889) -- 0:00:52

      Average standard deviation of split frequencies: 0.013023

      275500 -- (-387.581) [-386.583] (-386.611) (-387.791) * [-389.219] (-386.172) (-392.110) (-387.409) -- 0:00:52
      276000 -- [-385.145] (-387.422) (-387.472) (-386.779) * (-387.598) (-385.620) (-397.900) [-386.982] -- 0:00:55
      276500 -- (-385.473) (-385.765) (-385.470) [-392.441] * (-386.754) (-384.728) (-402.508) [-387.053] -- 0:00:54
      277000 -- [-387.314] (-386.014) (-387.067) (-388.263) * (-385.585) [-391.688] (-393.906) (-387.290) -- 0:00:54
      277500 -- (-387.986) (-390.700) (-384.991) [-392.852] * [-388.286] (-388.779) (-390.858) (-385.813) -- 0:00:54
      278000 -- [-390.421] (-387.638) (-386.320) (-390.587) * (-390.442) [-387.658] (-393.049) (-391.247) -- 0:00:54
      278500 -- (-387.429) (-386.517) [-384.940] (-389.226) * (-387.085) [-385.839] (-386.140) (-389.063) -- 0:00:54
      279000 -- (-390.147) (-387.438) (-385.782) [-386.223] * (-388.489) (-386.370) [-386.780] (-390.300) -- 0:00:54
      279500 -- [-386.792] (-387.185) (-385.633) (-388.293) * (-386.931) (-388.302) (-386.039) [-388.636] -- 0:00:54
      280000 -- [-386.443] (-389.265) (-386.743) (-387.814) * [-390.511] (-390.118) (-391.816) (-388.137) -- 0:00:53

      Average standard deviation of split frequencies: 0.013437

      280500 -- [-385.213] (-388.635) (-386.506) (-389.400) * [-387.767] (-385.765) (-386.605) (-389.651) -- 0:00:53
      281000 -- (-386.105) (-391.420) (-388.086) [-386.412] * (-385.619) (-386.560) (-387.225) [-386.635] -- 0:00:53
      281500 -- [-387.093] (-390.002) (-386.561) (-387.539) * [-386.138] (-384.747) (-386.651) (-388.595) -- 0:00:53
      282000 -- (-387.495) [-386.750] (-387.915) (-386.058) * (-387.050) (-385.576) (-390.488) [-386.147] -- 0:00:53
      282500 -- (-387.695) (-388.454) [-389.531] (-388.783) * (-388.147) [-389.604] (-391.746) (-387.354) -- 0:00:53
      283000 -- (-386.744) (-387.780) (-389.869) [-387.179] * (-390.946) (-390.058) (-386.208) [-385.166] -- 0:00:53
      283500 -- (-386.662) [-387.340] (-386.155) (-388.592) * (-387.058) (-391.270) [-387.864] (-385.087) -- 0:00:53
      284000 -- [-385.642] (-388.816) (-388.812) (-387.357) * (-386.387) (-388.876) (-386.898) [-385.797] -- 0:00:52
      284500 -- (-388.209) [-385.557] (-392.512) (-389.270) * (-390.925) (-389.002) [-386.788] (-386.630) -- 0:00:52
      285000 -- (-386.875) (-384.976) (-387.263) [-388.144] * (-387.899) (-386.604) (-387.669) [-386.338] -- 0:00:52

      Average standard deviation of split frequencies: 0.012507

      285500 -- [-385.430] (-388.830) (-388.687) (-387.281) * (-389.928) (-386.395) [-386.507] (-388.300) -- 0:00:52
      286000 -- (-386.988) [-389.617] (-388.485) (-386.902) * [-389.665] (-386.881) (-385.244) (-385.618) -- 0:00:52
      286500 -- [-386.477] (-386.501) (-388.844) (-387.903) * [-391.623] (-390.476) (-387.531) (-386.156) -- 0:00:52
      287000 -- (-385.084) [-385.593] (-390.962) (-387.046) * (-386.921) (-387.591) (-390.743) [-386.050] -- 0:00:52
      287500 -- (-389.501) (-386.771) (-388.627) [-385.136] * (-387.833) (-387.871) (-385.837) [-384.904] -- 0:00:52
      288000 -- (-387.511) [-387.489] (-388.344) (-385.279) * (-388.870) [-385.284] (-388.726) (-388.682) -- 0:00:51
      288500 -- (-390.460) [-387.322] (-389.644) (-389.946) * [-391.060] (-387.090) (-388.583) (-386.041) -- 0:00:51
      289000 -- (-388.023) (-388.434) (-387.619) [-386.768] * (-386.782) (-385.235) (-386.353) [-386.198] -- 0:00:51
      289500 -- [-385.637] (-387.393) (-386.621) (-387.144) * [-387.334] (-387.327) (-387.248) (-387.983) -- 0:00:51
      290000 -- (-386.241) (-390.489) (-386.168) [-386.630] * (-386.691) [-387.288] (-387.965) (-386.460) -- 0:00:51

      Average standard deviation of split frequencies: 0.011543

      290500 -- (-385.892) (-385.990) (-386.720) [-388.662] * [-384.989] (-386.947) (-390.052) (-385.418) -- 0:00:53
      291000 -- (-389.194) (-387.786) (-386.911) [-386.947] * (-385.962) [-385.618] (-387.445) (-388.764) -- 0:00:53
      291500 -- (-388.223) [-386.828] (-390.263) (-386.123) * (-387.243) [-386.101] (-386.943) (-387.435) -- 0:00:53
      292000 -- (-385.899) (-391.208) (-388.467) [-388.383] * (-386.386) [-386.599] (-386.631) (-388.892) -- 0:00:53
      292500 -- (-389.216) (-387.428) [-390.547] (-394.740) * [-386.595] (-388.067) (-387.418) (-386.443) -- 0:00:53
      293000 -- (-388.096) (-388.169) [-389.161] (-392.170) * (-387.539) [-388.024] (-386.438) (-390.816) -- 0:00:53
      293500 -- (-392.162) [-386.211] (-388.375) (-386.013) * (-387.720) (-388.528) (-386.062) [-389.283] -- 0:00:52
      294000 -- (-390.853) (-386.427) [-391.308] (-388.122) * (-388.446) (-387.384) [-388.379] (-388.758) -- 0:00:52
      294500 -- (-392.278) [-387.202] (-386.791) (-387.853) * (-387.550) [-385.808] (-386.594) (-385.641) -- 0:00:52
      295000 -- (-387.374) [-385.742] (-388.627) (-387.326) * (-385.321) (-390.225) (-386.543) [-386.097] -- 0:00:52

      Average standard deviation of split frequencies: 0.012085

      295500 -- (-384.937) [-384.895] (-390.626) (-387.681) * (-390.717) (-385.845) [-386.605] (-387.271) -- 0:00:52
      296000 -- (-387.305) (-385.112) [-387.936] (-385.681) * (-391.368) (-387.344) [-387.688] (-386.637) -- 0:00:52
      296500 -- [-386.125] (-385.182) (-386.771) (-389.370) * [-386.177] (-388.841) (-387.606) (-388.894) -- 0:00:52
      297000 -- [-386.305] (-385.288) (-386.157) (-386.717) * (-386.624) (-388.723) [-389.912] (-387.207) -- 0:00:52
      297500 -- (-387.109) [-386.049] (-385.956) (-386.710) * (-389.095) (-385.368) [-387.284] (-387.707) -- 0:00:51
      298000 -- (-385.087) [-385.183] (-387.613) (-386.073) * (-385.782) (-385.843) (-385.602) [-386.075] -- 0:00:51
      298500 -- (-386.204) (-386.352) [-388.839] (-388.897) * (-386.816) (-388.810) (-389.071) [-390.196] -- 0:00:51
      299000 -- [-385.927] (-389.665) (-385.515) (-387.206) * (-388.178) [-387.529] (-388.031) (-390.798) -- 0:00:51
      299500 -- (-386.433) (-389.888) [-386.064] (-386.102) * (-389.352) (-392.492) (-386.868) [-389.438] -- 0:00:51
      300000 -- (-386.293) (-387.304) (-384.882) [-386.920] * (-388.566) [-389.992] (-386.013) (-385.366) -- 0:00:51

      Average standard deviation of split frequencies: 0.013373

      300500 -- [-388.078] (-388.044) (-386.851) (-388.050) * (-393.375) (-388.989) [-387.335] (-387.472) -- 0:00:51
      301000 -- (-388.061) (-389.014) [-388.196] (-386.571) * (-389.343) (-389.163) [-387.057] (-386.012) -- 0:00:51
      301500 -- (-388.018) (-385.808) (-385.456) [-387.916] * (-387.129) [-386.567] (-386.128) (-386.928) -- 0:00:50
      302000 -- (-386.362) [-385.775] (-385.476) (-386.802) * [-386.426] (-391.729) (-392.259) (-387.749) -- 0:00:50
      302500 -- [-387.470] (-388.480) (-385.415) (-387.963) * (-386.662) [-390.548] (-387.556) (-386.572) -- 0:00:50
      303000 -- [-385.198] (-389.219) (-386.686) (-390.610) * (-385.049) (-388.469) (-386.495) [-384.790] -- 0:00:50
      303500 -- [-385.590] (-388.460) (-387.758) (-385.962) * [-386.093] (-386.636) (-386.946) (-386.841) -- 0:00:50
      304000 -- [-385.779] (-390.722) (-390.274) (-386.369) * (-388.297) (-385.535) (-389.486) [-390.049] -- 0:00:52
      304500 -- (-390.671) (-385.489) (-391.382) [-386.217] * (-386.883) (-385.751) (-388.679) [-386.401] -- 0:00:52
      305000 -- (-390.199) (-385.360) [-386.993] (-386.795) * (-387.081) [-389.092] (-386.917) (-386.951) -- 0:00:52

      Average standard deviation of split frequencies: 0.012811

      305500 -- [-385.675] (-385.349) (-385.629) (-385.767) * (-387.715) (-390.442) (-386.897) [-386.078] -- 0:00:52
      306000 -- (-387.514) [-387.019] (-386.853) (-387.227) * [-391.752] (-386.348) (-386.284) (-389.507) -- 0:00:52
      306500 -- (-390.583) (-387.475) [-385.110] (-388.469) * [-385.487] (-388.933) (-387.704) (-388.843) -- 0:00:52
      307000 -- (-388.933) [-388.534] (-386.263) (-388.333) * (-393.266) (-388.710) (-390.175) [-386.078] -- 0:00:51
      307500 -- (-386.048) [-386.672] (-387.759) (-386.150) * (-386.112) (-388.653) (-386.672) [-385.261] -- 0:00:51
      308000 -- (-390.002) [-387.872] (-387.789) (-386.281) * (-388.532) [-391.008] (-388.758) (-387.232) -- 0:00:51
      308500 -- (-391.163) (-386.132) (-385.268) [-386.458] * (-387.009) (-385.823) (-387.220) [-386.220] -- 0:00:51
      309000 -- [-387.009] (-385.514) (-386.058) (-388.782) * (-386.003) (-387.630) (-390.160) [-385.863] -- 0:00:51
      309500 -- (-386.308) (-385.783) [-385.225] (-387.597) * (-385.136) (-385.740) [-389.495] (-389.451) -- 0:00:51
      310000 -- (-387.444) (-386.925) (-385.655) [-387.691] * (-385.225) (-386.971) [-386.215] (-386.001) -- 0:00:51

      Average standard deviation of split frequencies: 0.013994

      310500 -- (-385.678) (-387.027) [-385.901] (-388.011) * [-385.360] (-387.226) (-387.045) (-385.886) -- 0:00:51
      311000 -- [-386.184] (-387.669) (-386.583) (-389.807) * (-386.352) (-388.767) [-386.613] (-389.044) -- 0:00:50
      311500 -- (-385.823) (-391.375) (-386.784) [-386.072] * (-384.652) (-385.212) [-392.391] (-387.697) -- 0:00:50
      312000 -- (-388.334) [-389.612] (-385.322) (-385.152) * (-386.421) (-387.525) (-386.935) [-386.336] -- 0:00:50
      312500 -- (-384.922) (-387.768) (-387.092) [-385.437] * (-390.454) (-385.917) [-385.991] (-386.126) -- 0:00:50
      313000 -- (-386.657) (-386.302) (-387.406) [-385.572] * (-385.160) (-387.352) [-386.995] (-388.013) -- 0:00:50
      313500 -- (-387.799) (-388.726) [-390.220] (-387.382) * (-385.559) (-385.261) (-386.750) [-386.219] -- 0:00:50
      314000 -- (-393.875) [-386.628] (-384.895) (-386.535) * (-390.489) (-392.439) [-385.757] (-389.001) -- 0:00:50
      314500 -- (-387.103) (-386.005) [-385.266] (-386.856) * (-389.302) (-386.410) [-385.550] (-386.553) -- 0:00:50
      315000 -- (-388.067) (-386.891) (-389.941) [-386.106] * (-388.197) (-387.533) (-385.362) [-390.410] -- 0:00:50

      Average standard deviation of split frequencies: 0.013675

      315500 -- [-387.611] (-385.694) (-389.678) (-389.999) * [-388.182] (-386.364) (-387.686) (-389.474) -- 0:00:49
      316000 -- (-385.851) (-388.011) [-386.186] (-390.495) * (-385.879) [-387.642] (-386.028) (-390.689) -- 0:00:49
      316500 -- [-385.501] (-385.713) (-386.438) (-389.089) * (-388.334) (-387.761) [-388.787] (-388.412) -- 0:00:49
      317000 -- (-388.766) (-386.034) (-391.233) [-388.173] * (-387.140) (-388.569) [-385.331] (-386.567) -- 0:00:49
      317500 -- [-386.676] (-386.213) (-390.608) (-388.453) * (-386.916) [-387.957] (-385.336) (-393.034) -- 0:00:49
      318000 -- [-388.112] (-386.109) (-396.518) (-386.847) * [-388.203] (-390.349) (-390.778) (-386.067) -- 0:00:49
      318500 -- (-386.471) [-387.633] (-393.338) (-384.755) * (-389.409) (-389.664) (-386.171) [-385.539] -- 0:00:51
      319000 -- (-393.288) (-385.848) [-387.691] (-385.216) * (-385.464) (-390.227) [-385.745] (-389.380) -- 0:00:51
      319500 -- (-390.110) (-391.229) (-385.529) [-385.895] * [-386.032] (-389.803) (-386.377) (-387.009) -- 0:00:51
      320000 -- (-386.522) [-387.079] (-385.946) (-385.557) * (-387.861) (-394.841) (-390.117) [-386.750] -- 0:00:50

      Average standard deviation of split frequencies: 0.013557

      320500 -- (-388.838) (-385.798) [-386.748] (-388.014) * (-386.410) [-391.079] (-390.365) (-386.755) -- 0:00:50
      321000 -- (-387.310) [-390.719] (-388.672) (-387.852) * (-385.975) (-391.625) (-385.879) [-388.775] -- 0:00:50
      321500 -- (-387.583) (-387.295) [-386.029] (-385.471) * (-386.439) (-386.351) [-385.123] (-386.507) -- 0:00:50
      322000 -- (-389.840) (-385.082) (-387.709) [-384.927] * (-387.265) (-389.962) (-385.191) [-386.271] -- 0:00:50
      322500 -- (-387.381) (-385.656) (-388.793) [-391.084] * [-385.529] (-386.342) (-386.102) (-387.574) -- 0:00:50
      323000 -- (-386.872) [-386.265] (-387.872) (-387.875) * (-388.141) [-389.503] (-386.965) (-386.850) -- 0:00:50
      323500 -- (-392.700) (-385.525) [-386.217] (-389.008) * (-391.753) (-386.444) (-387.724) [-387.770] -- 0:00:50
      324000 -- (-392.083) (-385.977) [-386.348] (-385.094) * (-392.365) (-387.176) (-386.717) [-385.849] -- 0:00:50
      324500 -- (-388.039) [-384.880] (-386.178) (-386.297) * (-388.300) [-385.472] (-391.942) (-387.054) -- 0:00:49
      325000 -- [-385.653] (-386.373) (-384.953) (-388.159) * (-388.158) (-389.385) (-387.685) [-385.600] -- 0:00:49

      Average standard deviation of split frequencies: 0.013014

      325500 -- [-386.828] (-385.646) (-389.360) (-386.613) * (-388.766) (-386.243) (-386.075) [-385.988] -- 0:00:49
      326000 -- (-389.909) (-388.590) [-388.904] (-385.273) * [-389.999] (-387.330) (-388.697) (-386.542) -- 0:00:49
      326500 -- (-388.723) (-385.116) [-390.212] (-386.745) * (-388.118) [-386.968] (-386.395) (-385.627) -- 0:00:49
      327000 -- (-390.820) [-387.137] (-388.756) (-386.854) * (-387.752) (-391.049) (-389.709) [-385.462] -- 0:00:49
      327500 -- (-389.009) [-387.385] (-391.483) (-392.073) * (-387.466) [-388.667] (-385.499) (-385.439) -- 0:00:49
      328000 -- [-386.230] (-385.731) (-385.232) (-386.860) * (-390.806) (-392.348) (-389.036) [-384.961] -- 0:00:49
      328500 -- (-387.528) [-385.854] (-386.338) (-387.849) * (-390.370) (-388.054) [-387.901] (-385.484) -- 0:00:49
      329000 -- (-387.748) (-385.792) (-388.011) [-385.893] * (-389.281) [-385.735] (-385.890) (-386.289) -- 0:00:48
      329500 -- (-387.002) (-387.578) (-386.041) [-387.501] * (-390.544) (-386.323) (-387.302) [-390.315] -- 0:00:48
      330000 -- (-389.193) (-388.117) [-386.019] (-388.476) * (-388.689) [-386.706] (-387.556) (-386.801) -- 0:00:48

      Average standard deviation of split frequencies: 0.012514

      330500 -- (-388.869) [-386.142] (-388.097) (-388.438) * (-388.154) (-386.475) [-386.893] (-386.556) -- 0:00:48
      331000 -- (-386.484) (-386.704) [-388.212] (-386.282) * (-390.535) [-387.143] (-388.738) (-386.127) -- 0:00:48
      331500 -- [-387.275] (-393.429) (-386.820) (-388.321) * (-386.686) [-387.669] (-385.640) (-386.200) -- 0:00:48
      332000 -- (-386.140) (-386.588) (-386.297) [-386.936] * (-387.150) [-387.952] (-388.930) (-388.280) -- 0:00:48
      332500 -- [-385.927] (-388.003) (-389.810) (-388.374) * (-391.152) (-385.338) (-385.882) [-386.831] -- 0:00:50
      333000 -- (-386.913) [-389.983] (-388.462) (-389.471) * (-388.961) (-387.596) [-387.699] (-387.797) -- 0:00:50
      333500 -- (-385.528) [-386.705] (-386.660) (-387.439) * (-387.103) [-387.465] (-385.636) (-389.443) -- 0:00:49
      334000 -- (-386.043) (-387.706) (-385.364) [-385.279] * (-389.082) (-388.110) (-387.205) [-390.383] -- 0:00:49
      334500 -- (-388.251) (-388.462) (-387.015) [-387.069] * (-389.150) (-385.125) (-390.108) [-386.252] -- 0:00:49
      335000 -- [-388.362] (-386.133) (-387.225) (-386.540) * [-386.447] (-386.003) (-388.196) (-388.044) -- 0:00:49

      Average standard deviation of split frequencies: 0.012315

      335500 -- (-387.020) (-388.740) (-392.754) [-385.957] * [-385.390] (-386.920) (-387.742) (-387.580) -- 0:00:49
      336000 -- (-386.821) [-385.759] (-387.753) (-386.952) * [-387.768] (-386.280) (-390.285) (-388.116) -- 0:00:49
      336500 -- [-390.263] (-386.017) (-387.143) (-388.610) * [-389.953] (-387.277) (-387.374) (-385.355) -- 0:00:49
      337000 -- (-392.693) (-387.277) (-387.023) [-387.231] * [-387.795] (-385.664) (-387.367) (-387.167) -- 0:00:49
      337500 -- (-387.481) (-386.630) (-392.596) [-385.430] * (-389.855) [-389.646] (-386.618) (-386.783) -- 0:00:49
      338000 -- (-385.767) (-385.486) [-389.146] (-386.005) * (-386.373) (-391.165) (-387.251) [-389.990] -- 0:00:48
      338500 -- (-386.530) (-386.693) [-385.884] (-385.285) * [-386.305] (-387.394) (-387.676) (-386.575) -- 0:00:48
      339000 -- (-387.031) (-386.851) (-384.928) [-387.059] * (-385.294) [-390.869] (-388.765) (-388.250) -- 0:00:48
      339500 -- (-388.297) (-386.683) (-385.917) [-386.257] * (-387.443) (-391.670) (-386.256) [-386.465] -- 0:00:48
      340000 -- (-388.359) (-386.404) (-386.613) [-387.350] * (-386.691) [-386.946] (-388.610) (-387.689) -- 0:00:48

