--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:10:43 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/rpsS/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -386.35 -389.92
2 -386.38 -389.80
--------------------------------------
TOTAL -386.36 -389.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896501 0.089263 0.335835 1.477724 0.864119 1355.72 1428.36 1.000
r(A<->C){all} 0.162306 0.019085 0.000122 0.442583 0.127266 199.05 208.79 1.000
r(A<->G){all} 0.165454 0.018664 0.000018 0.439914 0.132401 208.76 244.43 1.004
r(A<->T){all} 0.169710 0.020854 0.000078 0.459402 0.133615 214.48 237.54 1.004
r(C<->G){all} 0.165868 0.021280 0.000031 0.464043 0.125060 199.69 203.98 1.000
r(C<->T){all} 0.162087 0.018667 0.000098 0.445064 0.125207 242.03 281.84 1.002
r(G<->T){all} 0.174575 0.021546 0.000074 0.470894 0.136317 230.60 295.58 1.008
pi(A){all} 0.264301 0.000724 0.214151 0.319892 0.263747 1303.68 1315.62 1.000
pi(C){all} 0.271753 0.000708 0.219633 0.323654 0.270841 1264.13 1308.72 1.000
pi(G){all} 0.265008 0.000670 0.216336 0.317913 0.263951 1366.33 1433.66 1.000
pi(T){all} 0.198938 0.000550 0.154774 0.245083 0.198039 1330.04 1399.10 1.000
alpha{1,2} 0.400770 0.202227 0.000204 1.315972 0.246340 1228.53 1279.44 1.000
alpha{3} 0.448184 0.232293 0.000119 1.438954 0.281797 1215.67 1329.77 1.000
pinvar{all} 0.993785 0.000052 0.979491 0.999997 0.996202 1306.95 1391.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -367.512444
Model 2: PositiveSelection -367.512343
Model 0: one-ratio -367.512471
Model 7: beta -367.512343
Model 8: beta&w>1 -367.512343
Model 0 vs 1 5.3999999977349944E-5
Model 2 vs 1 2.0200000005843322E-4
Model 8 vs 7 0.0
>C1
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C2
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C3
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C4
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C5
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C6
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=93
C1 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C2 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C3 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C4 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C5 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C6 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
**************************************************
C1 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C2 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C3 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C4 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C5 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C6 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
*******************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 93 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 93 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [2790]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [2790]--->[2790]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.441 Mb, Max= 30.606 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C2 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C3 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C4 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C5 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
C6 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