      Average standard deviation of split frequencies: 0.013761

      340500 -- (-386.753) (-387.847) (-386.776) [-387.190] * [-386.350] (-387.415) (-387.073) (-390.552) -- 0:00:48
      341000 -- (-386.441) [-386.824] (-385.812) (-387.879) * (-386.455) (-388.585) [-387.599] (-387.342) -- 0:00:48
      341500 -- (-393.687) (-388.160) [-389.369] (-387.312) * [-388.135] (-388.287) (-385.513) (-388.799) -- 0:00:48
      342000 -- (-388.428) (-387.155) (-386.900) [-386.101] * [-386.590] (-390.809) (-389.125) (-387.648) -- 0:00:48
      342500 -- [-386.833] (-388.918) (-385.286) (-386.319) * (-386.460) (-385.881) [-385.246] (-387.579) -- 0:00:47
      343000 -- (-386.869) [-388.867] (-386.061) (-387.552) * (-388.071) (-387.000) [-386.611] (-386.623) -- 0:00:47
      343500 -- (-386.214) (-390.002) [-388.937] (-386.221) * (-387.887) (-388.856) [-386.796] (-385.339) -- 0:00:47
      344000 -- [-387.281] (-387.140) (-385.902) (-388.888) * (-385.771) [-386.063] (-389.032) (-389.283) -- 0:00:47
      344500 -- (-385.924) [-384.862] (-387.495) (-388.169) * (-391.591) (-386.280) [-387.597] (-391.461) -- 0:00:47
      345000 -- (-388.112) [-388.793] (-388.061) (-387.652) * (-386.495) (-387.521) (-386.835) [-389.874] -- 0:00:47

      Average standard deviation of split frequencies: 0.012983

      345500 -- [-386.679] (-385.822) (-391.694) (-394.691) * [-387.985] (-388.452) (-387.914) (-389.310) -- 0:00:47
      346000 -- [-386.873] (-391.877) (-394.403) (-389.939) * (-389.498) [-385.960] (-388.523) (-385.516) -- 0:00:47
      346500 -- [-390.516] (-386.732) (-388.022) (-386.137) * (-389.135) [-389.271] (-387.185) (-390.157) -- 0:00:47
      347000 -- (-392.670) [-386.443] (-387.737) (-388.264) * (-388.239) (-387.653) (-388.270) [-385.760] -- 0:00:48
      347500 -- (-392.385) (-385.247) [-387.030] (-388.187) * (-387.677) (-385.402) (-386.090) [-385.894] -- 0:00:48
      348000 -- [-389.212] (-387.110) (-390.232) (-387.848) * (-387.397) [-386.736] (-389.669) (-386.539) -- 0:00:48
      348500 -- (-391.335) (-391.815) [-387.322] (-387.380) * (-385.616) [-387.826] (-388.685) (-385.901) -- 0:00:48
      349000 -- (-389.394) (-385.983) [-390.147] (-389.193) * (-387.330) (-386.191) [-386.254] (-386.214) -- 0:00:48
      349500 -- (-387.334) (-386.861) (-389.252) [-388.598] * (-392.161) (-387.364) [-387.238] (-385.171) -- 0:00:48
      350000 -- (-385.785) (-392.923) (-387.792) [-385.809] * [-387.675] (-385.185) (-386.958) (-390.926) -- 0:00:48

      Average standard deviation of split frequencies: 0.013759

      350500 -- (-386.827) (-387.613) (-387.416) [-385.124] * (-391.405) (-387.815) (-389.396) [-386.280] -- 0:00:48
      351000 -- [-385.636] (-387.015) (-387.516) (-387.937) * (-390.797) [-387.207] (-386.260) (-385.051) -- 0:00:48
      351500 -- (-388.384) [-389.546] (-385.774) (-387.150) * (-386.799) (-386.470) (-386.431) [-388.593] -- 0:00:47
      352000 -- (-389.794) (-387.148) (-386.465) [-388.427] * (-386.474) (-385.769) (-386.794) [-387.404] -- 0:00:47
      352500 -- (-387.638) (-387.514) [-388.153] (-387.264) * [-387.964] (-386.115) (-386.372) (-389.864) -- 0:00:47
      353000 -- (-386.127) [-386.885] (-385.920) (-386.603) * (-389.279) [-385.802] (-385.646) (-387.739) -- 0:00:47
      353500 -- [-385.936] (-388.172) (-385.943) (-386.155) * (-390.252) (-387.598) [-385.244] (-385.625) -- 0:00:47
      354000 -- (-389.156) [-388.183] (-387.177) (-385.937) * (-389.038) [-387.191] (-385.990) (-386.607) -- 0:00:47
      354500 -- (-387.544) (-391.106) [-386.742] (-389.108) * [-386.419] (-385.117) (-387.623) (-390.400) -- 0:00:47
      355000 -- (-387.991) [-386.809] (-387.753) (-390.508) * (-387.289) [-386.167] (-386.063) (-394.238) -- 0:00:47

      Average standard deviation of split frequencies: 0.013320

      355500 -- (-386.464) (-387.448) (-385.302) [-386.688] * [-387.762] (-385.557) (-388.683) (-388.835) -- 0:00:47
      356000 -- (-386.514) (-388.637) (-386.011) [-389.140] * (-388.766) (-386.562) (-385.825) [-387.432] -- 0:00:47
      356500 -- (-387.190) [-386.168] (-386.287) (-387.583) * (-386.363) (-385.687) (-386.386) [-386.096] -- 0:00:46
      357000 -- (-386.498) [-385.521] (-385.259) (-387.297) * (-385.313) (-386.188) [-385.618] (-387.764) -- 0:00:46
      357500 -- (-387.115) (-387.667) (-388.713) [-385.761] * [-388.329] (-392.074) (-387.177) (-388.564) -- 0:00:46
      358000 -- (-387.510) [-387.449] (-387.111) (-386.711) * (-388.535) (-393.721) (-386.222) [-385.004] -- 0:00:46
      358500 -- (-386.546) (-386.450) [-388.177] (-386.564) * (-384.961) (-393.116) [-386.464] (-385.540) -- 0:00:46
      359000 -- [-394.100] (-386.995) (-386.778) (-387.129) * (-384.911) (-385.529) [-388.585] (-385.591) -- 0:00:46
      359500 -- (-388.182) [-386.985] (-386.271) (-387.824) * [-385.813] (-386.691) (-386.575) (-386.118) -- 0:00:46
      360000 -- [-387.087] (-387.157) (-387.202) (-386.533) * (-388.981) (-388.349) [-387.068] (-389.742) -- 0:00:46

      Average standard deviation of split frequencies: 0.013762

      360500 -- (-391.126) [-389.192] (-385.889) (-387.311) * (-392.865) (-386.323) [-387.135] (-387.692) -- 0:00:46
      361000 -- (-386.768) (-388.546) (-386.312) [-385.946] * (-385.787) [-385.319] (-388.270) (-386.279) -- 0:00:46
      361500 -- (-386.283) (-385.281) (-386.826) [-386.878] * (-386.581) [-387.612] (-387.185) (-387.110) -- 0:00:47
      362000 -- (-389.270) (-385.127) [-386.990] (-386.004) * (-386.358) (-387.501) [-387.012] (-390.072) -- 0:00:47
      362500 -- (-386.117) [-388.023] (-388.800) (-386.196) * [-388.354] (-393.595) (-385.027) (-384.932) -- 0:00:47
      363000 -- (-390.211) (-388.172) (-388.080) [-388.710] * (-388.740) [-389.048] (-388.290) (-385.611) -- 0:00:47
      363500 -- (-387.028) (-387.225) (-391.011) [-390.688] * (-385.861) [-389.564] (-389.015) (-386.344) -- 0:00:47
      364000 -- (-387.724) (-388.035) [-385.824] (-389.523) * (-390.811) (-388.510) [-389.256] (-394.749) -- 0:00:47
      364500 -- [-386.211] (-385.337) (-391.415) (-388.410) * [-385.656] (-388.520) (-388.138) (-387.762) -- 0:00:47
      365000 -- [-385.234] (-388.757) (-386.070) (-389.258) * [-385.847] (-387.885) (-389.742) (-387.737) -- 0:00:46

      Average standard deviation of split frequencies: 0.014016

      365500 -- [-386.087] (-391.468) (-387.564) (-388.232) * (-385.265) [-385.661] (-387.605) (-387.361) -- 0:00:46
      366000 -- (-385.198) (-386.384) [-385.766] (-387.604) * (-388.990) [-385.933] (-389.345) (-390.140) -- 0:00:46
      366500 -- (-388.113) (-385.283) (-392.169) [-387.639] * (-390.042) (-389.799) (-384.994) [-386.381] -- 0:00:46
      367000 -- (-387.196) [-386.279] (-385.032) (-387.410) * [-388.715] (-387.844) (-388.321) (-387.641) -- 0:00:46
      367500 -- (-386.407) [-386.585] (-389.521) (-393.545) * (-386.711) [-387.151] (-387.962) (-385.479) -- 0:00:46
      368000 -- [-388.662] (-386.741) (-386.201) (-388.595) * (-385.339) (-386.434) [-385.699] (-385.532) -- 0:00:46
      368500 -- (-386.074) (-386.318) [-387.967] (-385.544) * (-384.960) [-388.943] (-386.806) (-386.444) -- 0:00:46
      369000 -- (-387.462) (-386.126) [-386.493] (-385.550) * (-385.781) (-385.170) [-385.722] (-386.528) -- 0:00:46
      369500 -- [-386.133] (-386.716) (-386.746) (-388.134) * [-395.001] (-387.903) (-386.365) (-392.873) -- 0:00:46
      370000 -- (-387.524) (-387.477) [-386.042] (-394.219) * [-388.300] (-386.475) (-389.794) (-387.613) -- 0:00:45

      Average standard deviation of split frequencies: 0.014289

      370500 -- (-385.848) (-386.535) [-388.139] (-392.335) * (-387.322) [-387.068] (-387.699) (-387.294) -- 0:00:45
      371000 -- (-388.976) (-389.074) (-388.054) [-387.085] * (-385.719) (-387.069) [-387.787] (-385.966) -- 0:00:45
      371500 -- (-386.212) (-385.290) (-387.233) [-385.320] * [-386.563] (-385.849) (-387.850) (-388.982) -- 0:00:45
      372000 -- (-385.534) (-388.429) (-386.699) [-386.527] * (-390.170) (-386.018) [-386.396] (-390.858) -- 0:00:45
      372500 -- (-387.322) (-385.199) [-387.655] (-385.965) * (-385.686) (-388.232) (-386.978) [-387.517] -- 0:00:45
      373000 -- (-385.529) [-386.029] (-385.758) (-385.526) * (-386.983) (-386.469) (-388.758) [-390.138] -- 0:00:45
      373500 -- (-385.636) (-389.400) [-385.787] (-385.235) * [-385.964] (-386.975) (-386.331) (-387.850) -- 0:00:45
      374000 -- (-386.166) [-388.709] (-386.307) (-388.050) * (-386.602) (-390.223) [-385.255] (-389.246) -- 0:00:45
      374500 -- (-386.923) [-387.074] (-386.270) (-387.650) * (-387.310) (-389.952) [-386.460] (-388.845) -- 0:00:45
      375000 -- [-386.044] (-385.084) (-385.606) (-389.445) * (-387.021) (-387.957) (-388.619) [-386.622] -- 0:00:45

      Average standard deviation of split frequencies: 0.014529

      375500 -- [-385.365] (-387.159) (-388.159) (-386.496) * (-388.172) (-386.497) [-387.470] (-385.746) -- 0:00:46
      376000 -- [-388.639] (-386.825) (-387.293) (-388.753) * (-389.589) (-386.034) [-388.041] (-388.136) -- 0:00:46
      376500 -- (-386.345) (-386.669) [-388.376] (-389.193) * (-388.649) (-389.886) [-389.695] (-386.641) -- 0:00:46
      377000 -- [-387.945] (-389.969) (-387.496) (-385.245) * (-386.035) (-389.500) (-387.349) [-385.978] -- 0:00:46
      377500 -- (-386.585) [-390.356] (-388.055) (-386.595) * (-387.234) [-387.469] (-386.837) (-388.629) -- 0:00:46
      378000 -- (-386.856) (-387.501) (-386.573) [-386.851] * (-389.122) (-386.469) (-393.394) [-387.017] -- 0:00:46
      378500 -- (-392.981) (-385.328) (-390.098) [-386.882] * (-385.593) [-390.460] (-391.552) (-386.256) -- 0:00:45
      379000 -- (-385.294) (-387.011) (-388.859) [-386.162] * (-392.178) (-386.213) (-389.260) [-387.192] -- 0:00:45
      379500 -- (-386.554) [-385.728] (-387.083) (-387.312) * (-392.185) (-385.002) [-386.610] (-385.541) -- 0:00:45
      380000 -- (-388.401) (-385.710) (-387.767) [-385.893] * (-388.369) [-386.015] (-386.138) (-385.596) -- 0:00:45

      Average standard deviation of split frequencies: 0.015079

      380500 -- (-387.038) (-386.004) (-387.726) [-385.871] * [-391.155] (-384.680) (-386.691) (-393.190) -- 0:00:45
      381000 -- (-386.033) (-385.298) [-387.944] (-387.677) * (-388.359) (-386.493) [-385.997] (-387.192) -- 0:00:45
      381500 -- (-387.155) (-392.887) (-385.809) [-387.302] * [-385.478] (-390.261) (-393.567) (-387.298) -- 0:00:45
      382000 -- (-388.026) (-391.197) (-386.902) [-390.066] * [-385.186] (-389.663) (-388.107) (-386.830) -- 0:00:45
      382500 -- [-394.788] (-386.394) (-390.142) (-385.460) * (-386.426) (-387.258) (-391.050) [-390.379] -- 0:00:45
      383000 -- (-390.540) (-391.454) (-387.799) [-386.384] * (-390.195) [-385.692] (-387.797) (-388.843) -- 0:00:45
      383500 -- (-387.086) (-385.379) [-388.078] (-385.030) * (-390.422) (-385.133) (-387.772) [-387.568] -- 0:00:45
      384000 -- (-385.026) (-386.236) (-386.555) [-385.043] * (-387.840) (-385.282) (-389.567) [-387.087] -- 0:00:44
      384500 -- (-386.883) [-386.107] (-387.108) (-387.723) * (-385.924) (-386.351) [-386.250] (-388.878) -- 0:00:44
      385000 -- [-386.303] (-388.330) (-389.942) (-386.555) * (-389.784) (-386.257) (-388.490) [-386.059] -- 0:00:44

      Average standard deviation of split frequencies: 0.015733

      385500 -- [-386.882] (-386.761) (-391.510) (-390.588) * [-388.730] (-390.969) (-387.505) (-384.896) -- 0:00:44
      386000 -- [-385.528] (-386.027) (-389.069) (-387.005) * (-385.504) (-389.836) (-387.052) [-385.310] -- 0:00:44
      386500 -- (-387.503) (-387.525) [-390.922] (-387.724) * (-387.095) [-386.494] (-385.803) (-387.775) -- 0:00:44
      387000 -- [-388.140] (-387.025) (-390.162) (-385.591) * [-386.716] (-386.933) (-387.639) (-387.885) -- 0:00:44
      387500 -- [-386.130] (-386.546) (-387.387) (-384.970) * (-389.715) (-390.498) (-388.226) [-386.302] -- 0:00:44
      388000 -- [-386.279] (-388.217) (-388.446) (-387.331) * [-387.068] (-389.291) (-386.536) (-385.197) -- 0:00:44
      388500 -- (-387.617) (-385.988) [-385.890] (-388.340) * (-388.373) (-387.497) [-385.653] (-388.602) -- 0:00:44
      389000 -- (-386.803) [-389.031] (-386.142) (-385.814) * (-390.485) (-388.235) (-385.716) [-386.193] -- 0:00:43
      389500 -- (-387.501) (-386.098) [-385.960] (-386.517) * (-385.329) (-387.608) [-386.388] (-386.499) -- 0:00:45
      390000 -- [-387.483] (-388.024) (-386.355) (-386.156) * [-388.004] (-389.288) (-387.046) (-386.740) -- 0:00:45

      Average standard deviation of split frequencies: 0.014254

      390500 -- (-390.328) (-388.517) (-386.395) [-388.525] * [-386.137] (-390.310) (-386.447) (-385.540) -- 0:00:45
      391000 -- [-387.276] (-390.757) (-387.145) (-386.420) * (-391.061) (-385.337) [-386.573] (-385.507) -- 0:00:45
      391500 -- [-386.924] (-385.802) (-387.256) (-386.741) * [-386.709] (-390.743) (-386.554) (-388.102) -- 0:00:45
      392000 -- (-385.826) (-387.884) [-386.291] (-385.317) * (-387.496) (-396.336) (-386.478) [-386.973] -- 0:00:44
      392500 -- (-385.228) (-389.173) [-386.374] (-385.741) * (-386.981) (-386.744) (-386.932) [-385.769] -- 0:00:44
      393000 -- [-387.070] (-389.852) (-389.271) (-389.447) * (-390.127) (-390.622) (-385.338) [-389.455] -- 0:00:44
      393500 -- (-386.796) (-386.678) (-389.662) [-388.066] * (-386.259) (-384.942) (-386.790) [-387.748] -- 0:00:44
      394000 -- (-385.547) (-385.524) (-387.941) [-385.971] * (-390.742) [-387.503] (-386.729) (-394.401) -- 0:00:44
      394500 -- [-385.025] (-385.757) (-398.212) (-385.934) * (-388.569) (-387.115) [-387.567] (-389.602) -- 0:00:44
      395000 -- (-385.385) [-386.037] (-399.227) (-388.672) * (-388.142) (-385.891) [-389.270] (-385.719) -- 0:00:44

      Average standard deviation of split frequencies: 0.014136

      395500 -- (-387.460) (-385.718) (-390.021) [-387.531] * (-387.424) [-385.612] (-389.078) (-388.642) -- 0:00:44
      396000 -- (-389.006) [-387.113] (-386.768) (-387.082) * (-386.255) (-388.027) (-385.587) [-387.438] -- 0:00:44
      396500 -- (-388.475) (-390.452) [-385.178] (-387.791) * (-389.897) (-393.796) [-385.284] (-387.699) -- 0:00:44
      397000 -- (-387.312) (-385.403) (-387.965) [-384.998] * [-391.561] (-388.700) (-386.337) (-387.316) -- 0:00:44
      397500 -- (-386.933) (-388.741) [-385.931] (-385.013) * (-385.756) (-386.999) [-386.276] (-386.878) -- 0:00:43
      398000 -- (-385.620) (-386.005) [-386.654] (-388.571) * (-386.429) (-396.463) [-386.009] (-386.362) -- 0:00:43
      398500 -- [-386.054] (-387.826) (-387.103) (-388.258) * (-388.556) (-390.418) [-385.850] (-389.203) -- 0:00:43
      399000 -- (-387.267) [-386.552] (-389.744) (-388.385) * (-386.166) (-390.756) [-388.122] (-385.810) -- 0:00:43
      399500 -- [-387.349] (-386.804) (-387.841) (-389.103) * [-388.172] (-393.897) (-387.982) (-385.854) -- 0:00:43
      400000 -- (-386.526) (-388.683) [-385.991] (-387.573) * (-384.943) (-389.561) (-386.646) [-385.665] -- 0:00:43

      Average standard deviation of split frequencies: 0.013457

      400500 -- (-386.992) (-384.981) [-390.188] (-387.402) * (-386.044) [-388.887] (-389.968) (-386.694) -- 0:00:43
      401000 -- [-387.001] (-388.672) (-390.907) (-387.208) * (-386.038) (-387.304) [-386.570] (-389.786) -- 0:00:43
      401500 -- (-385.629) [-386.284] (-391.124) (-388.634) * (-388.457) (-385.638) [-385.765] (-390.435) -- 0:00:43
      402000 -- [-385.914] (-385.666) (-387.038) (-388.428) * [-389.421] (-385.456) (-388.683) (-387.773) -- 0:00:43
      402500 -- (-385.382) (-386.861) (-387.987) [-385.801] * (-386.677) (-387.492) (-389.423) [-388.628] -- 0:00:43
      403000 -- (-384.898) [-386.236] (-385.282) (-385.248) * [-387.595] (-389.983) (-387.755) (-389.410) -- 0:00:42
      403500 -- (-386.254) [-389.282] (-388.830) (-385.396) * (-385.090) (-389.298) (-390.625) [-387.174] -- 0:00:44
      404000 -- (-386.098) (-390.665) (-389.225) [-387.995] * (-385.350) (-385.620) (-386.411) [-385.862] -- 0:00:44
      404500 -- (-385.896) (-392.916) [-386.690] (-388.350) * (-386.023) (-389.133) [-386.367] (-388.131) -- 0:00:44
      405000 -- (-388.082) (-392.397) [-387.099] (-388.645) * (-386.021) (-388.768) [-385.850] (-386.360) -- 0:00:44