**************************************************
C1 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C2 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C3 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C4 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C5 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
C6 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
*******************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C2 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C3 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C4 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C5 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
C6 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
**************************************************
C1 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C2 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C3 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C4 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C5 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
C6 GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
**************************************************
C1 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C2 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C3 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C4 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C5 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
C6 GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
**************************************************
C1 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C2 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C3 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C4 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C5 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
C6 GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
**************************************************
C1 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C2 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C3 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C4 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C5 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
C6 GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
**************************************************
C1 TCAAGGATGACCGGAAGGCCAAACGACGA
C2 TCAAGGATGACCGGAAGGCCAAACGACGA
C3 TCAAGGATGACCGGAAGGCCAAACGACGA
C4 TCAAGGATGACCGGAAGGCCAAACGACGA
C5 TCAAGGATGACCGGAAGGCCAAACGACGA
C6 TCAAGGATGACCGGAAGGCCAAACGACGA
*****************************
>C1
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C2
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C3
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C4
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C5
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C6
ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA
GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT
GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG
GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT
GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA
TCAAGGATGACCGGAAGGCCAAACGACGA
>C1
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C2
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C3
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C4
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C5
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
>C6
MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 279 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788549
Setting output file names to "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2024459600
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0454929038
Seed = 702443027
Swapseed = 1579788549
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -624.415377 -- -24.965149
Chain 2 -- -624.415377 -- -24.965149
Chain 3 -- -624.415282 -- -24.965149
Chain 4 -- -624.415342 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -624.415377 -- -24.965149
Chain 2 -- -624.415342 -- -24.965149
Chain 3 -- -624.415342 -- -24.965149
Chain 4 -- -624.415377 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-624.415] (-624.415) (-624.415) (-624.415) * [-624.415] (-624.415) (-624.415) (-624.415)
500 -- (-393.434) (-400.251) (-397.532) [-395.171] * (-405.320) (-399.812) [-392.848] (-394.321) -- 0:00:00
1000 -- (-398.934) [-396.786] (-397.664) (-393.213) * [-392.039] (-388.564) (-396.444) (-398.887) -- 0:00:00
1500 -- (-399.311) (-398.167) [-389.964] (-394.920) * (-394.195) (-407.119) (-391.368) [-399.266] -- 0:00:00
2000 -- (-393.169) (-396.573) [-390.978] (-396.244) * (-397.263) [-395.926] (-394.867) (-405.264) -- 0:00:00
2500 -- (-394.196) (-406.574) (-394.001) [-401.152] * (-395.319) [-402.838] (-395.667) (-399.906) -- 0:00:00
3000 -- (-396.022) [-392.668] (-395.489) (-394.214) * (-393.496) (-394.550) (-398.845) [-390.951] -- 0:00:00
3500 -- [-392.709] (-404.300) (-395.620) (-399.467) * (-396.328) [-395.285] (-405.917) (-395.842) -- 0:00:00
4000 -- (-391.554) (-399.700) [-395.220] (-403.098) * (-403.655) (-405.585) (-403.890) [-399.432] -- 0:00:00
4500 -- [-391.337] (-392.194) (-396.283) (-398.078) * (-406.331) (-402.437) [-391.995] (-401.550) -- 0:00:00
5000 -- (-401.679) (-396.428) [-393.788] (-397.866) * (-401.374) (-398.968) [-396.614] (-402.884) -- 0:00:00
Average standard deviation of split frequencies: 0.102138
5500 -- (-397.173) (-398.388) [-399.225] (-401.033) * (-392.893) (-404.548) (-398.620) [-396.595] -- 0:00:00
6000 -- (-399.563) [-391.754] (-393.198) (-394.302) * (-398.022) (-395.140) [-400.972] (-395.687) -- 0:00:00
6500 -- (-394.606) [-392.747] (-394.406) (-396.005) * (-398.360) [-393.633] (-397.787) (-395.754) -- 0:00:00
7000 -- (-395.233) [-395.873] (-398.848) (-398.004) * (-405.146) [-390.623] (-392.037) (-392.284) -- 0:00:00
7500 -- (-396.503) (-406.524) [-396.695] (-401.349) * (-403.044) (-392.449) [-396.173] (-392.819) -- 0:00:00
8000 -- (-397.679) (-399.585) (-397.998) [-398.638] * (-386.865) (-393.937) [-397.256] (-397.406) -- 0:00:00
8500 -- (-410.079) (-396.164) (-397.437) [-401.242] * [-388.042] (-399.017) (-401.045) (-399.780) -- 0:01:56
9000 -- [-396.433] (-396.788) (-399.941) (-405.381) * [-388.118] (-401.453) (-397.741) (-409.469) -- 0:01:50
9500 -- [-396.351] (-406.823) (-392.705) (-392.945) * (-386.508) [-393.403] (-397.556) (-404.028) -- 0:01:44
10000 -- (-395.469) [-387.130] (-400.902) (-395.173) * (-385.374) (-401.943) [-398.233] (-409.142) -- 0:01:39
Average standard deviation of split frequencies: 0.079550
10500 -- [-395.814] (-384.810) (-391.048) (-398.455) * (-387.846) (-406.062) [-396.371] (-395.427) -- 0:01:34
11000 -- (-395.874) [-386.284] (-406.181) (-389.862) * (-389.223) (-395.454) [-392.739] (-393.343) -- 0:01:29
11500 -- [-405.363] (-385.176) (-400.169) (-395.949) * [-387.359] (-390.375) (-397.646) (-402.017) -- 0:01:25
12000 -- (-399.024) (-386.264) (-397.994) [-396.535] * (-388.918) [-395.424] (-397.802) (-396.556) -- 0:01:22