      Average standard deviation of split frequencies: 0.014206

      405500 -- (-388.782) [-387.848] (-387.511) (-386.496) * (-386.393) [-386.452] (-386.216) (-386.338) -- 0:00:43
      406000 -- (-387.064) (-386.466) (-386.469) [-387.618] * (-387.017) (-387.341) [-386.808] (-388.774) -- 0:00:43
      406500 -- (-389.063) [-385.901] (-387.900) (-390.525) * (-391.182) (-389.839) [-388.850] (-387.624) -- 0:00:43
      407000 -- [-385.544] (-385.528) (-387.808) (-389.460) * (-389.227) (-388.036) (-388.459) [-385.671] -- 0:00:43
      407500 -- (-386.346) (-385.167) [-386.605] (-392.636) * [-389.842] (-386.437) (-388.492) (-386.446) -- 0:00:43
      408000 -- (-386.720) [-388.990] (-386.373) (-388.972) * (-386.991) (-388.855) [-386.752] (-389.056) -- 0:00:43
      408500 -- (-388.925) (-389.995) (-386.190) [-385.453] * (-389.541) (-387.658) (-387.478) [-387.401] -- 0:00:43
      409000 -- [-387.916] (-386.639) (-387.874) (-384.948) * [-388.135] (-388.303) (-388.522) (-387.769) -- 0:00:43
      409500 -- (-388.762) (-385.529) (-385.977) [-388.712] * [-389.761] (-390.837) (-385.612) (-387.797) -- 0:00:43
      410000 -- (-386.863) [-387.705] (-384.886) (-388.747) * (-387.646) [-390.813] (-386.937) (-388.156) -- 0:00:43

      Average standard deviation of split frequencies: 0.014383

      410500 -- (-390.862) (-388.115) [-386.165] (-386.541) * [-387.040] (-391.618) (-391.732) (-385.625) -- 0:00:43
      411000 -- (-390.573) (-387.365) [-385.777] (-388.340) * [-386.119] (-385.688) (-391.980) (-388.256) -- 0:00:42
      411500 -- (-387.857) (-386.650) [-384.954] (-386.811) * [-386.140] (-390.595) (-387.879) (-388.564) -- 0:00:42
      412000 -- (-388.540) (-387.362) (-387.455) [-385.910] * (-385.386) (-386.237) [-393.205] (-388.598) -- 0:00:42
      412500 -- (-386.141) (-386.654) (-390.608) [-386.926] * (-390.199) (-386.569) (-387.982) [-387.116] -- 0:00:42
      413000 -- (-390.082) [-386.246] (-386.244) (-391.257) * (-386.459) (-386.591) [-386.084] (-386.915) -- 0:00:42
      413500 -- [-387.700] (-387.329) (-385.936) (-387.373) * [-386.706] (-386.847) (-388.325) (-385.739) -- 0:00:42
      414000 -- (-389.049) (-385.348) (-387.544) [-387.142] * [-386.020] (-385.230) (-387.008) (-387.051) -- 0:00:42
      414500 -- [-387.139] (-386.192) (-388.165) (-385.938) * (-385.512) [-387.306] (-387.196) (-386.079) -- 0:00:42
      415000 -- [-387.548] (-386.502) (-388.611) (-386.921) * [-386.299] (-385.511) (-386.273) (-388.613) -- 0:00:42

      Average standard deviation of split frequencies: 0.013527

      415500 -- (-386.105) [-386.414] (-386.611) (-391.607) * (-385.731) (-387.589) (-391.267) [-386.288] -- 0:00:42
      416000 -- [-385.923] (-387.139) (-387.800) (-389.357) * [-387.652] (-384.999) (-390.899) (-387.157) -- 0:00:42
      416500 -- (-385.889) (-387.478) [-388.784] (-387.566) * (-386.068) (-385.729) [-387.775] (-385.770) -- 0:00:42
      417000 -- (-388.382) (-389.544) (-388.949) [-386.818] * (-389.336) [-390.222] (-387.731) (-386.560) -- 0:00:41
      417500 -- (-389.073) (-392.089) (-385.704) [-386.467] * (-388.802) (-385.890) [-385.921] (-388.336) -- 0:00:41
      418000 -- (-387.337) (-387.987) (-385.475) [-386.463] * [-384.922] (-387.668) (-389.636) (-385.656) -- 0:00:43
      418500 -- (-386.799) (-388.543) [-387.224] (-387.680) * (-385.649) (-387.389) [-385.710] (-386.241) -- 0:00:43
      419000 -- (-389.694) (-388.726) [-388.557] (-387.079) * [-385.288] (-389.181) (-385.535) (-393.172) -- 0:00:42
      419500 -- (-386.467) (-385.505) [-388.213] (-387.865) * (-386.318) (-387.335) [-388.843] (-388.951) -- 0:00:42
      420000 -- (-387.832) (-386.807) (-388.655) [-388.353] * (-386.356) (-390.128) [-389.098] (-386.644) -- 0:00:42

      Average standard deviation of split frequencies: 0.014218

      420500 -- (-388.407) [-387.224] (-389.037) (-386.948) * (-388.421) [-391.076] (-386.330) (-390.314) -- 0:00:42
      421000 -- (-387.947) (-385.509) (-386.664) [-384.833] * [-391.996] (-387.568) (-386.782) (-388.535) -- 0:00:42
      421500 -- (-388.358) (-388.413) [-385.623] (-386.230) * (-386.619) (-388.387) (-391.767) [-387.254] -- 0:00:42
      422000 -- [-385.295] (-387.974) (-388.123) (-386.080) * (-385.820) (-389.300) (-389.834) [-385.899] -- 0:00:42
      422500 -- (-387.434) (-385.744) [-388.208] (-385.196) * [-386.191] (-391.455) (-385.494) (-387.565) -- 0:00:42
      423000 -- (-394.435) [-388.567] (-385.784) (-387.184) * (-388.204) (-391.056) [-388.189] (-389.276) -- 0:00:42
      423500 -- (-387.971) [-385.143] (-385.249) (-389.989) * [-387.037] (-389.073) (-392.505) (-388.503) -- 0:00:42
      424000 -- (-386.202) (-385.581) [-386.675] (-387.330) * (-387.581) (-386.611) (-391.114) [-386.517] -- 0:00:42
      424500 -- [-386.554] (-389.278) (-386.620) (-388.174) * (-385.397) (-391.249) [-387.176] (-389.760) -- 0:00:42
      425000 -- (-385.748) (-389.738) [-387.910] (-387.683) * [-385.804] (-388.561) (-385.120) (-384.870) -- 0:00:41

      Average standard deviation of split frequencies: 0.015232

      425500 -- (-385.376) (-386.547) (-385.890) [-386.115] * (-386.833) (-388.656) (-389.127) [-387.797] -- 0:00:41
      426000 -- [-385.645] (-386.978) (-386.233) (-385.297) * [-388.390] (-387.447) (-386.011) (-389.688) -- 0:00:41
      426500 -- (-386.638) (-389.627) (-388.654) [-386.213] * [-388.839] (-386.424) (-389.642) (-394.218) -- 0:00:41
      427000 -- (-390.063) [-390.947] (-387.763) (-388.938) * (-385.760) (-387.641) (-385.589) [-385.621] -- 0:00:41
      427500 -- (-387.791) [-387.586] (-385.747) (-389.344) * (-386.316) (-386.412) [-385.394] (-387.370) -- 0:00:41
      428000 -- (-387.968) [-390.510] (-389.375) (-386.351) * (-386.003) (-389.438) [-385.548] (-386.442) -- 0:00:41
      428500 -- [-385.660] (-389.794) (-385.360) (-388.318) * (-385.533) (-385.725) [-387.071] (-386.904) -- 0:00:41
      429000 -- (-387.530) (-388.717) [-385.636] (-388.024) * (-387.349) (-387.747) (-387.510) [-385.302] -- 0:00:41
      429500 -- (-385.869) (-387.888) [-388.154] (-386.203) * (-387.643) (-388.298) [-385.480] (-389.363) -- 0:00:41
      430000 -- (-388.036) (-389.473) [-389.112] (-387.398) * (-389.630) [-386.201] (-386.604) (-385.743) -- 0:00:41

      Average standard deviation of split frequencies: 0.015196

      430500 -- (-387.266) (-384.967) (-386.363) [-388.442] * (-387.408) (-385.593) [-387.677] (-389.904) -- 0:00:41
      431000 -- (-390.448) (-389.418) (-389.682) [-387.230] * (-387.858) (-390.137) (-392.122) [-387.277] -- 0:00:40
      431500 -- [-386.270] (-385.507) (-386.594) (-387.513) * (-387.970) (-386.941) (-389.176) [-388.053] -- 0:00:40
      432000 -- (-386.057) (-389.178) [-386.738] (-386.491) * (-386.634) (-387.582) (-389.579) [-387.954] -- 0:00:40
      432500 -- (-387.619) [-390.729] (-387.763) (-391.345) * [-385.767] (-386.472) (-387.007) (-387.583) -- 0:00:41
      433000 -- (-385.676) [-385.518] (-388.770) (-387.550) * (-387.577) (-388.943) [-384.783] (-386.466) -- 0:00:41
      433500 -- [-386.034] (-389.575) (-387.605) (-394.282) * [-388.563] (-387.590) (-385.633) (-384.811) -- 0:00:41
      434000 -- (-385.995) (-386.290) [-387.461] (-392.206) * (-387.098) [-386.879] (-387.314) (-389.605) -- 0:00:41
      434500 -- (-385.324) (-387.338) [-385.516] (-388.548) * (-388.023) [-386.609] (-386.327) (-389.148) -- 0:00:41
      435000 -- (-388.894) (-386.487) [-388.501] (-388.342) * (-386.470) (-385.630) [-389.960] (-390.176) -- 0:00:41

      Average standard deviation of split frequencies: 0.014799

      435500 -- (-392.129) [-389.178] (-385.249) (-392.503) * [-387.631] (-386.509) (-390.408) (-386.914) -- 0:00:41
      436000 -- (-385.441) [-385.138] (-388.724) (-388.848) * [-385.507] (-385.595) (-388.350) (-386.644) -- 0:00:41
      436500 -- (-386.387) (-385.792) [-387.148] (-386.934) * [-389.773] (-390.671) (-387.768) (-386.869) -- 0:00:41
      437000 -- (-386.829) (-388.432) [-385.666] (-387.289) * (-386.817) (-386.692) (-387.995) [-385.152] -- 0:00:41
      437500 -- (-385.341) (-388.933) [-387.385] (-387.217) * (-386.750) [-384.798] (-388.012) (-385.404) -- 0:00:41
      438000 -- (-385.531) [-386.525] (-385.224) (-385.014) * (-386.557) (-386.093) (-387.185) [-385.635] -- 0:00:41
      438500 -- (-387.408) (-387.311) [-385.856] (-386.575) * (-387.443) (-391.552) [-385.073] (-387.068) -- 0:00:40
      439000 -- (-387.003) [-387.307] (-386.516) (-387.485) * (-385.773) (-387.319) (-392.451) [-388.135] -- 0:00:40
      439500 -- (-386.335) (-392.833) [-386.848] (-386.158) * (-393.535) (-387.222) [-387.889] (-388.864) -- 0:00:40
      440000 -- [-385.275] (-389.082) (-385.669) (-386.920) * (-390.682) [-389.622] (-385.498) (-390.553) -- 0:00:40

      Average standard deviation of split frequencies: 0.015190

      440500 -- (-385.906) [-386.620] (-389.938) (-387.786) * (-389.639) (-390.734) [-385.451] (-388.602) -- 0:00:40
      441000 -- (-388.254) (-386.533) [-389.726] (-389.713) * [-389.097] (-387.342) (-388.783) (-390.044) -- 0:00:40
      441500 -- [-386.237] (-388.343) (-389.308) (-387.396) * (-389.478) (-386.989) [-387.494] (-388.705) -- 0:00:40
      442000 -- (-387.498) [-385.809] (-387.295) (-385.295) * (-386.415) [-386.107] (-387.678) (-387.799) -- 0:00:40
      442500 -- (-387.193) (-386.562) [-386.954] (-385.663) * (-385.569) (-390.938) [-385.625] (-386.682) -- 0:00:40
      443000 -- (-388.106) (-388.649) [-385.245] (-390.108) * (-386.446) (-387.637) (-386.470) [-386.293] -- 0:00:40
      443500 -- (-386.445) (-386.150) [-386.830] (-387.655) * (-386.158) (-388.463) (-388.257) [-385.620] -- 0:00:40
      444000 -- (-389.698) [-388.388] (-386.771) (-385.570) * [-385.692] (-386.803) (-387.507) (-386.327) -- 0:00:40
      444500 -- (-387.335) [-386.419] (-388.248) (-390.020) * (-386.155) (-389.587) (-387.145) [-388.269] -- 0:00:39
      445000 -- (-385.168) (-386.749) [-386.840] (-388.290) * [-386.636] (-386.890) (-385.942) (-386.803) -- 0:00:39

      Average standard deviation of split frequencies: 0.015788

      445500 -- (-385.078) (-388.282) [-386.963] (-385.954) * (-387.919) (-385.889) (-385.575) [-388.489] -- 0:00:39
      446000 -- (-387.869) (-389.646) (-393.610) [-388.140] * (-386.687) [-385.415] (-388.283) (-388.789) -- 0:00:39
      446500 -- (-387.574) (-385.956) (-388.836) [-385.443] * (-387.479) (-388.829) [-389.556] (-388.314) -- 0:00:40
      447000 -- (-386.048) (-387.632) [-388.969] (-385.853) * [-387.383] (-387.449) (-386.128) (-387.578) -- 0:00:40
      447500 -- [-388.275] (-386.518) (-386.046) (-388.150) * (-387.099) [-386.857] (-387.412) (-388.672) -- 0:00:40
      448000 -- (-386.370) (-388.379) [-387.555] (-384.703) * (-387.867) (-386.345) [-386.777] (-389.737) -- 0:00:40
      448500 -- [-389.640] (-389.276) (-385.727) (-385.988) * (-385.645) (-385.887) (-386.154) [-386.937] -- 0:00:40
      449000 -- (-386.442) [-386.291] (-386.425) (-389.172) * [-388.938] (-386.212) (-392.534) (-391.146) -- 0:00:40
      449500 -- (-388.089) (-386.642) (-392.332) [-387.981] * (-390.264) [-386.644] (-387.007) (-387.035) -- 0:00:40
      450000 -- (-386.533) (-387.204) [-385.525] (-385.991) * [-387.471] (-386.931) (-387.685) (-385.294) -- 0:00:40

      Average standard deviation of split frequencies: 0.015102

      450500 -- [-385.778] (-385.546) (-385.833) (-386.034) * [-387.244] (-389.866) (-389.810) (-387.051) -- 0:00:40
      451000 -- (-385.919) (-386.997) (-386.628) [-385.747] * (-387.841) [-385.877] (-389.149) (-387.184) -- 0:00:40
      451500 -- (-386.920) (-387.965) (-386.500) [-385.926] * [-387.139] (-386.709) (-388.029) (-385.812) -- 0:00:40
      452000 -- (-386.119) (-385.757) [-390.874] (-391.672) * (-387.273) (-387.723) [-385.371] (-386.327) -- 0:00:40
      452500 -- (-385.519) (-385.289) (-387.332) [-384.950] * (-387.342) (-388.022) [-386.124] (-387.461) -- 0:00:39
      453000 -- (-387.179) (-385.987) [-386.196] (-386.979) * (-389.029) [-388.087] (-386.527) (-387.856) -- 0:00:39
      453500 -- (-387.153) [-386.732] (-385.287) (-387.465) * (-386.172) [-387.023] (-386.877) (-385.320) -- 0:00:39
      454000 -- (-387.761) [-387.264] (-388.219) (-386.558) * (-387.141) (-387.589) (-385.858) [-385.616] -- 0:00:39
      454500 -- [-388.575] (-387.598) (-386.720) (-391.005) * (-387.199) [-387.384] (-385.624) (-386.310) -- 0:00:39
      455000 -- [-385.847] (-386.755) (-387.012) (-386.152) * (-387.961) (-387.510) [-387.766] (-385.705) -- 0:00:39

      Average standard deviation of split frequencies: 0.015093

      455500 -- [-385.466] (-388.660) (-387.951) (-392.368) * (-387.937) [-386.392] (-386.486) (-387.191) -- 0:00:39
      456000 -- (-388.060) [-385.574] (-388.256) (-386.873) * (-385.730) [-385.332] (-386.832) (-393.638) -- 0:00:39
      456500 -- (-388.590) (-389.715) [-389.049] (-392.260) * (-385.946) (-385.891) (-386.388) [-386.025] -- 0:00:39
      457000 -- (-388.862) (-389.629) (-390.659) [-386.635] * (-386.615) (-387.397) [-386.992] (-386.552) -- 0:00:39
      457500 -- [-385.970] (-388.293) (-389.908) (-389.384) * [-384.927] (-387.184) (-389.724) (-386.389) -- 0:00:39
      458000 -- (-386.335) (-389.628) (-385.253) [-385.976] * (-388.280) (-385.867) [-387.021] (-386.403) -- 0:00:39
      458500 -- (-391.013) (-390.124) (-389.266) [-385.835] * [-387.384] (-386.544) (-387.550) (-386.365) -- 0:00:38
      459000 -- (-393.070) [-387.927] (-391.501) (-387.136) * (-388.233) (-386.420) (-386.169) [-386.664] -- 0:00:38
      459500 -- (-393.859) [-388.561] (-389.084) (-387.570) * (-387.899) (-386.387) [-386.542] (-386.472) -- 0:00:39
      460000 -- [-387.056] (-393.536) (-389.753) (-386.346) * [-387.887] (-387.289) (-385.366) (-384.793) -- 0:00:39

      Average standard deviation of split frequencies: 0.016168

      460500 -- [-391.477] (-391.535) (-386.704) (-386.532) * (-391.749) [-386.340] (-386.049) (-385.553) -- 0:00:39
      461000 -- (-387.228) (-387.629) (-385.659) [-384.798] * (-391.757) (-390.263) [-385.049] (-385.710) -- 0:00:39
      461500 -- (-386.455) (-387.551) (-388.488) [-385.919] * (-387.039) (-387.918) [-387.784] (-388.134) -- 0:00:39
      462000 -- (-386.497) (-385.834) (-386.351) [-386.186] * (-388.998) (-386.344) [-386.887] (-386.941) -- 0:00:39
      462500 -- [-386.811] (-387.150) (-385.055) (-386.382) * (-385.946) (-385.349) [-386.857] (-389.747) -- 0:00:39
      463000 -- [-388.842] (-387.774) (-385.765) (-385.834) * [-386.782] (-385.811) (-388.818) (-386.490) -- 0:00:39
      463500 -- (-386.333) (-387.397) (-390.604) [-385.574] * (-386.449) [-389.170] (-386.255) (-386.582) -- 0:00:39
      464000 -- (-389.383) (-389.192) [-386.630] (-385.159) * (-385.597) (-385.604) [-386.138] (-386.372) -- 0:00:39
      464500 -- (-386.007) (-386.674) [-385.463] (-387.031) * (-389.227) [-388.739] (-385.769) (-389.096) -- 0:00:39
      465000 -- [-387.587] (-385.618) (-385.607) (-392.768) * (-388.662) (-388.571) [-385.614] (-386.338) -- 0:00:39

      Average standard deviation of split frequencies: 0.014795

      465500 -- [-385.506] (-390.929) (-385.680) (-387.529) * [-387.111] (-385.338) (-390.558) (-387.481) -- 0:00:39
      466000 -- (-390.457) [-386.281] (-387.327) (-387.141) * (-388.980) [-384.967] (-389.174) (-385.678) -- 0:00:38
      466500 -- (-386.610) (-386.170) (-387.070) [-385.588] * (-393.838) [-384.710] (-389.480) (-388.245) -- 0:00:38
      467000 -- (-384.989) (-388.619) [-385.903] (-386.532) * (-396.380) (-391.884) [-388.260] (-388.698) -- 0:00:38
      467500 -- (-386.908) (-388.492) [-389.782] (-387.427) * (-390.255) [-388.190] (-387.008) (-390.159) -- 0:00:38
      468000 -- [-385.995] (-388.032) (-387.077) (-386.228) * (-390.387) (-390.336) [-388.162] (-390.593) -- 0:00:38
      468500 -- (-386.357) [-386.912] (-388.193) (-387.755) * [-387.797] (-385.698) (-386.695) (-387.533) -- 0:00:38
      469000 -- (-391.123) (-385.855) [-386.138] (-385.075) * (-388.223) (-387.490) [-391.500] (-387.760) -- 0:00:38
      469500 -- (-386.285) (-387.630) [-386.239] (-387.811) * (-390.690) [-389.174] (-392.682) (-386.179) -- 0:00:38
      470000 -- [-385.808] (-385.534) (-386.331) (-388.223) * (-390.393) (-388.305) (-386.159) [-386.953] -- 0:00:38

      Average standard deviation of split frequencies: 0.014847

      470500 -- (-388.872) [-385.890] (-387.181) (-387.082) * [-389.231] (-387.614) (-386.901) (-386.203) -- 0:00:38
      471000 -- [-385.879] (-385.649) (-390.796) (-388.105) * (-385.971) [-386.463] (-386.127) (-386.016) -- 0:00:38
      471500 -- (-393.879) [-385.986] (-388.568) (-388.653) * [-385.907] (-386.882) (-385.303) (-386.300) -- 0:00:38
      472000 -- (-388.026) (-387.442) [-387.219] (-385.525) * (-387.687) (-386.622) (-387.488) [-389.301] -- 0:00:38
      472500 -- [-393.825] (-386.021) (-387.519) (-386.814) * (-387.459) (-385.682) [-386.537] (-386.023) -- 0:00:37
      473000 -- (-386.471) [-387.182] (-386.146) (-390.444) * [-385.471] (-385.394) (-386.754) (-385.913) -- 0:00:37
      473500 -- (-386.486) (-388.050) (-390.441) [-385.218] * [-386.037] (-386.159) (-386.900) (-387.868) -- 0:00:37
      474000 -- (-386.713) (-387.124) [-389.521] (-387.055) * (-387.623) [-388.997] (-387.376) (-387.800) -- 0:00:38
      474500 -- (-386.559) (-390.235) (-386.246) [-388.826] * (-388.180) (-385.987) (-387.646) [-389.173] -- 0:00:38
      475000 -- (-384.787) (-386.843) (-388.639) [-387.606] * (-386.840) (-385.601) (-387.642) [-387.281] -- 0:00:38

      Average standard deviation of split frequencies: 0.013927

      475500 -- (-387.390) [-386.865] (-388.232) (-388.915) * (-386.521) (-386.805) [-386.396] (-388.564) -- 0:00:38
      476000 -- [-386.651] (-387.105) (-387.620) (-386.754) * [-386.994] (-386.920) (-387.793) (-386.462) -- 0:00:38
      476500 -- [-385.987] (-393.381) (-388.695) (-387.373) * [-386.436] (-384.755) (-386.614) (-386.740) -- 0:00:38
      477000 -- (-389.305) (-388.079) (-390.503) [-387.678] * (-385.691) (-387.208) [-386.944] (-387.417) -- 0:00:38
      477500 -- [-387.754] (-389.404) (-387.186) (-387.292) * (-387.226) (-386.334) [-386.715] (-387.743) -- 0:00:38
      478000 -- (-386.636) [-387.005] (-391.728) (-387.000) * (-386.712) [-387.387] (-388.715) (-386.574) -- 0:00:38
      478500 -- (-387.699) (-387.313) (-388.153) [-385.418] * (-387.278) [-389.808] (-393.642) (-390.705) -- 0:00:38
      479000 -- (-386.555) (-387.737) [-385.808] (-386.391) * (-385.239) [-387.000] (-388.411) (-389.077) -- 0:00:38
      479500 -- (-386.939) [-386.443] (-387.165) (-386.949) * [-388.962] (-386.006) (-387.465) (-385.223) -- 0:00:37
      480000 -- [-385.966] (-385.319) (-387.581) (-388.175) * (-385.962) (-389.140) (-389.295) [-388.302] -- 0:00:37

      Average standard deviation of split frequencies: 0.013975

      480500 -- (-387.070) (-385.397) (-387.205) [-388.347] * (-385.300) (-386.268) [-386.590] (-385.349) -- 0:00:37
      481000 -- (-386.547) [-387.441] (-389.410) (-387.506) * (-385.892) (-385.619) [-385.643] (-385.609) -- 0:00:37
      481500 -- (-391.140) (-389.419) [-388.977] (-386.029) * [-389.061] (-389.402) (-391.502) (-388.699) -- 0:00:37
      482000 -- (-387.337) (-386.696) [-389.528] (-390.105) * (-386.471) (-388.500) [-385.996] (-390.371) -- 0:00:37
      482500 -- (-387.091) [-387.762] (-387.911) (-390.014) * (-387.511) [-388.951] (-387.627) (-386.447) -- 0:00:37
      483000 -- [-389.816] (-386.186) (-389.829) (-385.574) * (-388.138) [-388.337] (-385.872) (-386.350) -- 0:00:37
      483500 -- [-387.388] (-388.591) (-387.484) (-384.814) * (-387.622) (-391.798) [-388.870] (-386.719) -- 0:00:37
      484000 -- (-388.802) [-388.208] (-386.664) (-387.433) * (-386.322) (-393.099) (-389.561) [-386.411] -- 0:00:37
      484500 -- [-387.636] (-385.800) (-390.855) (-389.503) * (-385.195) (-393.450) [-387.446] (-386.360) -- 0:00:37
      485000 -- (-388.770) [-388.679] (-389.311) (-387.614) * (-385.447) (-386.597) [-386.276] (-389.190) -- 0:00:37

      Average standard deviation of split frequencies: 0.014435

      485500 -- (-389.011) (-387.281) (-385.681) [-387.312] * [-388.233] (-385.915) (-388.416) (-390.468) -- 0:00:37
      486000 -- (-397.277) [-386.161] (-387.284) (-388.229) * [-386.440] (-388.668) (-386.071) (-387.375) -- 0:00:37
      486500 -- (-389.271) (-389.633) (-385.736) [-385.631] * (-387.443) [-385.764] (-385.660) (-387.302) -- 0:00:36
      487000 -- (-389.273) (-387.644) (-390.085) [-386.061] * [-395.203] (-387.101) (-387.885) (-386.220) -- 0:00:36
      487500 -- (-385.270) [-385.290] (-388.841) (-389.637) * (-385.585) [-385.790] (-387.744) (-388.123) -- 0:00:37
      488000 -- (-385.318) (-387.388) (-387.782) [-385.383] * [-385.410] (-386.207) (-388.717) (-388.800) -- 0:00:37
      488500 -- (-387.531) (-385.818) (-386.116) [-388.038] * (-386.337) (-387.282) (-389.175) [-385.377] -- 0:00:37
      489000 -- (-385.281) (-386.191) (-385.822) [-386.188] * (-387.129) [-388.231] (-385.939) (-386.784) -- 0:00:37
      489500 -- (-388.249) (-386.245) [-384.757] (-390.352) * (-385.608) (-389.828) [-385.707] (-385.891) -- 0:00:37
      490000 -- (-387.824) [-386.147] (-385.276) (-386.507) * (-388.678) [-386.198] (-389.402) (-389.272) -- 0:00:37

      Average standard deviation of split frequencies: 0.014242

      490500 -- [-387.341] (-386.475) (-386.360) (-388.643) * (-387.075) [-385.719] (-389.240) (-385.975) -- 0:00:37
      491000 -- (-388.223) [-387.126] (-385.633) (-386.474) * (-390.984) (-385.948) [-387.005] (-386.107) -- 0:00:37
      491500 -- (-387.883) (-385.514) (-388.428) [-386.951] * (-387.532) (-387.433) (-386.837) [-387.308] -- 0:00:37
      492000 -- [-388.759] (-385.713) (-387.943) (-389.085) * (-385.782) (-389.384) (-388.278) [-386.109] -- 0:00:37
      492500 -- [-390.418] (-394.922) (-386.891) (-388.029) * (-391.148) (-388.258) (-388.862) [-386.282] -- 0:00:37
      493000 -- (-394.065) (-394.933) (-387.530) [-386.942] * (-386.992) (-386.127) (-386.575) [-389.836] -- 0:00:37
      493500 -- [-386.524] (-387.669) (-386.004) (-385.359) * [-386.296] (-387.622) (-388.557) (-387.034) -- 0:00:36
      494000 -- (-389.034) (-388.673) (-390.168) [-388.533] * (-384.987) [-389.069] (-385.971) (-389.828) -- 0:00:36
      494500 -- [-385.106] (-387.224) (-388.208) (-387.866) * [-388.231] (-393.191) (-385.466) (-386.095) -- 0:00:36
      495000 -- (-386.333) [-388.108] (-392.692) (-387.207) * (-387.539) [-389.296] (-386.939) (-386.452) -- 0:00:36

      Average standard deviation of split frequencies: 0.013865

      495500 -- (-386.943) [-386.316] (-395.570) (-388.222) * (-385.740) (-390.426) [-386.638] (-385.632) -- 0:00:36
      496000 -- [-387.309] (-389.447) (-392.243) (-388.951) * (-386.501) [-386.726] (-390.593) (-386.115) -- 0:00:36
      496500 -- (-385.838) (-389.186) (-391.041) [-387.530] * [-389.124] (-389.249) (-385.014) (-390.165) -- 0:00:36
      497000 -- (-385.921) (-388.622) (-388.082) [-387.469] * (-386.775) [-385.888] (-386.121) (-388.257) -- 0:00:36
      497500 -- (-385.138) [-389.709] (-387.197) (-385.104) * (-385.600) [-386.146] (-388.089) (-385.276) -- 0:00:36
      498000 -- (-385.843) (-386.569) (-385.287) [-389.563] * [-385.200] (-385.240) (-388.611) (-386.411) -- 0:00:36
      498500 -- (-392.459) (-386.863) [-385.980] (-386.028) * (-388.273) (-390.194) (-385.943) [-385.551] -- 0:00:36
      499000 -- (-390.021) [-387.362] (-389.973) (-385.189) * [-385.689] (-386.722) (-389.257) (-389.938) -- 0:00:36
      499500 -- (-386.206) (-387.854) (-388.014) [-386.405] * [-386.205] (-388.555) (-386.385) (-387.842) -- 0:00:36
      500000 -- [-385.426] (-387.975) (-389.467) (-386.347) * (-385.668) [-387.659] (-385.663) (-386.726) -- 0:00:36

      Average standard deviation of split frequencies: 0.013902

      500500 -- [-385.546] (-389.953) (-388.162) (-387.034) * (-386.049) [-385.346] (-385.256) (-386.462) -- 0:00:35
      501000 -- (-385.094) [-393.977] (-385.946) (-388.304) * [-388.222] (-387.697) (-386.059) (-386.984) -- 0:00:35
      501500 -- (-389.434) (-388.421) (-386.332) [-388.702] * [-388.302] (-386.554) (-387.382) (-384.992) -- 0:00:36
      502000 -- (-385.278) (-386.998) (-387.899) [-388.809] * (-387.304) (-385.907) (-387.380) [-385.138] -- 0:00:36
      502500 -- [-385.569] (-386.242) (-388.013) (-385.114) * (-387.661) [-385.707] (-386.604) (-385.872) -- 0:00:36
      503000 -- (-389.168) (-388.479) (-386.905) [-386.359] * [-388.948] (-385.008) (-386.985) (-388.856) -- 0:00:36
      503500 -- (-389.178) (-387.963) [-387.761] (-389.106) * (-388.212) [-388.170] (-387.169) (-385.861) -- 0:00:36
      504000 -- (-385.118) [-385.484] (-388.792) (-385.671) * (-386.576) (-388.126) (-391.377) [-385.683] -- 0:00:36
      504500 -- [-386.607] (-386.979) (-387.660) (-385.070) * [-388.664] (-389.745) (-389.778) (-386.542) -- 0:00:36
      505000 -- (-386.568) [-388.026] (-387.532) (-385.207) * (-388.147) (-387.903) (-388.487) [-389.749] -- 0:00:36

      Average standard deviation of split frequencies: 0.013646

      505500 -- (-392.051) [-385.955] (-388.337) (-385.339) * (-388.086) [-386.383] (-386.585) (-386.220) -- 0:00:36
      506000 -- [-386.866] (-387.799) (-394.364) (-385.378) * (-387.293) [-389.024] (-387.083) (-387.401) -- 0:00:36
      506500 -- [-386.460] (-387.193) (-385.359) (-385.179) * (-387.927) (-384.710) [-385.938] (-388.133) -- 0:00:36
      507000 -- [-385.825] (-387.632) (-388.748) (-385.145) * (-386.788) (-387.501) [-386.493] (-386.972) -- 0:00:35
      507500 -- (-390.485) (-386.514) (-394.904) [-386.794] * (-386.123) (-385.930) (-390.576) [-387.842] -- 0:00:35
      508000 -- (-386.347) (-390.477) [-392.836] (-387.961) * (-386.469) [-385.860] (-387.812) (-386.729) -- 0:00:35
      508500 -- (-387.154) [-389.981] (-386.009) (-386.782) * (-385.181) [-387.147] (-391.191) (-389.189) -- 0:00:35
      509000 -- (-388.705) [-386.648] (-386.224) (-390.639) * (-388.115) [-388.062] (-387.380) (-386.741) -- 0:00:35
      509500 -- [-389.323] (-388.225) (-385.514) (-386.534) * (-388.399) (-393.423) [-388.884] (-386.703) -- 0:00:35
      510000 -- (-386.103) (-386.520) [-388.115] (-386.114) * (-385.663) (-390.264) (-386.821) [-390.023] -- 0:00:35

      Average standard deviation of split frequencies: 0.013693

      510500 -- (-386.027) (-386.990) (-387.732) [-388.304] * (-385.944) (-387.481) (-388.054) [-386.165] -- 0:00:35
      511000 -- (-386.375) (-386.153) [-385.882] (-386.377) * (-388.154) (-387.699) [-385.213] (-385.692) -- 0:00:35
      511500 -- (-385.858) (-388.328) [-386.461] (-387.977) * (-389.690) [-387.213] (-386.048) (-385.636) -- 0:00:35
      512000 -- [-384.776] (-388.547) (-387.540) (-387.803) * (-387.692) (-385.992) (-386.367) [-388.275] -- 0:00:35
      512500 -- (-386.573) (-388.892) [-388.058] (-388.457) * (-386.005) (-391.604) (-387.097) [-391.511] -- 0:00:35
      513000 -- [-386.342] (-385.306) (-387.245) (-388.024) * [-385.316] (-387.700) (-385.976) (-386.200) -- 0:00:35
      513500 -- (-386.799) [-391.957] (-387.368) (-387.990) * [-388.032] (-386.786) (-385.911) (-387.333) -- 0:00:35
      514000 -- (-386.101) (-385.134) [-385.964] (-390.422) * (-387.227) [-385.197] (-389.459) (-388.611) -- 0:00:34
      514500 -- [-386.277] (-385.136) (-386.375) (-391.356) * (-386.262) [-386.067] (-389.044) (-386.668) -- 0:00:34
      515000 -- [-385.233] (-388.576) (-392.967) (-393.325) * (-391.417) (-387.925) [-388.335] (-386.127) -- 0:00:35

      Average standard deviation of split frequencies: 0.013489

      515500 -- (-387.046) [-388.607] (-389.932) (-394.183) * (-388.645) (-385.527) [-385.987] (-388.186) -- 0:00:35
      516000 -- [-388.805] (-386.516) (-385.870) (-393.380) * (-388.220) (-385.586) (-387.301) [-390.284] -- 0:00:35
      516500 -- (-385.025) (-386.479) (-387.967) [-386.871] * (-387.160) (-386.805) [-386.671] (-386.721) -- 0:00:35
      517000 -- [-387.569] (-385.832) (-385.900) (-389.240) * (-392.248) (-386.786) (-385.525) [-385.614] -- 0:00:35
      517500 -- (-389.346) [-392.482] (-388.743) (-385.683) * (-385.914) (-385.198) [-387.951] (-386.682) -- 0:00:35
      518000 -- (-386.187) (-391.980) [-386.406] (-387.294) * (-386.354) [-385.282] (-388.547) (-387.114) -- 0:00:35
      518500 -- (-388.964) [-388.623] (-384.871) (-385.534) * (-388.925) (-390.940) [-389.117] (-389.443) -- 0:00:35
      519000 -- (-387.876) (-386.746) [-385.264] (-387.013) * (-386.215) (-391.660) [-385.114] (-385.419) -- 0:00:35
      519500 -- (-386.231) (-389.276) (-385.533) [-386.473] * [-387.839] (-391.164) (-394.043) (-385.049) -- 0:00:35
      520000 -- [-386.088] (-386.413) (-386.360) (-387.410) * (-388.436) [-389.605] (-394.245) (-385.718) -- 0:00:35

      Average standard deviation of split frequencies: 0.013208

      520500 -- (-385.198) (-388.061) [-385.740] (-387.703) * (-389.389) (-386.164) [-387.265] (-385.807) -- 0:00:35
      521000 -- (-387.519) (-388.106) (-385.681) [-386.224] * (-388.506) [-386.845] (-390.279) (-385.526) -- 0:00:34
      521500 -- (-386.112) [-386.666] (-390.432) (-388.037) * (-392.985) [-389.237] (-387.581) (-388.696) -- 0:00:34
      522000 -- (-388.303) (-386.874) [-387.253] (-386.064) * (-386.759) (-385.831) [-386.176] (-385.405) -- 0:00:34
      522500 -- (-387.925) [-387.747] (-389.438) (-388.689) * [-389.819] (-387.615) (-385.553) (-385.293) -- 0:00:34
      523000 -- [-385.532] (-386.441) (-388.249) (-385.070) * (-385.760) (-385.811) [-386.044] (-387.384) -- 0:00:34
      523500 -- (-386.188) (-387.692) (-388.957) [-388.183] * (-390.947) (-386.850) (-386.265) [-385.976] -- 0:00:34
      524000 -- (-392.315) [-388.474] (-387.055) (-388.928) * (-389.304) (-388.816) (-388.237) [-387.647] -- 0:00:34
      524500 -- (-390.763) [-388.545] (-386.240) (-384.985) * (-386.265) (-386.488) [-391.491] (-386.485) -- 0:00:34
      525000 -- (-387.606) (-386.790) [-385.782] (-385.260) * [-385.501] (-388.485) (-386.648) (-388.417) -- 0:00:34

      Average standard deviation of split frequencies: 0.013390

      525500 -- (-388.105) (-388.140) [-385.783] (-390.744) * [-387.030] (-389.937) (-386.793) (-387.257) -- 0:00:34
      526000 -- (-386.124) (-387.713) [-386.183] (-391.049) * [-387.154] (-386.917) (-386.125) (-387.736) -- 0:00:34
      526500 -- (-386.612) (-385.965) [-385.355] (-389.836) * (-385.975) [-387.197] (-386.568) (-387.057) -- 0:00:34
      527000 -- (-386.336) (-388.094) [-384.962] (-386.247) * (-390.672) (-387.048) [-385.780] (-385.789) -- 0:00:34
      527500 -- (-386.990) (-395.517) [-386.630] (-386.400) * (-387.934) [-386.036] (-386.463) (-386.170) -- 0:00:34
      528000 -- (-385.453) (-390.326) [-386.352] (-387.740) * (-394.268) (-384.961) (-389.657) [-387.680] -- 0:00:33
      528500 -- (-386.041) [-388.409] (-389.029) (-390.078) * (-391.323) (-386.579) (-387.276) [-389.512] -- 0:00:33
      529000 -- (-386.119) [-386.926] (-388.374) (-386.992) * (-387.330) (-384.933) (-392.373) [-389.723] -- 0:00:34
      529500 -- (-385.916) (-387.827) (-389.870) [-385.713] * (-387.717) (-388.248) [-386.307] (-386.459) -- 0:00:34
      530000 -- (-387.965) [-390.945] (-385.596) (-391.719) * [-386.383] (-386.393) (-387.049) (-387.583) -- 0:00:34