12500 -- [-388.266] (-386.183) (-404.651) (-398.895) * (-385.821) (-401.602) (-390.307) [-393.941] -- 0:01:19
13000 -- (-385.899) (-388.681) (-400.686) [-397.914] * (-385.574) (-393.241) (-391.002) [-394.070] -- 0:01:15
13500 -- [-388.410] (-385.294) (-397.464) (-397.574) * (-386.964) (-396.084) (-394.686) [-396.504] -- 0:01:13
14000 -- (-385.170) (-392.998) (-393.771) [-392.809] * [-388.362] (-402.463) (-397.592) (-402.725) -- 0:01:10
14500 -- [-385.810] (-386.464) (-407.171) (-401.686) * (-386.534) (-393.996) [-394.518] (-398.178) -- 0:01:07
15000 -- (-387.704) (-388.111) (-397.489) [-402.803] * (-385.554) [-396.298] (-398.046) (-397.088) -- 0:01:05
Average standard deviation of split frequencies: 0.058926
15500 -- (-384.901) (-386.328) (-396.746) [-393.153] * [-385.546] (-398.221) (-403.249) (-398.700) -- 0:01:03
16000 -- [-388.446] (-385.128) (-406.277) (-401.617) * [-387.175] (-404.139) (-390.990) (-411.880) -- 0:01:01
16500 -- (-388.947) (-387.660) [-390.899] (-396.008) * (-386.506) (-407.742) [-400.545] (-406.167) -- 0:00:59
17000 -- (-388.379) (-384.969) (-387.940) [-393.074] * (-387.257) (-394.399) [-396.034] (-397.268) -- 0:00:57
17500 -- (-389.294) (-390.769) (-388.569) [-397.285] * (-384.783) (-403.199) [-398.341] (-390.868) -- 0:00:56
18000 -- (-386.935) [-385.883] (-386.894) (-398.564) * (-386.353) (-391.899) [-399.763] (-392.125) -- 0:00:54
18500 -- (-386.598) [-385.550] (-386.775) (-400.859) * (-386.592) [-388.089] (-397.400) (-391.136) -- 0:00:53
19000 -- (-388.503) (-385.061) (-387.400) [-401.478] * [-386.862] (-390.666) (-401.783) (-388.157) -- 0:00:51
19500 -- [-388.492] (-387.095) (-387.240) (-402.278) * (-388.105) [-387.398] (-412.205) (-391.806) -- 0:01:40
20000 -- (-386.740) (-385.639) (-387.063) [-394.489] * (-390.782) [-385.592] (-392.819) (-385.721) -- 0:01:38
Average standard deviation of split frequencies: 0.045620
20500 -- (-385.593) (-385.685) (-385.110) [-398.661] * (-384.792) [-387.523] (-386.672) (-388.350) -- 0:01:35
21000 -- (-387.578) [-385.954] (-386.034) (-405.727) * [-389.778] (-389.632) (-390.909) (-390.487) -- 0:01:33
21500 -- (-386.911) (-386.012) [-386.814] (-396.834) * [-388.136] (-387.500) (-388.703) (-386.121) -- 0:01:31
22000 -- (-386.655) [-387.565] (-385.579) (-396.387) * (-389.642) [-386.450] (-386.007) (-386.059) -- 0:01:28
22500 -- (-392.089) (-385.171) (-386.208) [-397.728] * [-387.674] (-385.476) (-388.477) (-388.566) -- 0:01:26
23000 -- (-388.432) (-389.533) (-387.975) [-392.144] * (-384.834) (-386.565) [-388.335] (-385.890) -- 0:01:24
23500 -- (-387.535) (-386.222) (-385.447) [-397.216] * [-386.093] (-386.730) (-386.519) (-386.304) -- 0:01:23
24000 -- (-385.796) (-388.536) [-389.317] (-397.880) * (-385.662) (-386.347) [-385.919] (-386.757) -- 0:01:21
24500 -- (-389.950) [-388.361] (-389.609) (-406.575) * (-386.962) [-388.209] (-386.137) (-385.939) -- 0:01:19
25000 -- (-388.093) [-386.988] (-387.192) (-395.177) * (-385.800) (-390.381) [-386.396] (-386.659) -- 0:01:18
Average standard deviation of split frequencies: 0.036262
25500 -- (-386.179) (-385.823) [-386.275] (-402.522) * [-385.570] (-389.041) (-385.589) (-388.932) -- 0:01:16
26000 -- (-385.950) (-389.717) [-386.129] (-398.991) * [-387.686] (-385.752) (-387.642) (-389.136) -- 0:01:14
26500 -- (-385.337) (-389.039) (-386.138) [-394.095] * (-395.557) [-387.936] (-389.158) (-387.858) -- 0:01:13
27000 -- (-386.852) (-387.148) [-386.353] (-402.930) * (-387.922) (-387.754) [-386.941] (-388.514) -- 0:01:12
27500 -- (-386.416) [-386.202] (-388.397) (-400.108) * [-387.516] (-392.382) (-386.020) (-385.210) -- 0:01:10
28000 -- (-388.542) [-386.681] (-385.108) (-397.432) * [-387.819] (-388.649) (-388.451) (-386.690) -- 0:01:09
28500 -- (-385.570) [-390.012] (-387.431) (-392.425) * (-386.904) (-385.117) (-389.389) [-385.939] -- 0:01:08
29000 -- (-395.203) (-388.339) (-394.056) [-393.027] * (-385.867) (-385.124) (-389.042) [-386.424] -- 0:01:06
29500 -- (-392.220) [-388.035] (-387.330) (-405.558) * (-387.117) [-385.698] (-388.624) (-384.881) -- 0:01:05
30000 -- (-388.209) [-386.383] (-386.879) (-395.117) * (-388.087) (-385.492) (-386.532) [-388.780] -- 0:01:04
Average standard deviation of split frequencies: 0.035355
30500 -- (-390.858) (-387.107) [-385.961] (-387.478) * (-390.734) [-388.231] (-389.913) (-386.963) -- 0:01:35
31000 -- [-385.878] (-388.236) (-390.583) (-389.743) * (-388.292) (-391.706) [-385.064] (-387.470) -- 0:01:33
31500 -- [-385.943] (-389.499) (-386.662) (-391.586) * (-386.456) [-387.462] (-386.294) (-386.910) -- 0:01:32
32000 -- [-390.878] (-388.845) (-388.416) (-387.576) * (-385.544) (-386.404) [-385.491] (-390.815) -- 0:01:30
32500 -- [-388.317] (-387.858) (-387.436) (-389.453) * (-387.379) [-387.204] (-390.104) (-387.465) -- 0:01:29
33000 -- (-386.424) (-388.348) (-388.914) [-386.238] * (-391.867) (-387.396) [-389.501] (-387.105) -- 0:01:27
33500 -- (-392.215) [-386.458] (-386.407) (-387.417) * (-392.664) (-387.334) [-389.140] (-388.940) -- 0:01:26
34000 -- (-385.800) (-385.539) [-387.026] (-387.060) * (-385.751) [-386.725] (-390.754) (-385.033) -- 0:01:25
34500 -- (-385.926) (-386.643) (-387.101) [-385.583] * (-385.899) (-386.645) [-388.614] (-385.251) -- 0:01:23
35000 -- (-388.046) (-385.538) (-387.877) [-385.849] * (-388.454) (-391.757) (-390.881) [-387.349] -- 0:01:22
Average standard deviation of split frequencies: 0.039284
35500 -- [-386.463] (-385.999) (-389.436) (-385.684) * (-388.714) (-387.419) (-385.712) [-387.984] -- 0:01:21
36000 -- [-385.478] (-386.427) (-391.159) (-389.605) * (-387.637) (-390.305) [-386.575] (-387.873) -- 0:01:20
36500 -- (-387.493) [-388.112] (-386.359) (-387.217) * (-387.232) [-389.582] (-386.968) (-386.270) -- 0:01:19
37000 -- (-388.788) (-385.562) [-384.946] (-385.542) * (-387.039) (-389.611) (-387.222) [-387.005] -- 0:01:18
37500 -- (-390.724) [-387.837] (-385.798) (-387.814) * (-385.396) [-388.658] (-386.930) (-388.531) -- 0:01:17
38000 -- [-386.364] (-386.500) (-386.606) (-385.517) * (-387.179) (-386.348) [-387.830] (-387.862) -- 0:01:15
38500 -- (-387.308) [-385.389] (-386.518) (-388.957) * (-387.396) (-385.976) (-387.742) [-388.771] -- 0:01:14
39000 -- (-387.077) (-387.695) (-392.659) [-394.221] * [-386.983] (-387.286) (-388.113) (-388.214) -- 0:01:13
39500 -- (-391.426) (-387.021) (-387.447) [-389.632] * (-386.726) (-389.430) (-386.602) [-388.798] -- 0:01:12
40000 -- (-390.588) (-386.048) [-385.111] (-389.449) * (-385.392) [-387.653] (-385.030) (-386.627) -- 0:01:12
Average standard deviation of split frequencies: 0.034776
40500 -- (-388.311) (-387.061) [-388.640] (-388.953) * (-390.010) [-387.423] (-385.995) (-387.048) -- 0:01:11
41000 -- (-390.496) (-386.819) (-388.229) [-386.283] * [-387.857] (-387.019) (-386.449) (-385.351) -- 0:01:10
41500 -- (-387.833) (-387.939) (-385.932) [-385.609] * (-385.432) (-388.287) [-385.763] (-392.594) -- 0:01:32
42000 -- [-388.593] (-386.499) (-388.655) (-385.614) * (-387.784) [-387.928] (-384.859) (-388.929) -- 0:01:31