      Average standard deviation of split frequencies: 0.013638

      530500 -- (-387.396) (-387.807) (-388.671) [-386.050] * (-386.722) (-389.118) [-385.862] (-388.560) -- 0:00:34
      531000 -- (-390.292) [-388.427] (-385.104) (-385.827) * (-387.018) [-387.950] (-388.388) (-386.276) -- 0:00:34
      531500 -- (-389.430) (-385.875) [-386.875] (-386.596) * [-386.729] (-389.986) (-387.590) (-385.996) -- 0:00:34
      532000 -- [-390.258] (-392.356) (-386.111) (-387.848) * [-387.979] (-389.948) (-387.307) (-386.186) -- 0:00:34
      532500 -- (-387.979) (-386.440) [-385.639] (-385.909) * (-386.143) (-384.940) [-387.920] (-387.558) -- 0:00:34
      533000 -- [-388.294] (-388.259) (-385.963) (-388.951) * (-391.339) (-384.931) (-389.327) [-384.923] -- 0:00:34
      533500 -- [-386.308] (-388.383) (-387.477) (-386.288) * (-386.991) [-385.134] (-387.934) (-386.726) -- 0:00:34
      534000 -- (-387.162) (-389.101) (-386.505) [-387.147] * (-393.104) [-386.831] (-392.379) (-385.689) -- 0:00:34
      534500 -- (-386.999) [-386.068] (-388.110) (-388.333) * (-385.175) (-390.349) (-386.721) [-386.348] -- 0:00:33
      535000 -- (-385.580) [-386.069] (-388.641) (-386.104) * (-385.518) (-388.343) (-390.114) [-385.501] -- 0:00:33

      Average standard deviation of split frequencies: 0.013503

      535500 -- (-390.785) (-387.369) (-389.141) [-388.599] * (-386.019) [-386.539] (-384.732) (-387.699) -- 0:00:33
      536000 -- (-389.235) (-385.713) [-387.926] (-389.582) * (-391.020) (-389.943) [-389.429] (-386.554) -- 0:00:33
      536500 -- (-386.156) (-388.600) [-387.659] (-388.631) * (-389.234) (-386.807) (-390.405) [-390.832] -- 0:00:33
      537000 -- [-386.484] (-386.686) (-386.044) (-386.478) * (-385.264) [-387.857] (-386.122) (-386.915) -- 0:00:33
      537500 -- [-389.019] (-386.084) (-385.819) (-387.818) * (-386.288) (-385.381) (-386.468) [-389.628] -- 0:00:33
      538000 -- (-387.848) (-391.344) (-386.228) [-387.038] * (-386.413) [-387.443] (-385.678) (-388.676) -- 0:00:33
      538500 -- (-389.251) (-389.527) [-388.565] (-387.544) * (-385.130) [-385.979] (-388.674) (-386.330) -- 0:00:33
      539000 -- [-386.637] (-386.294) (-389.263) (-388.518) * (-386.719) (-385.139) (-388.388) [-389.334] -- 0:00:33
      539500 -- (-385.647) [-386.343] (-390.770) (-386.256) * (-385.534) (-386.942) (-386.677) [-387.668] -- 0:00:33
      540000 -- (-388.974) (-385.192) [-385.981] (-387.090) * (-385.255) (-386.757) [-385.777] (-385.596) -- 0:00:33

      Average standard deviation of split frequencies: 0.013899

      540500 -- (-385.164) [-389.191] (-388.184) (-387.750) * (-387.327) (-388.218) (-388.593) [-388.838] -- 0:00:33
      541000 -- [-386.621] (-387.094) (-386.520) (-386.999) * (-390.814) [-391.478] (-388.816) (-387.956) -- 0:00:33
      541500 -- (-386.837) (-384.969) [-387.151] (-388.240) * (-387.959) (-392.312) (-387.317) [-386.423] -- 0:00:33
      542000 -- [-387.591] (-388.121) (-387.103) (-387.490) * (-386.455) (-387.587) [-387.245] (-385.499) -- 0:00:32
      542500 -- [-388.204] (-385.782) (-385.636) (-387.969) * [-388.479] (-386.150) (-388.921) (-389.241) -- 0:00:32
      543000 -- (-388.215) (-389.059) [-387.181] (-386.884) * (-389.603) (-387.195) [-387.533] (-389.897) -- 0:00:33
      543500 -- (-388.225) (-384.908) (-384.916) [-388.825] * (-388.410) [-386.733] (-390.246) (-387.741) -- 0:00:33
      544000 -- (-387.522) [-386.260] (-387.921) (-385.457) * [-385.801] (-385.954) (-388.425) (-388.883) -- 0:00:33
      544500 -- (-386.865) [-384.964] (-387.282) (-386.090) * (-387.167) [-387.194] (-386.828) (-387.341) -- 0:00:33
      545000 -- (-389.311) (-387.179) (-385.674) [-385.593] * (-385.231) (-388.546) [-387.618] (-386.366) -- 0:00:33

      Average standard deviation of split frequencies: 0.013763

      545500 -- (-390.304) (-389.407) (-386.155) [-388.545] * (-389.533) (-385.489) (-386.970) [-390.025] -- 0:00:33
      546000 -- (-386.318) [-388.772] (-386.710) (-387.000) * (-387.214) (-388.067) [-385.281] (-387.147) -- 0:00:33
      546500 -- (-386.794) [-384.601] (-387.255) (-389.227) * (-391.195) (-388.987) (-387.463) [-386.930] -- 0:00:33
      547000 -- [-387.057] (-388.128) (-386.194) (-386.184) * (-389.423) (-387.057) [-385.818] (-386.819) -- 0:00:33
      547500 -- (-385.233) (-386.863) [-386.381] (-387.143) * (-388.566) (-385.411) (-386.173) [-386.482] -- 0:00:33
      548000 -- (-385.359) (-387.463) (-389.458) [-388.202] * [-385.247] (-389.136) (-388.083) (-386.087) -- 0:00:32
      548500 -- (-386.453) (-388.597) (-386.451) [-385.658] * (-387.344) (-391.395) [-386.998] (-386.036) -- 0:00:32
      549000 -- (-385.202) (-392.778) [-385.697] (-386.551) * (-387.756) (-385.068) [-386.054] (-386.113) -- 0:00:32
      549500 -- [-385.436] (-388.302) (-389.292) (-386.656) * (-386.821) (-385.426) (-385.514) [-386.659] -- 0:00:32
      550000 -- [-388.166] (-389.476) (-387.118) (-386.820) * [-386.057] (-389.670) (-385.087) (-386.801) -- 0:00:32

      Average standard deviation of split frequencies: 0.013143

      550500 -- [-385.646] (-387.729) (-388.129) (-387.002) * (-385.274) (-389.334) [-384.986] (-386.949) -- 0:00:32
      551000 -- [-385.766] (-386.286) (-391.080) (-388.460) * [-385.379] (-388.116) (-387.233) (-387.874) -- 0:00:32
      551500 -- [-386.391] (-385.284) (-389.957) (-386.158) * (-385.566) (-386.638) [-385.920] (-386.449) -- 0:00:32
      552000 -- (-388.976) [-385.409] (-385.072) (-386.494) * (-386.723) [-385.842] (-388.068) (-385.568) -- 0:00:32
      552500 -- (-388.921) [-386.365] (-386.141) (-386.723) * (-388.658) (-393.073) (-386.174) [-385.064] -- 0:00:32
      553000 -- [-386.420] (-388.052) (-395.922) (-388.095) * (-388.801) (-388.081) (-386.406) [-387.685] -- 0:00:32
      553500 -- [-387.417] (-387.648) (-390.093) (-387.146) * (-386.517) (-386.796) (-390.109) [-388.562] -- 0:00:32
      554000 -- [-387.544] (-387.629) (-386.777) (-385.518) * (-388.480) (-386.334) [-385.886] (-387.730) -- 0:00:32
      554500 -- (-387.142) (-387.534) (-386.591) [-386.335] * (-387.761) (-389.967) (-386.343) [-385.561] -- 0:00:32
      555000 -- (-386.988) (-387.463) [-391.462] (-386.347) * (-385.961) (-390.482) (-386.180) [-385.977] -- 0:00:32

      Average standard deviation of split frequencies: 0.012568

      555500 -- (-387.670) (-388.602) [-387.100] (-386.812) * [-388.650] (-389.030) (-390.539) (-385.409) -- 0:00:32
      556000 -- (-388.811) (-391.512) [-386.079] (-385.760) * (-386.279) (-387.710) [-388.055] (-390.699) -- 0:00:31
      556500 -- (-390.682) (-386.767) [-386.903] (-389.807) * (-386.527) (-386.401) (-387.232) [-386.186] -- 0:00:32
      557000 -- (-387.019) (-386.242) [-386.125] (-390.285) * (-385.431) (-390.471) [-387.468] (-386.311) -- 0:00:32
      557500 -- (-386.664) (-385.346) [-385.246] (-386.701) * [-387.828] (-385.922) (-386.188) (-386.826) -- 0:00:32
      558000 -- [-386.184] (-384.702) (-386.376) (-386.108) * (-390.260) (-386.967) [-387.836] (-385.772) -- 0:00:32
      558500 -- (-387.295) [-385.413] (-386.841) (-388.979) * (-388.609) (-388.103) (-388.451) [-393.511] -- 0:00:32
      559000 -- [-386.069] (-386.103) (-387.790) (-386.767) * [-389.544] (-386.676) (-386.918) (-391.163) -- 0:00:32
      559500 -- (-389.443) (-388.394) [-386.410] (-388.116) * [-386.741] (-388.995) (-387.549) (-388.616) -- 0:00:32
      560000 -- [-389.914] (-390.030) (-389.110) (-386.273) * (-385.924) (-386.019) [-385.431] (-387.219) -- 0:00:32

      Average standard deviation of split frequencies: 0.012661

      560500 -- (-387.282) (-385.769) (-394.846) [-386.560] * (-386.496) (-387.536) (-388.137) [-386.608] -- 0:00:32
      561000 -- (-388.141) [-386.786] (-386.078) (-388.848) * (-386.678) (-387.142) [-387.876] (-387.039) -- 0:00:32
      561500 -- (-386.522) (-385.223) [-386.960] (-391.757) * [-388.025] (-385.951) (-386.797) (-388.228) -- 0:00:32
      562000 -- (-389.601) [-385.498] (-387.554) (-390.469) * (-385.610) [-385.552] (-389.884) (-386.946) -- 0:00:31
      562500 -- (-392.107) (-388.097) (-385.957) [-385.869] * (-385.951) [-385.220] (-385.385) (-389.563) -- 0:00:31
      563000 -- (-385.265) (-385.618) (-386.737) [-385.635] * (-392.255) (-387.126) [-385.087] (-385.391) -- 0:00:31
      563500 -- (-386.391) (-389.019) [-386.099] (-386.011) * (-386.669) (-386.424) (-384.877) [-385.405] -- 0:00:31
      564000 -- [-388.912] (-385.583) (-385.761) (-385.607) * (-386.998) [-386.466] (-386.060) (-386.242) -- 0:00:31
      564500 -- (-387.533) (-388.118) (-385.786) [-387.120] * (-387.260) [-389.882] (-385.978) (-386.718) -- 0:00:31
      565000 -- (-388.167) (-385.366) (-385.522) [-385.363] * [-389.042] (-385.761) (-385.985) (-385.374) -- 0:00:31

      Average standard deviation of split frequencies: 0.012738

      565500 -- (-391.112) [-384.945] (-386.419) (-386.035) * [-385.740] (-387.788) (-389.886) (-387.702) -- 0:00:31
      566000 -- (-385.958) [-387.405] (-388.499) (-386.772) * (-386.315) [-386.927] (-387.670) (-386.218) -- 0:00:31
      566500 -- [-387.375] (-385.797) (-388.896) (-389.002) * [-387.538] (-386.194) (-387.155) (-385.325) -- 0:00:31
      567000 -- (-389.277) (-385.723) (-385.546) [-385.474] * (-386.822) (-386.728) [-384.883] (-386.760) -- 0:00:31
      567500 -- (-386.415) (-386.064) (-389.565) [-386.537] * (-386.100) (-386.448) (-390.256) [-387.129] -- 0:00:31
      568000 -- (-389.052) (-386.276) [-388.170] (-385.224) * (-385.839) (-388.911) (-395.316) [-386.960] -- 0:00:31
      568500 -- (-387.525) [-388.196] (-388.019) (-386.975) * (-384.932) (-387.151) [-388.157] (-388.704) -- 0:00:31
      569000 -- (-387.045) [-385.681] (-385.934) (-390.039) * [-385.492] (-386.889) (-389.243) (-387.404) -- 0:00:31
      569500 -- (-388.510) [-386.026] (-387.017) (-385.608) * (-387.591) (-385.292) [-386.761] (-389.194) -- 0:00:30
      570000 -- [-388.225] (-385.519) (-386.427) (-387.155) * (-387.469) [-385.196] (-390.644) (-391.384) -- 0:00:30

      Average standard deviation of split frequencies: 0.012245

      570500 -- (-388.079) [-389.590] (-388.763) (-385.736) * (-385.970) [-386.711] (-385.717) (-390.715) -- 0:00:31
      571000 -- [-386.744] (-388.739) (-386.883) (-384.910) * (-389.564) [-385.919] (-384.851) (-385.240) -- 0:00:31
      571500 -- (-385.643) [-387.626] (-387.642) (-385.083) * [-389.112] (-385.543) (-388.142) (-387.375) -- 0:00:31
      572000 -- (-384.974) (-387.092) (-387.154) [-387.021] * (-385.372) (-389.167) (-385.811) [-385.735] -- 0:00:31
      572500 -- (-385.976) (-392.417) (-386.039) [-386.272] * (-386.138) (-388.342) [-386.832] (-387.166) -- 0:00:31
      573000 -- (-385.441) [-388.933] (-387.307) (-387.525) * (-386.686) (-387.355) [-387.876] (-385.887) -- 0:00:31
      573500 -- (-389.588) [-387.346] (-385.835) (-385.781) * [-388.757] (-389.710) (-385.902) (-388.247) -- 0:00:31
      574000 -- (-385.070) (-386.852) [-385.478] (-386.060) * [-388.822] (-385.183) (-385.414) (-386.726) -- 0:00:31
      574500 -- [-386.370] (-390.507) (-390.968) (-391.419) * (-391.362) (-386.775) (-386.293) [-387.162] -- 0:00:31
      575000 -- (-388.082) (-385.306) (-384.873) [-386.132] * (-389.054) (-390.879) (-386.189) [-387.045] -- 0:00:31

      Average standard deviation of split frequencies: 0.011939

      575500 -- (-385.085) [-386.458] (-388.288) (-386.451) * (-388.963) [-385.218] (-387.703) (-389.304) -- 0:00:30
      576000 -- (-387.013) (-390.529) (-388.858) [-387.463] * (-387.806) [-385.083] (-386.850) (-385.795) -- 0:00:30
      576500 -- (-386.286) (-389.287) (-385.988) [-385.776] * (-385.721) (-385.980) (-386.924) [-385.502] -- 0:00:30
      577000 -- [-385.111] (-386.627) (-390.170) (-389.203) * (-390.042) (-386.053) [-388.954] (-386.479) -- 0:00:30
      577500 -- (-387.118) (-386.161) [-392.408] (-387.064) * (-385.745) [-387.454] (-385.235) (-384.650) -- 0:00:30
      578000 -- [-385.889] (-390.644) (-389.762) (-391.330) * (-386.761) [-388.375] (-387.336) (-387.012) -- 0:00:30
      578500 -- (-388.526) (-386.444) (-386.557) [-388.315] * (-388.077) [-386.500] (-386.649) (-391.674) -- 0:00:30
      579000 -- (-391.660) (-387.302) [-385.114] (-386.871) * (-386.380) (-389.422) (-385.525) [-386.493] -- 0:00:30
      579500 -- (-388.322) (-389.412) (-387.565) [-389.046] * (-387.326) (-387.798) [-387.341] (-386.969) -- 0:00:30
      580000 -- (-394.360) (-385.554) [-385.432] (-389.152) * (-387.130) (-385.353) (-386.802) [-385.892] -- 0:00:30

      Average standard deviation of split frequencies: 0.012273

      580500 -- (-385.390) [-385.076] (-387.081) (-385.466) * (-386.157) (-386.881) [-387.914] (-385.877) -- 0:00:30
      581000 -- [-385.832] (-386.950) (-385.141) (-385.406) * (-385.860) (-388.304) [-388.081] (-385.259) -- 0:00:30
      581500 -- (-384.884) (-388.670) (-387.953) [-384.965] * [-386.086] (-389.209) (-392.220) (-385.597) -- 0:00:30
      582000 -- [-385.760] (-388.702) (-388.822) (-386.143) * [-389.551] (-389.184) (-386.467) (-388.720) -- 0:00:30
      582500 -- (-388.443) (-386.956) (-389.297) [-386.740] * (-388.205) (-389.197) (-386.271) [-384.868] -- 0:00:30
      583000 -- (-386.919) (-386.989) [-387.530] (-386.719) * (-389.037) (-391.510) (-386.955) [-386.555] -- 0:00:30
      583500 -- [-385.358] (-385.515) (-389.113) (-386.550) * (-388.682) (-389.566) (-388.787) [-389.839] -- 0:00:29
      584000 -- (-389.541) (-388.562) (-390.998) [-387.216] * (-387.582) (-388.820) (-387.891) [-388.179] -- 0:00:29
      584500 -- (-390.696) (-390.622) [-388.900] (-391.278) * (-386.497) (-390.033) (-386.530) [-385.293] -- 0:00:30
      585000 -- (-385.428) (-390.158) (-388.249) [-386.683] * (-388.484) (-386.828) (-385.787) [-385.888] -- 0:00:30

      Average standard deviation of split frequencies: 0.012114

      585500 -- (-386.583) [-389.283] (-384.872) (-385.240) * (-386.645) [-387.669] (-385.152) (-387.420) -- 0:00:30
      586000 -- (-386.787) (-387.724) [-385.799] (-387.209) * (-389.638) (-388.880) (-385.626) [-391.970] -- 0:00:30
      586500 -- (-386.618) (-388.682) (-387.412) [-387.854] * [-387.015] (-386.627) (-388.928) (-396.648) -- 0:00:30
      587000 -- (-389.173) (-386.789) [-387.722] (-387.728) * (-385.911) (-387.643) (-389.865) [-389.330] -- 0:00:30
      587500 -- (-386.406) (-386.658) (-387.286) [-387.819] * (-389.388) (-385.373) (-386.944) [-389.368] -- 0:00:30
      588000 -- (-386.570) [-388.473] (-388.556) (-387.222) * [-385.991] (-386.435) (-386.252) (-387.529) -- 0:00:30
      588500 -- (-386.279) [-386.818] (-389.639) (-386.367) * (-386.293) (-387.080) [-389.436] (-388.871) -- 0:00:30
      589000 -- (-385.937) (-386.661) [-386.261] (-395.472) * [-386.837] (-385.540) (-387.065) (-390.669) -- 0:00:30
      589500 -- [-386.743] (-385.798) (-388.458) (-390.767) * [-385.739] (-385.393) (-387.650) (-385.013) -- 0:00:29
      590000 -- [-388.315] (-385.340) (-388.259) (-387.225) * (-388.972) (-386.664) (-387.433) [-384.926] -- 0:00:29

      Average standard deviation of split frequencies: 0.011596

      590500 -- (-386.950) (-386.466) [-385.698] (-387.600) * (-385.829) (-389.236) (-385.552) [-388.510] -- 0:00:29
      591000 -- [-386.747] (-386.137) (-385.036) (-384.758) * (-385.158) (-386.176) (-387.067) [-385.093] -- 0:00:29
      591500 -- (-388.434) (-386.189) (-384.873) [-384.894] * (-385.539) [-390.275] (-385.585) (-386.988) -- 0:00:29
      592000 -- [-388.811] (-386.512) (-387.195) (-387.121) * [-386.864] (-385.390) (-385.721) (-387.595) -- 0:00:29
      592500 -- (-391.710) (-391.282) (-387.525) [-385.872] * [-387.001] (-385.932) (-386.774) (-385.655) -- 0:00:29
      593000 -- (-386.539) (-385.696) (-389.835) [-385.656] * (-386.629) (-387.258) [-387.247] (-385.965) -- 0:00:29
      593500 -- (-384.988) (-387.720) (-388.733) [-385.660] * [-387.116] (-386.050) (-384.849) (-385.870) -- 0:00:29
      594000 -- [-388.331] (-387.162) (-386.772) (-388.154) * (-385.380) (-387.731) [-386.282] (-386.899) -- 0:00:29
      594500 -- (-392.259) [-386.640] (-388.661) (-387.422) * (-386.496) (-387.055) (-388.702) [-388.000] -- 0:00:29
      595000 -- (-385.185) (-386.308) [-385.449] (-386.552) * (-388.975) (-387.847) (-387.050) [-391.332] -- 0:00:29