42500 -- (-385.601) (-388.948) [-385.515] (-386.070) * (-387.943) [-386.281] (-385.719) (-386.340) -- 0:01:30
43000 -- (-384.943) (-390.240) [-388.459] (-389.049) * (-387.260) (-387.163) [-388.114] (-386.080) -- 0:01:29
43500 -- (-386.617) [-391.465] (-386.640) (-390.866) * (-388.561) [-386.369] (-389.427) (-390.358) -- 0:01:27
44000 -- [-390.372] (-392.201) (-390.579) (-385.284) * (-386.211) (-385.899) [-387.451] (-390.263) -- 0:01:26
44500 -- [-386.681] (-385.736) (-386.118) (-389.125) * (-389.505) (-386.471) [-387.919] (-387.358) -- 0:01:25
45000 -- (-387.122) (-386.404) [-386.939] (-386.681) * (-386.573) (-386.008) [-385.939] (-387.661) -- 0:01:24
Average standard deviation of split frequencies: 0.025620
45500 -- [-385.372] (-385.575) (-389.695) (-385.223) * (-390.351) [-385.363] (-388.034) (-389.900) -- 0:01:23
46000 -- (-387.368) (-386.529) (-388.565) [-386.667] * [-385.709] (-386.133) (-388.136) (-387.616) -- 0:01:22
46500 -- [-386.735] (-386.051) (-390.419) (-387.404) * (-387.338) (-386.097) [-386.563] (-388.841) -- 0:01:22
47000 -- [-386.149] (-385.559) (-387.245) (-388.158) * [-386.033] (-386.903) (-386.449) (-388.946) -- 0:01:21
47500 -- (-392.424) (-386.402) [-388.518] (-388.880) * (-390.229) (-387.048) [-388.096] (-388.096) -- 0:01:20
48000 -- (-392.264) [-385.152] (-385.891) (-389.067) * [-386.269] (-387.078) (-385.410) (-386.902) -- 0:01:19
48500 -- (-387.895) (-389.112) [-385.035] (-388.510) * [-390.074] (-388.514) (-385.995) (-389.263) -- 0:01:18
49000 -- (-388.212) (-387.756) (-386.401) [-387.958] * [-386.939] (-387.973) (-389.785) (-391.593) -- 0:01:17
49500 -- [-386.159] (-388.567) (-387.494) (-386.992) * [-386.339] (-386.839) (-387.315) (-387.427) -- 0:01:16
50000 -- (-385.799) (-391.387) [-388.537] (-388.726) * [-386.322] (-387.054) (-387.069) (-386.325) -- 0:01:16
Average standard deviation of split frequencies: 0.024294
50500 -- [-387.794] (-390.169) (-387.860) (-386.588) * (-386.543) (-386.950) [-387.301] (-387.906) -- 0:01:15
51000 -- (-386.356) (-385.272) [-387.329] (-386.457) * (-386.027) (-388.199) (-385.824) [-386.463] -- 0:01:14
51500 -- [-386.208] (-385.137) (-388.433) (-390.514) * [-387.641] (-388.276) (-385.209) (-385.390) -- 0:01:13
52000 -- (-389.408) (-384.939) [-386.155] (-389.047) * [-391.598] (-386.005) (-387.373) (-385.321) -- 0:01:12
52500 -- (-389.138) [-386.649] (-387.566) (-385.222) * (-385.483) (-388.400) (-390.360) [-386.340] -- 0:01:12
53000 -- (-388.607) (-387.100) (-389.633) [-388.884] * (-385.942) (-388.089) [-387.700] (-388.698) -- 0:01:11
53500 -- (-386.407) (-385.412) (-388.330) [-385.704] * (-386.031) [-390.304] (-392.228) (-386.701) -- 0:01:10
54000 -- (-384.798) [-385.439] (-392.197) (-386.044) * (-391.546) (-389.592) (-391.467) [-389.031] -- 0:01:10
54500 -- [-386.262] (-387.223) (-389.372) (-386.115) * (-388.690) [-385.538] (-387.145) (-388.327) -- 0:01:26
55000 -- [-386.283] (-387.931) (-389.521) (-387.571) * (-386.297) [-389.008] (-388.177) (-386.175) -- 0:01:25
Average standard deviation of split frequencies: 0.022849
55500 -- [-388.057] (-394.936) (-385.986) (-387.761) * (-386.279) (-385.855) (-386.680) [-385.196] -- 0:01:25
56000 -- [-386.093] (-393.986) (-388.448) (-389.439) * (-387.761) (-389.792) [-388.256] (-385.479) -- 0:01:24
56500 -- [-387.475] (-388.103) (-392.103) (-386.882) * [-385.816] (-387.003) (-385.791) (-387.634) -- 0:01:23
57000 -- (-389.446) [-387.036] (-387.220) (-386.142) * (-386.314) (-391.886) [-384.932] (-386.790) -- 0:01:22
57500 -- (-385.766) [-387.357] (-386.653) (-390.520) * (-386.711) (-392.862) (-391.543) [-385.119] -- 0:01:21
58000 -- (-385.391) (-387.648) (-389.583) [-385.478] * (-388.140) (-386.179) [-389.015] (-387.868) -- 0:01:21
58500 -- (-385.755) (-386.601) (-390.910) [-385.724] * [-386.729] (-387.629) (-385.075) (-385.608) -- 0:01:20
59000 -- (-386.495) (-387.442) [-385.490] (-392.301) * [-386.099] (-385.934) (-387.109) (-385.572) -- 0:01:19
59500 -- (-386.351) [-386.630] (-390.356) (-386.634) * (-387.316) (-387.334) [-386.461] (-385.914) -- 0:01:19
60000 -- (-388.859) (-386.653) (-392.921) [-385.657] * (-386.447) [-388.540] (-386.750) (-385.550) -- 0:01:18
Average standard deviation of split frequencies: 0.018404
60500 -- (-385.709) (-389.702) (-387.194) [-387.056] * (-386.220) (-387.871) [-385.359] (-390.690) -- 0:01:17
61000 -- [-386.407] (-390.045) (-389.707) (-386.124) * (-385.688) (-392.781) (-385.533) [-388.101] -- 0:01:16
61500 -- (-385.697) (-388.710) [-389.768] (-386.422) * (-386.629) (-387.495) [-385.953] (-386.739) -- 0:01:16
62000 -- (-386.820) [-384.862] (-385.688) (-388.429) * [-386.526] (-387.934) (-386.562) (-385.821) -- 0:01:15
62500 -- (-389.894) (-388.067) (-387.226) [-387.081] * [-385.071] (-387.047) (-386.092) (-387.647) -- 0:01:15
63000 -- (-391.227) (-387.856) [-388.420] (-386.883) * [-388.899] (-387.318) (-387.159) (-385.277) -- 0:01:14
63500 -- [-386.262] (-386.909) (-388.431) (-387.501) * (-385.633) (-387.933) (-387.317) [-386.169] -- 0:01:13
64000 -- (-385.024) (-387.161) [-388.341] (-385.712) * (-387.221) (-387.038) (-386.275) [-385.714] -- 0:01:13
64500 -- [-386.587] (-387.188) (-387.539) (-386.175) * (-385.555) (-386.789) [-385.743] (-387.575) -- 0:01:12
65000 -- (-389.825) (-387.050) [-387.060] (-385.635) * [-385.650] (-386.718) (-385.325) (-387.464) -- 0:01:11
Average standard deviation of split frequencies: 0.015079
65500 -- (-385.939) (-390.915) (-390.356) [-388.228] * [-385.057] (-387.154) (-386.376) (-385.141) -- 0:01:11
66000 -- (-387.066) (-390.407) (-387.065) [-384.928] * [-387.998] (-386.811) (-387.145) (-390.255) -- 0:01:10
66500 -- (-387.505) (-391.756) [-387.840] (-390.942) * (-387.079) (-386.050) [-386.614] (-389.870) -- 0:01:10
67000 -- (-388.459) (-387.222) (-386.149) [-387.289] * (-385.561) (-385.761) (-387.476) [-386.471] -- 0:01:09
67500 -- (-385.883) (-387.445) (-385.851) [-387.709] * (-392.777) (-386.471) [-388.731] (-391.909) -- 0:01:09
68000 -- [-390.770] (-391.658) (-395.290) (-386.868) * (-386.253) [-386.799] (-387.440) (-385.642) -- 0:01:08
68500 -- (-389.858) (-386.742) (-391.478) [-387.540] * (-385.412) (-390.118) (-388.299) [-386.333] -- 0:01:21
69000 -- (-388.220) [-387.156] (-390.392) (-388.975) * (-388.589) (-388.503) (-389.771) [-386.415] -- 0:01:20
69500 -- [-386.601] (-385.595) (-387.443) (-386.318) * [-387.230] (-387.494) (-393.175) (-386.619) -- 0:01:20
70000 -- (-385.103) (-385.589) (-388.441) [-388.221] * (-386.544) (-387.060) [-389.465] (-392.340) -- 0:01:19
Average standard deviation of split frequencies: 0.013342
70500 -- (-385.073) (-385.712) [-386.159] (-386.310) * [-385.707] (-387.056) (-386.966) (-388.294) -- 0:01:19
71000 -- (-388.923) (-385.752) [-385.745] (-387.105) * (-388.134) (-387.467) [-385.507] (-386.413) -- 0:01:18
71500 -- [-386.839] (-386.817) (-385.749) (-389.592) * [-387.333] (-394.525) (-385.728) (-385.252) -- 0:01:17
72000 -- (-388.707) [-386.446] (-385.943) (-387.614) * (-386.655) (-385.634) (-385.755) [-390.366] -- 0:01:17
72500 -- (-390.248) (-386.107) [-386.056] (-386.771) * (-385.898) (-388.666) [-388.461] (-390.425) -- 0:01:16