      Average standard deviation of split frequencies: 0.010925

      595500 -- (-386.000) (-385.424) (-391.908) [-389.225] * (-385.968) (-387.192) (-385.623) [-387.982] -- 0:00:29
      596000 -- (-385.695) (-388.535) [-387.313] (-388.620) * (-386.422) (-385.458) [-386.222] (-387.459) -- 0:00:29
      596500 -- [-387.289] (-386.491) (-387.114) (-387.490) * [-386.165] (-387.777) (-385.750) (-386.824) -- 0:00:29
      597000 -- (-386.317) (-388.013) [-387.397] (-385.993) * (-386.676) (-386.334) [-386.398] (-389.117) -- 0:00:29
      597500 -- [-386.444] (-387.397) (-387.952) (-389.039) * (-386.439) [-385.001] (-385.626) (-386.471) -- 0:00:28
      598000 -- (-387.251) [-387.463] (-385.206) (-386.853) * (-385.803) [-386.692] (-387.819) (-386.303) -- 0:00:28
      598500 -- (-386.710) (-387.637) [-387.640] (-385.314) * (-389.062) (-386.544) [-388.949] (-387.069) -- 0:00:28
      599000 -- (-385.047) (-388.233) (-386.084) [-385.430] * (-385.844) [-388.253] (-388.662) (-387.329) -- 0:00:29
      599500 -- [-385.704] (-393.736) (-389.067) (-388.681) * [-387.020] (-385.439) (-388.209) (-386.231) -- 0:00:29
      600000 -- (-386.599) (-386.726) (-387.943) [-389.697] * [-387.535] (-391.402) (-388.708) (-386.676) -- 0:00:29

      Average standard deviation of split frequencies: 0.011634

      600500 -- (-385.716) (-385.707) (-386.743) [-388.365] * [-386.679] (-386.266) (-386.389) (-388.560) -- 0:00:29
      601000 -- (-386.387) (-386.188) [-385.414] (-385.886) * (-386.993) (-390.519) (-385.711) [-386.742] -- 0:00:29
      601500 -- [-385.100] (-387.392) (-385.034) (-388.640) * [-387.717] (-387.623) (-386.514) (-385.847) -- 0:00:29
      602000 -- (-385.109) (-386.671) (-385.981) [-386.455] * (-386.863) [-387.867] (-384.973) (-386.058) -- 0:00:29
      602500 -- (-387.927) (-392.572) (-385.536) [-385.907] * (-386.583) [-387.183] (-385.802) (-386.871) -- 0:00:29
      603000 -- (-387.049) (-386.758) (-385.961) [-385.389] * (-386.475) [-387.131] (-388.205) (-385.313) -- 0:00:28
      603500 -- (-389.623) (-385.906) (-385.737) [-387.426] * (-390.500) [-389.382] (-389.766) (-385.104) -- 0:00:28
      604000 -- (-386.574) [-385.893] (-385.321) (-391.665) * (-385.738) (-385.826) [-386.828] (-386.636) -- 0:00:28
      604500 -- (-388.385) (-386.449) [-386.229] (-392.508) * (-387.041) (-385.893) (-389.837) [-393.489] -- 0:00:28
      605000 -- (-386.103) (-386.880) [-385.162] (-391.634) * [-385.740] (-387.070) (-385.419) (-388.518) -- 0:00:28

      Average standard deviation of split frequencies: 0.012126

      605500 -- (-385.863) (-385.244) [-388.540] (-390.063) * (-385.406) (-386.226) (-388.736) [-387.301] -- 0:00:28
      606000 -- (-386.111) [-388.476] (-387.577) (-387.657) * (-387.539) (-385.954) [-385.222] (-387.444) -- 0:00:28
      606500 -- (-385.351) (-390.229) (-390.193) [-387.595] * [-388.355] (-390.279) (-385.241) (-386.641) -- 0:00:28
      607000 -- (-387.240) [-386.680] (-386.890) (-388.202) * (-385.934) [-387.398] (-386.876) (-387.031) -- 0:00:28
      607500 -- (-387.249) [-386.239] (-386.432) (-385.425) * (-390.550) [-390.280] (-387.371) (-385.336) -- 0:00:28
      608000 -- (-386.554) (-386.953) (-386.270) [-386.406] * [-386.357] (-389.025) (-386.382) (-387.864) -- 0:00:28
      608500 -- (-388.113) (-387.379) [-386.303] (-386.107) * (-385.122) [-388.467] (-386.376) (-387.799) -- 0:00:28
      609000 -- (-391.411) (-386.804) (-390.186) [-385.362] * (-385.675) (-388.073) (-388.755) [-391.041] -- 0:00:28
      609500 -- (-388.687) (-385.794) (-390.464) [-390.113] * [-385.572] (-387.266) (-385.537) (-385.993) -- 0:00:28
      610000 -- (-384.926) (-385.768) (-386.324) [-385.890] * (-387.097) (-386.905) [-386.588] (-387.446) -- 0:00:28

      Average standard deviation of split frequencies: 0.011820

      610500 -- (-385.576) (-386.522) [-387.123] (-386.848) * (-389.128) [-387.614] (-386.915) (-387.732) -- 0:00:28
      611000 -- (-385.682) (-386.069) (-386.701) [-391.952] * [-387.871] (-388.686) (-385.648) (-387.777) -- 0:00:28
      611500 -- (-386.104) (-389.211) [-385.086] (-386.101) * (-389.318) [-386.303] (-391.231) (-385.299) -- 0:00:27
      612000 -- (-387.802) (-386.010) (-386.886) [-387.646] * (-386.694) [-387.728] (-390.006) (-386.401) -- 0:00:27
      612500 -- (-390.270) (-389.701) [-386.244] (-386.447) * (-387.665) (-386.893) (-393.348) [-385.312] -- 0:00:28
      613000 -- [-390.122] (-388.793) (-387.289) (-385.051) * (-388.145) (-388.528) (-391.403) [-386.528] -- 0:00:28
      613500 -- (-387.511) [-387.332] (-393.271) (-389.528) * (-387.268) (-395.173) [-386.539] (-385.895) -- 0:00:28
      614000 -- (-386.199) (-386.370) [-388.282] (-386.401) * (-386.489) (-390.408) [-384.965] (-385.949) -- 0:00:28
      614500 -- (-386.673) (-385.045) [-387.378] (-389.557) * (-385.446) (-387.250) (-385.807) [-386.979] -- 0:00:28
      615000 -- [-389.162] (-387.398) (-388.033) (-390.397) * (-386.893) (-385.967) [-386.542] (-386.789) -- 0:00:28

      Average standard deviation of split frequencies: 0.011144

      615500 -- (-388.293) [-385.281] (-386.829) (-388.089) * (-387.890) (-389.564) (-388.895) [-385.966] -- 0:00:28
      616000 -- [-385.969] (-385.845) (-390.380) (-387.604) * [-386.114] (-386.161) (-386.771) (-384.911) -- 0:00:28
      616500 -- (-388.082) [-386.290] (-388.876) (-385.876) * (-386.728) (-386.001) (-387.094) [-386.754] -- 0:00:27
      617000 -- (-389.169) (-385.497) [-387.128] (-386.884) * (-388.716) (-387.640) (-387.449) [-384.818] -- 0:00:27
      617500 -- (-390.189) (-386.515) [-388.211] (-386.128) * (-388.010) (-387.533) (-388.061) [-386.738] -- 0:00:27
      618000 -- (-387.207) (-387.630) [-387.962] (-385.479) * (-388.584) (-390.251) [-387.930] (-387.271) -- 0:00:27
      618500 -- (-386.327) (-385.261) (-387.199) [-385.384] * (-384.926) (-393.259) (-384.812) [-386.128] -- 0:00:27
      619000 -- [-385.265] (-385.636) (-385.740) (-388.393) * [-387.328] (-385.118) (-390.101) (-386.024) -- 0:00:27
      619500 -- (-388.205) (-386.884) (-386.401) [-391.003] * (-385.897) [-384.906] (-389.534) (-386.877) -- 0:00:27
      620000 -- (-385.848) (-386.622) [-387.690] (-386.140) * [-385.752] (-387.323) (-389.627) (-389.008) -- 0:00:27

      Average standard deviation of split frequencies: 0.011060

      620500 -- (-389.313) (-387.344) [-388.513] (-385.791) * (-386.924) (-387.518) (-387.105) [-384.830] -- 0:00:27
      621000 -- (-388.639) (-388.855) (-388.629) [-384.913] * (-385.318) (-388.581) [-385.656] (-389.905) -- 0:00:27
      621500 -- [-388.089] (-386.858) (-387.897) (-387.776) * (-387.703) (-388.301) (-385.824) [-387.705] -- 0:00:27
      622000 -- (-390.442) (-387.622) [-385.085] (-386.712) * (-388.120) [-387.879] (-390.086) (-391.997) -- 0:00:27
      622500 -- [-385.953] (-392.262) (-386.236) (-387.782) * [-387.756] (-390.391) (-387.434) (-387.990) -- 0:00:27
      623000 -- (-385.442) [-388.157] (-386.570) (-387.569) * (-387.452) [-387.193] (-386.193) (-388.632) -- 0:00:27
      623500 -- [-385.832] (-385.667) (-385.782) (-387.098) * (-385.352) (-386.400) [-386.063] (-387.336) -- 0:00:27
      624000 -- (-385.982) (-386.934) (-386.926) [-386.726] * (-386.266) (-386.904) [-385.409] (-390.160) -- 0:00:27
      624500 -- [-386.585] (-390.268) (-391.365) (-387.163) * (-391.104) [-386.308] (-387.475) (-387.258) -- 0:00:27
      625000 -- (-389.364) (-386.408) (-387.355) [-387.706] * (-388.033) (-386.033) [-385.288] (-386.369) -- 0:00:27

      Average standard deviation of split frequencies: 0.010260

      625500 -- (-386.868) [-385.613] (-386.775) (-385.297) * (-388.066) (-389.818) [-386.481] (-386.923) -- 0:00:26
      626000 -- (-385.306) (-389.089) (-387.341) [-385.218] * (-387.006) (-387.116) [-385.989] (-387.301) -- 0:00:27
      626500 -- [-389.515] (-386.040) (-385.255) (-387.768) * (-387.730) [-386.705] (-386.680) (-385.003) -- 0:00:27
      627000 -- [-388.253] (-388.794) (-388.879) (-392.364) * (-392.165) (-385.225) [-386.833] (-389.791) -- 0:00:27
      627500 -- (-388.756) (-387.319) (-387.383) [-386.549] * (-391.865) [-386.849] (-387.673) (-390.769) -- 0:00:27
      628000 -- (-387.258) (-386.532) [-385.203] (-386.464) * (-388.229) (-385.085) (-388.168) [-386.963] -- 0:00:27
      628500 -- [-385.750] (-389.203) (-385.933) (-388.457) * (-388.611) [-387.580] (-385.809) (-394.994) -- 0:00:27
      629000 -- (-385.705) (-385.881) (-387.915) [-386.460] * (-387.867) (-386.426) [-386.822] (-388.344) -- 0:00:27
      629500 -- (-387.764) [-390.022] (-385.939) (-388.327) * [-385.556] (-386.414) (-389.898) (-385.767) -- 0:00:27
      630000 -- [-387.869] (-387.823) (-389.042) (-389.268) * (-386.838) (-386.207) [-387.602] (-392.871) -- 0:00:27

      Average standard deviation of split frequencies: 0.010184

      630500 -- (-387.580) [-386.309] (-385.214) (-387.576) * [-386.742] (-386.038) (-387.400) (-393.525) -- 0:00:26
      631000 -- (-390.702) [-387.189] (-387.077) (-389.407) * (-386.103) [-387.942] (-384.868) (-390.569) -- 0:00:26
      631500 -- (-385.686) (-387.470) [-386.323] (-389.066) * (-388.339) (-388.776) [-387.113] (-388.893) -- 0:00:26
      632000 -- [-388.502] (-389.544) (-385.442) (-390.458) * [-385.134] (-386.731) (-386.236) (-387.582) -- 0:00:26
      632500 -- [-385.095] (-385.565) (-387.124) (-389.459) * (-387.938) [-387.184] (-389.064) (-385.169) -- 0:00:26
      633000 -- (-388.113) (-389.831) (-389.496) [-386.522] * (-388.457) (-387.689) [-388.151] (-386.788) -- 0:00:26
      633500 -- (-386.714) [-385.051] (-388.274) (-387.896) * (-386.581) (-389.471) (-388.033) [-384.767] -- 0:00:26
      634000 -- [-390.279] (-389.453) (-386.813) (-387.765) * (-387.908) (-385.216) [-387.212] (-388.472) -- 0:00:26
      634500 -- (-386.883) (-386.366) [-388.964] (-385.843) * (-386.921) (-387.010) (-389.188) [-387.287] -- 0:00:26
      635000 -- [-387.332] (-389.293) (-385.081) (-387.757) * (-386.077) (-387.132) [-386.191] (-386.029) -- 0:00:26

      Average standard deviation of split frequencies: 0.009821

      635500 -- (-390.274) [-387.289] (-387.905) (-386.243) * (-387.976) [-387.601] (-388.167) (-386.345) -- 0:00:26
      636000 -- (-386.777) [-390.418] (-387.943) (-390.124) * [-387.842] (-386.765) (-385.952) (-386.538) -- 0:00:26
      636500 -- (-385.599) (-385.517) [-385.447] (-388.648) * (-387.662) (-388.104) (-389.568) [-388.243] -- 0:00:26
      637000 -- (-386.811) [-387.571] (-387.001) (-386.004) * (-386.574) [-385.658] (-386.222) (-386.651) -- 0:00:26
      637500 -- (-386.784) (-386.067) (-385.809) [-385.468] * (-386.066) (-390.019) (-388.859) [-390.084] -- 0:00:26
      638000 -- [-385.663] (-387.587) (-385.273) (-385.921) * [-387.356] (-387.027) (-388.437) (-386.205) -- 0:00:26
      638500 -- (-386.549) [-388.038] (-385.153) (-386.449) * (-386.073) [-388.217] (-386.107) (-385.953) -- 0:00:26
      639000 -- (-385.974) [-389.472] (-384.732) (-385.688) * (-388.005) (-388.260) [-385.794] (-389.188) -- 0:00:25
      639500 -- (-386.768) (-388.348) [-387.755] (-386.835) * (-384.822) [-385.376] (-388.955) (-387.386) -- 0:00:25
      640000 -- [-388.512] (-388.426) (-390.792) (-386.302) * (-387.728) (-385.739) [-387.056] (-388.268) -- 0:00:25

      Average standard deviation of split frequencies: 0.009519

      640500 -- (-387.422) [-385.031] (-386.761) (-385.989) * (-388.487) [-384.937] (-386.503) (-391.085) -- 0:00:26
      641000 -- (-391.632) (-385.769) (-387.858) [-385.889] * (-387.459) (-388.518) (-387.110) [-386.091] -- 0:00:26
      641500 -- (-386.219) (-387.006) [-387.358] (-386.473) * (-390.069) (-387.032) (-386.215) [-386.061] -- 0:00:26
      642000 -- (-385.457) (-387.306) [-385.969] (-389.468) * (-388.373) (-387.289) [-386.393] (-391.385) -- 0:00:26
      642500 -- (-387.372) (-386.028) [-387.526] (-388.988) * (-387.814) [-386.021] (-386.751) (-385.369) -- 0:00:26
      643000 -- (-386.698) [-385.785] (-386.682) (-386.942) * (-389.969) (-387.095) [-385.897] (-386.823) -- 0:00:26
      643500 -- [-388.448] (-385.814) (-392.013) (-387.481) * [-388.625] (-387.398) (-386.265) (-386.077) -- 0:00:26
      644000 -- (-386.579) [-386.402] (-386.661) (-386.481) * (-387.167) (-391.806) (-385.256) [-387.468] -- 0:00:25
      644500 -- (-386.915) [-385.607] (-389.753) (-388.972) * (-388.306) (-386.695) [-385.803] (-386.849) -- 0:00:25
      645000 -- (-386.970) [-385.435] (-386.856) (-390.849) * (-390.080) (-386.894) (-385.043) [-388.111] -- 0:00:25

      Average standard deviation of split frequencies: 0.009532

      645500 -- (-387.658) (-388.936) (-385.676) [-388.827] * (-387.875) (-390.265) (-386.592) [-388.693] -- 0:00:25
      646000 -- (-386.640) (-386.960) [-386.942] (-385.700) * [-387.161] (-391.338) (-386.494) (-385.672) -- 0:00:25
      646500 -- (-386.982) [-386.003] (-393.673) (-386.350) * [-387.193] (-386.133) (-390.228) (-391.374) -- 0:00:25
      647000 -- (-388.487) (-387.230) (-385.979) [-388.175] * (-387.309) [-386.280] (-389.330) (-387.350) -- 0:00:25
      647500 -- [-387.566] (-385.885) (-386.685) (-386.592) * (-385.894) [-386.805] (-386.447) (-388.995) -- 0:00:25
      648000 -- [-385.926] (-386.757) (-386.256) (-389.355) * (-389.617) (-387.040) (-388.112) [-387.033] -- 0:00:25
      648500 -- (-388.034) (-386.889) (-386.993) [-386.849] * (-385.174) (-389.535) (-386.385) [-390.750] -- 0:00:25
      649000 -- [-385.889] (-387.812) (-387.655) (-388.248) * (-387.291) [-390.686] (-386.043) (-386.729) -- 0:00:25
      649500 -- (-391.392) (-390.333) [-385.910] (-386.664) * [-385.775] (-387.230) (-384.886) (-390.662) -- 0:00:25
      650000 -- (-387.439) (-385.972) [-386.172] (-389.151) * (-385.330) (-389.598) [-386.564] (-390.939) -- 0:00:25

      Average standard deviation of split frequencies: 0.010098

      650500 -- (-387.517) (-387.727) (-388.482) [-387.147] * (-389.489) [-385.993] (-387.466) (-384.928) -- 0:00:25
      651000 -- (-387.408) (-387.551) [-388.818] (-385.494) * (-388.327) (-387.887) (-385.638) [-387.667] -- 0:00:25
      651500 -- (-390.039) (-388.440) (-390.142) [-385.499] * (-391.245) (-389.061) [-387.467] (-389.934) -- 0:00:25
      652000 -- (-388.546) (-385.332) (-385.651) [-386.203] * [-391.164] (-389.022) (-389.892) (-386.853) -- 0:00:25
      652500 -- [-389.269] (-390.334) (-387.921) (-387.160) * (-388.026) (-385.697) [-386.448] (-385.363) -- 0:00:25
      653000 -- (-386.604) (-395.081) (-387.818) [-389.522] * (-387.658) (-392.973) [-387.597] (-388.365) -- 0:00:24
      653500 -- (-385.361) (-385.908) (-388.432) [-386.650] * (-387.437) [-387.789] (-386.573) (-388.563) -- 0:00:24
      654000 -- (-386.031) (-388.301) [-385.931] (-387.332) * (-385.382) (-388.033) (-385.695) [-387.160] -- 0:00:24
      654500 -- [-386.483] (-386.196) (-391.114) (-394.129) * (-390.587) (-387.497) (-388.766) [-386.572] -- 0:00:25
      655000 -- (-393.984) (-390.147) [-385.389] (-390.006) * (-386.101) [-386.376] (-387.775) (-385.746) -- 0:00:25

      Average standard deviation of split frequencies: 0.010150

      655500 -- [-385.342] (-389.349) (-390.075) (-387.665) * (-387.563) (-385.918) [-386.302] (-386.607) -- 0:00:25
      656000 -- [-387.758] (-387.959) (-386.838) (-385.423) * [-386.425] (-386.267) (-387.236) (-385.662) -- 0:00:25
      656500 -- (-390.484) (-390.711) (-388.067) [-388.227] * [-392.241] (-386.162) (-386.791) (-387.982) -- 0:00:25
      657000 -- (-393.148) (-385.522) (-385.920) [-387.121] * (-386.552) [-386.466] (-389.406) (-385.407) -- 0:00:25
      657500 -- (-389.756) (-385.181) [-388.985] (-389.661) * (-386.300) [-389.452] (-391.716) (-386.125) -- 0:00:25
      658000 -- [-385.341] (-386.292) (-387.881) (-386.161) * [-385.018] (-391.915) (-387.551) (-389.495) -- 0:00:24
      658500 -- (-387.698) (-390.468) (-387.892) [-385.316] * (-387.520) (-386.209) (-390.160) [-387.410] -- 0:00:24
      659000 -- (-389.400) (-388.118) (-389.475) [-385.406] * (-385.898) [-384.761] (-387.326) (-390.599) -- 0:00:24
      659500 -- [-385.790] (-386.355) (-389.702) (-386.474) * (-385.608) [-388.125] (-388.364) (-390.644) -- 0:00:24
      660000 -- (-387.426) (-385.270) (-387.593) [-386.309] * (-386.170) [-386.342] (-386.451) (-387.226) -- 0:00:24

      Average standard deviation of split frequencies: 0.009945

      660500 -- (-385.779) (-387.042) [-386.293] (-386.692) * (-388.804) [-386.005] (-387.029) (-386.120) -- 0:00:24
      661000 -- (-385.604) [-385.772] (-386.461) (-386.442) * (-386.490) (-387.494) [-389.320] (-385.491) -- 0:00:24
      661500 -- (-388.675) (-388.000) (-387.910) [-387.422] * [-386.886] (-386.548) (-388.439) (-385.503) -- 0:00:24
      662000 -- [-386.363] (-386.238) (-388.558) (-389.224) * (-385.605) (-386.798) (-389.304) [-385.733] -- 0:00:24
      662500 -- (-386.514) (-386.020) (-385.336) [-387.559] * (-386.625) (-388.817) [-385.344] (-385.678) -- 0:00:24
      663000 -- (-389.446) [-387.503] (-386.976) (-388.756) * (-389.992) (-389.608) [-385.265] (-386.177) -- 0:00:24
      663500 -- [-386.189] (-386.131) (-389.887) (-391.355) * (-387.992) (-385.935) (-385.237) [-387.968] -- 0:00:24
      664000 -- (-385.859) (-387.637) [-388.669] (-386.826) * [-389.313] (-386.299) (-387.070) (-387.797) -- 0:00:24
      664500 -- (-384.920) (-386.186) [-386.779] (-385.288) * (-387.836) (-386.683) [-391.886] (-387.320) -- 0:00:24
      665000 -- (-387.401) (-388.756) (-388.461) [-389.949] * (-387.614) [-386.113] (-385.293) (-386.685) -- 0:00:24

      Average standard deviation of split frequencies: 0.009732

      665500 -- (-386.464) (-387.603) [-389.475] (-387.924) * (-386.484) (-386.812) (-385.704) [-386.597] -- 0:00:24
      666000 -- (-386.590) (-386.870) (-387.589) [-387.551] * (-389.149) (-385.310) [-385.253] (-387.631) -- 0:00:24
      666500 -- [-385.916] (-387.889) (-387.459) (-386.824) * (-388.071) (-387.601) [-387.206] (-385.170) -- 0:00:24
      667000 -- (-387.374) (-386.631) [-385.191] (-385.716) * (-385.457) (-388.757) [-387.657] (-390.811) -- 0:00:23
      667500 -- [-387.510] (-386.413) (-386.695) (-387.678) * [-387.013] (-387.161) (-388.147) (-391.919) -- 0:00:23
      668000 -- (-388.545) [-385.783] (-388.573) (-384.931) * [-388.157] (-388.382) (-387.778) (-386.330) -- 0:00:23
      668500 -- (-388.499) [-388.999] (-390.021) (-385.937) * [-389.691] (-384.929) (-384.829) (-386.565) -- 0:00:24
      669000 -- (-387.428) [-385.742] (-387.707) (-387.320) * (-387.058) (-386.116) [-385.924] (-387.509) -- 0:00:24
      669500 -- [-385.905] (-388.236) (-389.384) (-385.842) * (-386.587) [-385.658] (-386.806) (-388.753) -- 0:00:24
      670000 -- (-386.356) (-387.388) (-386.529) [-386.777] * (-391.027) (-389.996) [-385.455] (-385.361) -- 0:00:24

      Average standard deviation of split frequencies: 0.009401

      670500 -- (-386.705) [-390.369] (-390.323) (-386.514) * [-385.983] (-391.259) (-386.439) (-386.724) -- 0:00:24
      671000 -- (-386.480) (-386.052) (-389.962) [-385.300] * (-385.299) (-390.141) [-385.533] (-388.645) -- 0:00:24
      671500 -- (-391.409) (-385.573) (-385.966) [-387.850] * (-390.334) [-386.581] (-385.117) (-388.830) -- 0:00:23
      672000 -- (-386.620) (-387.329) [-385.319] (-388.538) * (-389.113) [-388.293] (-385.971) (-387.687) -- 0:00:23
      672500 -- (-386.510) (-385.632) (-389.897) [-386.931] * (-386.704) (-387.224) [-387.570] (-388.126) -- 0:00:23
      673000 -- (-388.972) [-386.279] (-392.896) (-387.055) * (-391.275) (-386.741) (-385.863) [-384.974] -- 0:00:23
      673500 -- (-387.238) [-386.524] (-389.267) (-387.232) * (-389.916) [-387.261] (-385.502) (-387.089) -- 0:00:23
      674000 -- (-386.272) [-387.182] (-388.477) (-389.414) * (-387.568) [-386.876] (-388.327) (-387.840) -- 0:00:23
      674500 -- (-389.596) (-385.914) (-385.899) [-388.700] * (-390.712) (-390.186) (-386.640) [-386.718] -- 0:00:23
      675000 -- (-391.052) (-388.167) (-389.946) [-386.306] * [-387.069] (-386.889) (-386.310) (-391.487) -- 0:00:23

      Average standard deviation of split frequencies: 0.010111

      675500 -- (-390.727) [-387.121] (-388.276) (-387.294) * (-390.809) [-386.439] (-387.358) (-385.095) -- 0:00:23
      676000 -- (-390.905) [-387.268] (-388.315) (-388.027) * [-386.526] (-396.847) (-388.998) (-387.662) -- 0:00:23
      676500 -- (-387.468) (-387.328) (-387.707) [-386.906] * (-390.548) [-387.863] (-386.197) (-387.378) -- 0:00:23
      677000 -- (-384.962) (-389.763) (-388.096) [-385.828] * (-386.028) [-385.588] (-385.781) (-389.480) -- 0:00:23
      677500 -- [-389.586] (-390.509) (-386.437) (-386.756) * (-387.150) (-389.769) [-386.008] (-387.405) -- 0:00:23
      678000 -- (-387.983) (-386.634) [-385.861] (-387.491) * (-388.588) (-391.703) [-387.783] (-385.701) -- 0:00:23
      678500 -- (-385.035) [-387.966] (-387.256) (-387.350) * [-385.690] (-388.633) (-387.463) (-385.844) -- 0:00:23
      679000 -- (-391.824) (-386.293) [-385.938] (-390.268) * (-385.251) (-385.884) [-384.864] (-385.518) -- 0:00:23
      679500 -- [-389.034] (-387.537) (-388.398) (-390.232) * [-386.858] (-389.179) (-386.590) (-389.164) -- 0:00:23
      680000 -- (-387.740) (-386.782) (-386.815) [-391.925] * (-386.225) (-386.356) (-388.750) [-388.964] -- 0:00:23

      Average standard deviation of split frequencies: 0.009869

      680500 -- (-390.060) [-387.399] (-387.876) (-386.010) * (-388.206) (-386.397) (-389.983) [-389.062] -- 0:00:23
      681000 -- [-386.106] (-388.239) (-387.348) (-386.156) * (-388.126) (-387.713) [-386.543] (-388.515) -- 0:00:22
      681500 -- (-385.461) (-387.082) [-386.458] (-390.546) * (-387.699) (-388.708) (-385.543) [-386.390] -- 0:00:22
      682000 -- (-386.089) (-388.948) [-386.837] (-389.224) * (-388.644) (-388.018) (-388.035) [-390.471] -- 0:00:22
      682500 -- [-386.562] (-387.515) (-388.023) (-385.583) * (-387.593) [-389.978] (-386.556) (-386.707) -- 0:00:23
      683000 -- (-389.239) [-386.487] (-390.635) (-386.089) * (-388.026) (-388.088) [-384.999] (-387.289) -- 0:00:23
      683500 -- (-388.026) [-388.769] (-388.216) (-386.602) * (-391.122) (-388.939) [-385.435] (-385.269) -- 0:00:23
      684000 -- (-386.414) (-386.306) (-386.773) [-385.940] * (-386.454) [-387.594] (-387.330) (-385.436) -- 0:00:23
      684500 -- (-385.768) [-386.757] (-386.144) (-389.487) * (-386.886) (-388.383) (-386.273) [-384.950] -- 0:00:23
      685000 -- (-390.612) (-389.113) [-385.022] (-387.271) * (-386.003) (-388.022) [-390.223] (-396.291) -- 0:00:22

      Average standard deviation of split frequencies: 0.009578

      685500 -- (-390.677) [-385.113] (-386.995) (-386.168) * [-384.795] (-385.315) (-386.083) (-389.018) -- 0:00:22
      686000 -- (-388.416) (-385.956) [-387.883] (-386.316) * (-385.142) (-389.722) [-385.843] (-391.545) -- 0:00:22
      686500 -- [-387.568] (-387.548) (-389.160) (-386.345) * (-387.575) [-385.737] (-387.576) (-389.104) -- 0:00:22
      687000 -- (-386.240) [-388.122] (-390.781) (-386.880) * (-386.270) (-389.982) [-387.979] (-387.745) -- 0:00:22
      687500 -- (-390.622) (-386.375) [-388.354] (-388.521) * [-384.982] (-392.408) (-385.987) (-386.631) -- 0:00:22
      688000 -- (-388.953) (-385.698) [-386.543] (-385.797) * [-386.372] (-387.002) (-386.863) (-387.273) -- 0:00:22
      688500 -- (-387.683) (-389.357) [-385.700] (-386.932) * (-387.521) (-387.220) (-386.170) [-391.885] -- 0:00:22
      689000 -- (-386.049) (-388.283) (-385.235) [-386.163] * (-386.386) (-386.089) (-384.995) [-386.732] -- 0:00:22
      689500 -- (-386.718) (-386.285) (-387.063) [-385.656] * (-388.918) (-386.719) [-388.980] (-385.264) -- 0:00:22
      690000 -- (-387.621) (-385.906) [-385.897] (-389.528) * [-386.656] (-387.981) (-388.474) (-386.828) -- 0:00:22

      Average standard deviation of split frequencies: 0.009129

      690500 -- (-388.808) [-388.261] (-386.808) (-386.070) * (-385.146) [-386.057] (-387.710) (-390.252) -- 0:00:22
      691000 -- (-387.154) (-389.603) (-387.717) [-387.040] * [-387.286] (-386.561) (-385.920) (-389.275) -- 0:00:22
      691500 -- (-388.099) (-386.789) [-386.271] (-391.285) * (-388.570) [-391.074] (-389.209) (-388.154) -- 0:00:22
      692000 -- (-387.812) (-386.487) (-387.267) [-385.217] * (-386.075) (-387.351) [-385.260] (-386.601) -- 0:00:22
      692500 -- (-386.762) (-385.864) [-387.533] (-386.586) * [-387.509] (-387.401) (-385.604) (-386.873) -- 0:00:22
      693000 -- (-388.171) (-385.605) [-392.225] (-386.207) * (-385.051) [-386.175] (-385.483) (-386.502) -- 0:00:22
      693500 -- [-387.564] (-385.086) (-386.221) (-387.356) * (-386.741) (-385.720) [-385.371] (-387.516) -- 0:00:22
      694000 -- [-384.860] (-390.328) (-388.643) (-386.014) * [-389.543] (-385.888) (-386.845) (-387.465) -- 0:00:22
      694500 -- (-389.677) [-388.015] (-390.434) (-388.122) * (-389.926) (-387.318) [-385.393] (-388.386) -- 0:00:21
      695000 -- [-387.730] (-385.055) (-392.085) (-387.285) * (-390.430) [-387.712] (-388.421) (-386.745) -- 0:00:21

      Average standard deviation of split frequencies: 0.009440

      695500 -- (-388.044) [-387.812] (-388.400) (-389.494) * (-387.129) (-386.741) [-387.726] (-385.646) -- 0:00:21
      696000 -- [-386.747] (-390.488) (-391.570) (-390.350) * (-385.534) [-386.305] (-386.345) (-388.644) -- 0:00:21
      696500 -- (-387.186) (-386.722) (-388.024) [-387.048] * (-385.403) (-386.446) (-386.779) [-389.554] -- 0:00:22
      697000 -- [-387.384] (-385.543) (-388.733) (-387.151) * [-387.261] (-385.966) (-385.300) (-387.228) -- 0:00:22
      697500 -- (-386.470) (-389.687) (-386.977) [-387.430] * (-386.896) [-385.972] (-385.416) (-387.704) -- 0:00:22
      698000 -- (-388.704) [-392.841] (-386.536) (-392.582) * (-388.689) (-388.447) (-387.351) [-386.154] -- 0:00:22
      698500 -- [-388.131] (-385.755) (-389.644) (-387.021) * [-385.914] (-389.060) (-386.135) (-386.614) -- 0:00:22
      699000 -- [-386.362] (-388.481) (-385.025) (-389.686) * (-388.132) (-387.377) (-386.845) [-387.414] -- 0:00:21
      699500 -- [-385.466] (-385.316) (-387.653) (-388.063) * [-386.356] (-386.380) (-387.034) (-389.126) -- 0:00:21
      700000 -- [-387.145] (-385.934) (-388.524) (-387.792) * [-388.418] (-387.141) (-386.668) (-387.847) -- 0:00:21

      Average standard deviation of split frequencies: 0.009167

      700500 -- (-387.125) [-386.689] (-388.007) (-387.170) * (-389.473) (-391.303) (-387.289) [-387.728] -- 0:00:21
      701000 -- (-386.322) (-385.722) [-386.567] (-385.945) * (-388.138) [-389.013] (-388.645) (-386.044) -- 0:00:21
      701500 -- [-386.284] (-386.519) (-390.403) (-385.778) * (-389.151) (-388.700) (-389.299) [-384.758] -- 0:00:21
      702000 -- (-386.200) (-386.030) [-385.345] (-388.421) * (-390.274) (-387.239) (-385.285) [-385.129] -- 0:00:21
      702500 -- [-386.966] (-390.570) (-385.605) (-385.932) * (-392.986) (-385.336) [-386.648] (-386.612) -- 0:00:21
      703000 -- (-387.339) (-386.957) [-387.441] (-390.777) * (-388.830) [-386.841] (-386.810) (-387.175) -- 0:00:21
      703500 -- (-386.378) (-388.915) (-386.861) [-385.857] * [-386.103] (-388.403) (-386.667) (-388.605) -- 0:00:21
      704000 -- (-389.246) (-386.650) (-386.710) [-387.911] * (-385.591) [-387.719] (-388.133) (-387.290) -- 0:00:21
      704500 -- (-387.356) [-386.011] (-389.327) (-386.822) * [-386.831] (-386.825) (-386.124) (-387.468) -- 0:00:21
      705000 -- (-389.508) (-385.593) (-386.537) [-389.363] * (-386.014) (-389.487) [-386.785] (-384.859) -- 0:00:21

      Average standard deviation of split frequencies: 0.008805

      705500 -- (-386.966) (-389.412) (-386.157) [-385.855] * (-387.269) (-388.956) [-386.491] (-388.343) -- 0:00:21
      706000 -- (-386.277) [-386.351] (-386.498) (-391.838) * [-388.150] (-388.182) (-389.961) (-385.738) -- 0:00:21
      706500 -- (-388.075) (-388.347) [-386.183] (-390.841) * (-388.872) [-389.109] (-385.446) (-388.818) -- 0:00:21
      707000 -- (-387.369) [-386.263] (-388.698) (-387.099) * (-387.523) (-385.640) (-386.373) [-390.873] -- 0:00:21
      707500 -- (-386.787) (-394.912) (-386.644) [-386.285] * [-387.448] (-386.491) (-387.231) (-385.842) -- 0:00:21
      708000 -- (-387.430) (-392.528) [-385.263] (-387.528) * [-391.984] (-385.748) (-386.015) (-385.631) -- 0:00:21
      708500 -- (-386.059) [-388.096] (-385.937) (-385.980) * (-386.205) (-386.094) [-387.863] (-387.625) -- 0:00:20
      709000 -- (-386.548) [-386.956] (-386.650) (-387.384) * (-387.112) (-388.924) [-386.653] (-386.101) -- 0:00:20
      709500 -- [-385.584] (-386.349) (-386.058) (-387.347) * (-391.050) [-385.574] (-387.469) (-385.865) -- 0:00:20
      710000 -- [-387.156] (-385.700) (-388.434) (-388.191) * (-388.653) (-385.744) [-387.334] (-385.863) -- 0:00:20

      Average standard deviation of split frequencies: 0.009121

      710500 -- (-385.822) (-384.842) [-386.193] (-391.202) * (-386.359) (-387.429) [-390.930] (-385.778) -- 0:00:20
      711000 -- (-389.556) (-389.027) [-385.892] (-385.396) * (-386.401) [-387.525] (-390.428) (-389.017) -- 0:00:21
      711500 -- (-389.012) (-389.603) [-385.714] (-393.054) * (-386.572) [-388.475] (-385.262) (-388.676) -- 0:00:21
      712000 -- (-384.852) (-387.407) [-386.727] (-391.589) * (-386.881) [-386.339] (-385.015) (-385.829) -- 0:00:21
      712500 -- (-386.086) (-387.254) [-388.002] (-390.124) * (-387.845) (-389.444) (-386.681) [-386.170] -- 0:00:20
      713000 -- (-385.174) [-386.382] (-386.850) (-386.464) * [-388.593] (-385.290) (-388.636) (-386.801) -- 0:00:20
      713500 -- (-386.296) (-386.536) (-387.373) [-387.027] * (-388.557) (-386.997) (-388.279) [-385.517] -- 0:00:20
      714000 -- [-386.834] (-387.496) (-387.981) (-386.521) * (-386.907) (-385.699) [-386.602] (-385.898) -- 0:00:20
      714500 -- (-388.382) (-388.216) [-387.163] (-386.094) * [-385.036] (-385.914) (-391.295) (-387.312) -- 0:00:20
      715000 -- (-387.795) [-387.335] (-389.927) (-386.494) * [-386.223] (-389.030) (-386.662) (-387.800) -- 0:00:20

      Average standard deviation of split frequencies: 0.008682

      715500 -- (-387.049) (-386.116) (-386.388) [-385.597] * (-385.399) (-387.651) [-385.076] (-388.664) -- 0:00:20
      716000 -- [-386.432] (-388.251) (-385.911) (-385.470) * [-385.604] (-388.553) (-387.410) (-386.174) -- 0:00:20
      716500 -- [-385.561] (-388.374) (-385.949) (-385.052) * (-385.580) [-385.134] (-385.022) (-386.011) -- 0:00:20
      717000 -- (-386.475) (-385.175) [-386.679] (-387.376) * (-393.087) (-385.225) [-386.252] (-387.183) -- 0:00:20
      717500 -- (-392.680) [-386.095] (-387.522) (-387.992) * (-392.131) (-386.155) (-388.438) [-385.086] -- 0:00:20
      718000 -- [-387.328] (-387.734) (-385.902) (-387.517) * (-389.490) (-386.991) (-389.372) [-386.625] -- 0:00:20
      718500 -- (-388.536) [-385.889] (-386.079) (-388.630) * (-387.193) [-387.420] (-386.245) (-388.144) -- 0:00:20
      719000 -- (-386.662) (-386.940) [-387.163] (-388.625) * (-387.142) [-388.179] (-391.351) (-390.426) -- 0:00:20
      719500 -- [-387.356] (-385.134) (-386.055) (-389.198) * (-388.085) (-387.535) [-388.105] (-389.218) -- 0:00:20
      720000 -- [-385.744] (-385.757) (-386.263) (-388.122) * (-392.116) (-392.848) [-387.772] (-387.318) -- 0:00:20

      Average standard deviation of split frequencies: 0.009158

      720500 -- (-385.751) (-389.033) [-385.646] (-385.748) * [-385.433] (-390.324) (-386.671) (-386.329) -- 0:00:20
      721000 -- (-386.403) [-391.494] (-392.711) (-388.468) * (-385.434) (-389.894) [-386.970] (-386.616) -- 0:00:20
      721500 -- [-385.553] (-389.919) (-388.341) (-387.658) * [-385.718] (-389.251) (-391.969) (-386.184) -- 0:00:20
      722000 -- (-388.308) (-389.541) [-385.350] (-385.631) * (-387.736) (-385.757) (-386.693) [-385.461] -- 0:00:20
      722500 -- (-387.906) (-390.365) [-388.932] (-385.313) * [-387.667] (-385.816) (-386.595) (-389.927) -- 0:00:19
      723000 -- (-389.866) [-388.440] (-387.288) (-389.744) * (-387.397) (-385.851) [-385.327] (-388.178) -- 0:00:19
      723500 -- (-387.294) (-388.332) (-386.618) [-389.344] * (-387.671) [-388.031] (-385.016) (-388.214) -- 0:00:19
      724000 -- (-387.181) (-387.390) [-385.952] (-390.004) * (-391.263) (-385.197) (-385.810) [-389.984] -- 0:00:19
      724500 -- (-386.567) (-387.476) [-386.985] (-386.752) * (-390.132) (-387.944) (-386.769) [-386.980] -- 0:00:19
      725000 -- (-393.045) (-386.638) [-385.935] (-388.521) * (-391.847) (-386.353) [-392.740] (-389.925) -- 0:00:20

      Average standard deviation of split frequencies: 0.009172

      725500 -- (-389.173) (-386.003) [-388.043] (-389.590) * [-385.683] (-390.946) (-388.085) (-386.714) -- 0:00:20
      726000 -- [-386.871] (-387.315) (-396.247) (-385.863) * [-385.974] (-389.084) (-385.811) (-389.283) -- 0:00:20
      726500 -- [-385.749] (-389.053) (-390.088) (-387.977) * (-392.377) [-387.235] (-387.473) (-388.309) -- 0:00:19
      727000 -- (-391.184) [-387.305] (-386.784) (-390.571) * (-386.992) (-388.244) [-388.654] (-388.364) -- 0:00:19
      727500 -- (-386.076) (-393.051) (-390.457) [-385.810] * (-386.012) [-387.747] (-389.742) (-393.398) -- 0:00:19
      728000 -- (-385.386) [-386.015] (-387.998) (-389.647) * (-386.242) (-387.865) (-387.898) [-393.036] -- 0:00:19
      728500 -- (-385.344) (-387.614) (-385.910) [-387.068] * (-387.813) (-385.207) [-386.285] (-388.560) -- 0:00:19
      729000 -- (-386.285) (-388.906) (-385.893) [-385.977] * [-387.756] (-386.458) (-393.477) (-391.500) -- 0:00:19
      729500 -- (-385.437) (-385.897) (-386.497) [-387.244] * [-389.278] (-389.099) (-393.956) (-386.419) -- 0:00:19
      730000 -- (-385.568) [-390.819] (-388.610) (-385.836) * [-385.622] (-387.635) (-388.205) (-384.962) -- 0:00:19

      Average standard deviation of split frequencies: 0.009355

      730500 -- [-387.090] (-386.177) (-387.553) (-386.400) * [-387.183] (-386.323) (-388.427) (-385.749) -- 0:00:19
      731000 -- (-385.688) (-385.306) (-392.282) [-389.509] * (-385.680) (-386.915) (-387.771) [-385.931] -- 0:00:19
      731500 -- [-385.872] (-389.263) (-385.129) (-385.448) * (-390.661) (-386.246) [-394.139] (-387.396) -- 0:00:19
      732000 -- (-392.375) (-386.500) (-384.807) [-387.393] * (-393.122) (-385.639) (-389.392) [-387.888] -- 0:00:19
      732500 -- (-386.638) (-386.898) [-385.853] (-388.802) * (-395.633) (-386.970) (-386.002) [-388.415] -- 0:00:19
      733000 -- (-386.779) (-387.926) (-386.424) [-386.014] * (-393.756) [-386.225] (-390.779) (-385.793) -- 0:00:19
      733500 -- [-387.742] (-387.498) (-385.861) (-390.914) * [-385.468] (-385.907) (-386.826) (-388.184) -- 0:00:19
      734000 -- (-388.324) [-386.707] (-385.624) (-388.336) * (-386.943) (-386.059) [-387.470] (-387.510) -- 0:00:19
      734500 -- (-387.213) (-386.438) (-386.369) [-386.826] * (-389.295) (-385.061) (-387.402) [-387.050] -- 0:00:19
      735000 -- [-388.100] (-387.994) (-387.967) (-385.623) * (-388.715) [-385.869] (-384.813) (-388.756) -- 0:00:19

      Average standard deviation of split frequencies: 0.008741

      735500 -- [-386.730] (-388.018) (-389.148) (-387.522) * (-385.683) [-386.565] (-387.675) (-385.524) -- 0:00:19
      736000 -- (-385.590) (-387.246) (-388.037) [-388.260] * (-385.439) (-385.137) [-386.830] (-385.283) -- 0:00:19
      736500 -- (-388.871) (-389.299) [-389.407] (-386.879) * (-390.850) [-386.006] (-386.195) (-386.792) -- 0:00:18
      737000 -- (-385.324) [-385.796] (-387.090) (-387.362) * (-386.498) (-385.721) (-386.641) [-385.619] -- 0:00:18
      737500 -- (-385.466) (-389.347) (-387.382) [-389.302] * [-392.215] (-391.482) (-385.880) (-386.783) -- 0:00:18
      738000 -- (-385.276) (-387.895) (-389.654) [-387.593] * (-387.369) (-389.101) [-388.605] (-386.131) -- 0:00:18
      738500 -- (-391.627) (-387.735) [-387.316] (-393.109) * [-389.707] (-387.405) (-385.485) (-387.069) -- 0:00:18
      739000 -- (-389.891) (-385.894) [-389.997] (-387.203) * [-387.474] (-385.026) (-390.288) (-388.289) -- 0:00:19
      739500 -- (-389.975) (-386.080) (-387.040) [-388.151] * (-387.357) (-389.251) [-391.149] (-387.632) -- 0:00:19
      740000 -- [-388.416] (-385.336) (-384.805) (-385.885) * [-387.273] (-386.676) (-392.188) (-386.554) -- 0:00:18

      Average standard deviation of split frequencies: 0.008424

      740500 -- (-384.991) (-386.617) [-386.366] (-391.349) * (-386.547) (-387.655) (-386.843) [-390.317] -- 0:00:18
      741000 -- [-385.509] (-388.239) (-387.469) (-386.966) * [-386.082] (-386.178) (-388.631) (-385.671) -- 0:00:18
      741500 -- (-385.391) (-387.215) [-388.355] (-387.456) * (-387.231) [-391.679] (-385.538) (-389.453) -- 0:00:18
      742000 -- (-385.170) (-386.141) (-385.202) [-385.936] * (-385.785) (-386.298) (-386.715) [-385.672] -- 0:00:18
      742500 -- (-388.118) (-385.614) [-390.864] (-387.717) * [-388.906] (-386.996) (-386.526) (-386.130) -- 0:00:18
      743000 -- (-386.165) (-386.433) [-389.969] (-386.603) * (-385.383) [-389.623] (-391.409) (-388.975) -- 0:00:18
      743500 -- (-388.608) [-388.363] (-387.709) (-386.791) * (-386.465) [-387.567] (-388.907) (-385.539) -- 0:00:18
      744000 -- (-388.059) [-389.847] (-390.487) (-387.114) * (-385.799) [-385.456] (-386.362) (-387.327) -- 0:00:18
      744500 -- (-387.437) [-389.065] (-393.215) (-386.263) * (-385.819) [-388.508] (-389.516) (-385.782) -- 0:00:18
      745000 -- (-389.320) [-387.181] (-392.242) (-386.832) * [-386.791] (-385.607) (-389.244) (-387.152) -- 0:00:18

      Average standard deviation of split frequencies: 0.008475

      745500 -- (-387.459) (-388.162) (-392.180) [-387.489] * (-386.055) [-385.844] (-389.038) (-386.278) -- 0:00:18
      746000 -- [-386.966] (-388.066) (-392.335) (-386.760) * [-385.637] (-385.210) (-388.133) (-389.435) -- 0:00:18
      746500 -- [-387.037] (-386.411) (-388.596) (-388.116) * (-385.560) (-386.105) [-386.730] (-386.562) -- 0:00:18
      747000 -- (-386.912) (-387.399) [-386.884] (-386.700) * (-388.135) (-387.380) [-389.270] (-388.639) -- 0:00:18
      747500 -- [-385.122] (-385.091) (-386.744) (-386.477) * [-386.631] (-385.607) (-386.970) (-390.704) -- 0:00:18
      748000 -- (-386.519) (-388.635) [-386.472] (-389.326) * (-384.862) (-386.945) [-387.865] (-387.524) -- 0:00:18
      748500 -- (-385.547) (-387.822) (-389.960) [-387.354] * (-388.051) [-386.766] (-387.378) (-388.492) -- 0:00:18
      749000 -- [-387.040] (-391.098) (-386.018) (-386.748) * [-386.459] (-389.077) (-385.538) (-388.177) -- 0:00:18
      749500 -- (-391.312) [-388.304] (-385.708) (-387.178) * [-385.924] (-390.230) (-386.864) (-385.907) -- 0:00:18
      750000 -- (-388.203) (-384.845) (-388.209) [-388.560] * [-385.885] (-388.673) (-385.633) (-386.325) -- 0:00:18

      Average standard deviation of split frequencies: 0.009027

      750500 -- (-387.599) [-386.802] (-386.806) (-386.118) * (-386.215) (-385.566) [-389.250] (-386.876) -- 0:00:17
      751000 -- (-386.457) (-386.356) (-388.224) [-385.587] * (-386.216) (-386.173) (-385.950) [-385.844] -- 0:00:17
      751500 -- (-385.694) (-385.366) (-386.882) [-386.456] * (-388.639) (-388.785) [-385.892] (-384.761) -- 0:00:17
      752000 -- (-387.927) (-388.530) (-387.850) [-386.360] * (-390.335) (-387.826) (-386.839) [-385.417] -- 0:00:17
      752500 -- [-386.511] (-389.447) (-386.616) (-388.197) * (-392.711) (-390.673) [-387.075] (-386.631) -- 0:00:17
      753000 -- (-390.020) (-387.120) (-389.363) [-384.933] * [-387.076] (-388.313) (-387.749) (-389.232) -- 0:00:17
      753500 -- (-385.066) (-388.750) [-388.082] (-385.600) * (-386.791) (-391.610) (-386.458) [-384.959] -- 0:00:17
      754000 -- [-385.788] (-385.703) (-387.650) (-387.381) * (-385.236) (-389.505) [-386.242] (-386.451) -- 0:00:17
      754500 -- (-385.522) (-388.158) (-387.863) [-388.083] * (-386.942) (-391.443) [-387.983] (-385.363) -- 0:00:17
      755000 -- (-388.840) (-386.983) (-386.570) [-386.103] * (-389.647) [-390.440] (-386.413) (-387.737) -- 0:00:17

      Average standard deviation of split frequencies: 0.008326

      755500 -- (-386.128) (-391.124) [-386.402] (-392.330) * (-387.364) (-387.878) [-386.233] (-385.989) -- 0:00:17
      756000 -- (-390.474) (-391.991) [-385.881] (-386.172) * (-386.274) [-386.332] (-386.093) (-385.681) -- 0:00:17
      756500 -- [-385.113] (-388.501) (-386.105) (-386.218) * (-387.281) (-386.933) (-389.582) [-386.262] -- 0:00:17
      757000 -- (-386.068) (-386.457) [-390.162] (-389.579) * (-386.749) (-386.298) [-385.735] (-386.094) -- 0:00:17
      757500 -- [-386.173] (-388.168) (-386.279) (-387.355) * (-386.656) [-389.810] (-391.641) (-388.975) -- 0:00:17
      758000 -- (-386.025) [-386.955] (-390.719) (-386.916) * (-385.855) (-387.436) (-385.802) [-386.805] -- 0:00:17
      758500 -- (-387.546) (-385.991) (-389.206) [-387.485] * (-385.619) (-387.397) (-388.018) [-387.678] -- 0:00:17
      759000 -- (-386.389) (-385.701) [-386.013] (-395.160) * (-387.627) (-386.836) [-389.280] (-386.847) -- 0:00:17
      759500 -- (-385.027) (-387.109) [-387.096] (-389.952) * (-387.078) (-389.959) (-386.748) [-385.268] -- 0:00:17
      760000 -- (-392.420) (-386.475) [-385.582] (-389.199) * [-386.467] (-388.479) (-387.185) (-386.951) -- 0:00:17

      Average standard deviation of split frequencies: 0.007874

      760500 -- (-392.465) (-389.384) [-386.694] (-385.316) * (-387.450) (-385.531) (-386.533) [-387.158] -- 0:00:17
      761000 -- (-387.500) (-386.548) [-388.599] (-387.312) * (-388.520) (-390.504) [-388.347] (-387.337) -- 0:00:17
      761500 -- [-386.200] (-385.379) (-387.827) (-385.619) * (-387.471) (-386.082) (-386.410) [-388.088] -- 0:00:17
      762000 -- (-387.241) (-385.537) (-385.838) [-388.501] * (-386.738) (-386.554) [-388.920] (-390.217) -- 0:00:17
      762500 -- (-387.497) (-387.093) [-385.991] (-390.945) * (-388.917) (-386.176) [-384.884] (-386.070) -- 0:00:17
      763000 -- (-389.563) [-386.616] (-386.477) (-387.137) * [-387.522] (-385.372) (-386.410) (-388.258) -- 0:00:17
      763500 -- (-385.474) [-387.108] (-388.353) (-387.586) * (-386.777) (-386.334) (-388.088) [-386.886] -- 0:00:17
      764000 -- (-387.861) (-387.077) (-385.012) [-387.012] * (-387.455) (-385.364) [-385.861] (-386.731) -- 0:00:16
      764500 -- (-386.292) (-386.053) [-385.903] (-387.000) * [-385.380] (-385.879) (-384.912) (-386.346) -- 0:00:16
      765000 -- (-386.365) (-387.782) [-386.687] (-388.889) * [-386.643] (-387.693) (-385.998) (-391.865) -- 0:00:16

      Average standard deviation of split frequencies: 0.007892

      765500 -- [-384.990] (-389.898) (-387.603) (-387.691) * (-386.210) [-386.374] (-387.524) (-386.760) -- 0:00:16
      766000 -- [-385.498] (-386.173) (-389.298) (-385.362) * [-390.679] (-389.604) (-388.193) (-385.563) -- 0:00:16
      766500 -- (-385.516) [-387.570] (-389.378) (-385.639) * [-387.282] (-387.636) (-386.108) (-390.240) -- 0:00:16
      767000 -- (-388.712) [-384.798] (-388.069) (-389.798) * [-388.271] (-395.506) (-387.003) (-386.350) -- 0:00:17
      767500 -- (-388.845) (-385.950) (-387.359) [-386.053] * [-385.858] (-385.106) (-386.645) (-384.995) -- 0:00:16
      768000 -- (-388.422) (-386.372) (-388.693) [-385.597] * [-388.577] (-389.160) (-389.677) (-388.638) -- 0:00:16
      768500 -- [-387.213] (-388.435) (-385.721) (-389.698) * [-387.751] (-388.085) (-391.467) (-389.633) -- 0:00:16
      769000 -- [-387.253] (-386.092) (-388.590) (-387.523) * [-393.032] (-391.976) (-386.536) (-388.800) -- 0:00:16
      769500 -- (-388.126) (-389.041) (-387.867) [-386.697] * (-385.944) (-387.599) [-386.952] (-385.559) -- 0:00:16
      770000 -- (-385.993) [-386.946] (-387.302) (-387.403) * (-385.992) (-390.329) (-385.085) [-386.223] -- 0:00:16

      Average standard deviation of split frequencies: 0.007952

      770500 -- (-387.604) [-387.982] (-388.573) (-388.348) * [-386.761] (-394.855) (-385.890) (-387.547) -- 0:00:16
      771000 -- (-391.068) (-390.147) (-386.783) [-388.229] * (-388.579) (-388.240) [-385.568] (-386.234) -- 0:00:16
      771500 -- (-392.367) (-388.963) (-386.734) [-387.379] * (-390.579) (-386.698) [-386.624] (-388.141) -- 0:00:16
      772000 -- (-390.729) (-387.314) [-387.393] (-391.818) * (-386.692) (-388.528) (-385.418) [-387.909] -- 0:00:16
      772500 -- [-386.386] (-386.393) (-387.326) (-385.634) * (-388.460) (-394.183) [-392.774] (-390.049) -- 0:00:16
      773000 -- (-386.744) (-386.445) [-387.317] (-390.590) * (-386.951) (-386.024) (-389.400) [-386.834] -- 0:00:16
      773500 -- [-386.771] (-385.460) (-389.960) (-386.124) * (-387.546) (-388.918) (-386.531) [-386.119] -- 0:00:16
      774000 -- (-385.536) [-386.166] (-388.531) (-390.141) * [-385.665] (-390.539) (-391.178) (-385.843) -- 0:00:16
      774500 -- (-389.450) (-387.483) [-387.390] (-386.947) * (-386.118) (-385.731) (-388.179) [-385.053] -- 0:00:16
      775000 -- [-389.019] (-388.696) (-386.126) (-386.215) * (-384.929) (-386.486) [-387.565] (-386.066) -- 0:00:16

      Average standard deviation of split frequencies: 0.007361

      775500 -- (-386.402) (-387.393) [-384.709] (-386.383) * (-386.277) (-386.418) [-389.849] (-389.705) -- 0:00:16
      776000 -- [-386.214] (-387.195) (-384.926) (-387.006) * (-387.698) (-388.559) [-385.293] (-387.526) -- 0:00:16
      776500 -- (-386.517) [-387.156] (-387.435) (-385.656) * (-387.974) (-385.257) [-387.930] (-390.748) -- 0:00:16
      777000 -- [-385.996] (-385.615) (-385.671) (-385.601) * (-387.381) [-387.143] (-386.208) (-388.615) -- 0:00:16
      777500 -- (-386.821) (-389.525) [-387.402] (-386.526) * (-387.869) (-386.573) [-386.846] (-391.764) -- 0:00:16
      778000 -- [-385.897] (-388.251) (-387.160) (-388.784) * (-387.377) [-390.111] (-390.921) (-387.102) -- 0:00:15
      778500 -- (-389.998) [-387.539] (-392.198) (-386.880) * (-388.522) (-388.884) (-391.065) [-386.409] -- 0:00:15
      779000 -- (-388.963) (-385.765) [-390.158] (-390.062) * (-386.025) (-387.469) (-387.556) [-386.171] -- 0:00:15
      779500 -- (-385.235) [-389.113] (-389.906) (-387.996) * [-384.954] (-388.944) (-386.265) (-386.772) -- 0:00:15
      780000 -- [-386.927] (-387.849) (-387.716) (-388.045) * (-388.790) (-386.116) (-386.254) [-386.696] -- 0:00:15

      Average standard deviation of split frequencies: 0.007495

      780500 -- (-387.897) (-388.516) [-386.808] (-389.329) * (-386.381) (-386.200) [-386.237] (-387.785) -- 0:00:15
      781000 -- (-386.119) (-386.718) [-388.480] (-387.009) * (-386.168) (-387.010) (-386.424) [-385.376] -- 0:00:15
      781500 -- (-386.611) [-387.706] (-387.581) (-387.063) * (-387.489) (-386.494) (-385.255) [-386.767] -- 0:00:15
      782000 -- [-385.522] (-387.563) (-385.719) (-385.989) * (-385.376) (-387.066) [-387.372] (-388.370) -- 0:00:15
      782500 -- (-386.220) [-385.986] (-386.600) (-385.760) * (-386.498) (-387.553) [-390.555] (-385.471) -- 0:00:15
      783000 -- (-386.984) (-386.512) (-389.698) [-385.277] * (-389.559) [-389.894] (-391.442) (-386.668) -- 0:00:15
      783500 -- (-385.435) (-386.748) [-387.382] (-386.620) * (-387.328) [-388.237] (-390.106) (-389.033) -- 0:00:15
      784000 -- (-387.671) (-388.536) (-390.248) [-385.987] * [-387.610] (-387.970) (-388.181) (-386.135) -- 0:00:15
      784500 -- [-386.421] (-388.560) (-386.755) (-384.933) * (-389.439) (-389.554) (-388.571) [-385.824] -- 0:00:15
      785000 -- (-386.819) (-385.081) (-385.350) [-385.095] * (-391.902) [-387.084] (-385.861) (-386.623) -- 0:00:15

      Average standard deviation of split frequencies: 0.007903

      785500 -- [-389.549] (-387.826) (-387.471) (-386.042) * (-392.793) [-386.534] (-388.656) (-386.767) -- 0:00:15
      786000 --