73000 -- (-387.372) [-388.953] (-386.993) (-385.864) * [-386.366] (-389.753) (-385.637) (-387.922) -- 0:01:16
73500 -- [-386.705] (-386.421) (-386.333) (-386.658) * [-385.741] (-385.095) (-385.667) (-387.552) -- 0:01:15
74000 -- (-387.561) [-388.203] (-386.471) (-386.920) * (-386.960) [-386.408] (-385.418) (-386.321) -- 0:01:15
74500 -- (-389.100) [-385.597] (-387.500) (-388.123) * (-387.794) (-385.771) [-387.113] (-386.264) -- 0:01:14
75000 -- (-386.187) [-386.674] (-388.912) (-385.708) * (-386.123) (-387.472) (-387.286) [-386.564] -- 0:01:14
Average standard deviation of split frequencies: 0.015507
75500 -- (-384.778) (-385.411) [-387.406] (-387.188) * (-387.636) (-387.610) [-387.230] (-391.012) -- 0:01:13
76000 -- (-387.089) [-385.978] (-389.016) (-387.287) * (-390.606) [-385.936] (-389.224) (-389.593) -- 0:01:12
76500 -- (-387.089) (-386.481) [-391.469] (-386.718) * (-389.221) [-388.068] (-388.055) (-390.551) -- 0:01:12
77000 -- (-385.903) (-388.644) [-385.913] (-386.886) * (-386.750) [-386.234] (-387.123) (-386.836) -- 0:01:11
77500 -- (-385.933) (-388.018) (-391.498) [-388.888] * (-385.922) [-387.443] (-391.284) (-386.265) -- 0:01:11
78000 -- (-386.548) (-389.207) (-387.354) [-385.931] * (-389.166) [-386.150] (-388.634) (-388.701) -- 0:01:10
78500 -- (-388.490) (-388.725) (-387.911) [-386.870] * (-387.890) (-385.592) [-388.298] (-387.005) -- 0:01:10
79000 -- [-385.075] (-385.571) (-385.227) (-386.812) * (-387.523) (-385.960) [-388.128] (-386.378) -- 0:01:09
79500 -- (-390.739) (-385.362) [-385.554] (-387.118) * (-388.231) [-386.935] (-386.340) (-385.368) -- 0:01:09
80000 -- (-387.293) (-389.890) [-387.290] (-386.221) * (-389.486) (-385.520) [-385.474] (-385.197) -- 0:01:09
Average standard deviation of split frequencies: 0.015340
80500 -- [-385.827] (-385.974) (-386.649) (-390.403) * (-384.871) [-386.519] (-385.585) (-385.854) -- 0:01:08
81000 -- (-384.875) (-388.729) [-386.242] (-389.778) * (-385.464) [-385.563] (-385.432) (-386.392) -- 0:01:08
81500 -- (-385.013) (-386.245) (-385.539) [-388.585] * (-385.144) [-388.825] (-387.169) (-388.494) -- 0:01:07
82000 -- (-386.254) (-385.374) [-388.191] (-387.220) * [-385.040] (-385.450) (-386.879) (-386.522) -- 0:01:18
82500 -- (-386.736) (-385.637) [-387.660] (-385.076) * (-390.484) [-386.804] (-387.902) (-387.107) -- 0:01:17
83000 -- (-386.092) [-386.172] (-386.533) (-385.824) * (-387.744) (-388.212) [-387.347] (-385.673) -- 0:01:17
83500 -- (-392.771) (-386.158) (-388.031) [-389.915] * (-388.865) (-386.007) [-384.841] (-387.295) -- 0:01:16
84000 -- (-387.011) [-388.730] (-395.081) (-390.441) * (-387.478) (-387.271) [-384.799] (-387.093) -- 0:01:16
84500 -- [-384.903] (-386.405) (-385.176) (-388.259) * (-385.476) (-386.702) (-385.579) [-385.380] -- 0:01:15
85000 -- (-386.499) [-390.079] (-386.102) (-389.003) * (-385.410) (-388.880) [-388.032] (-387.982) -- 0:01:15
Average standard deviation of split frequencies: 0.016733
85500 -- (-386.812) [-386.824] (-387.308) (-387.348) * [-385.784] (-385.191) (-387.861) (-390.350) -- 0:01:14
86000 -- (-386.891) (-385.288) [-388.413] (-389.534) * (-388.749) (-387.849) [-386.736] (-389.901) -- 0:01:14
86500 -- (-385.598) (-390.985) [-391.573] (-386.387) * [-388.374] (-387.044) (-386.966) (-388.516) -- 0:01:13
87000 -- [-386.408] (-387.413) (-387.221) (-387.454) * (-388.056) [-385.092] (-388.163) (-386.715) -- 0:01:13
87500 -- [-385.344] (-387.037) (-385.009) (-385.552) * (-389.317) (-384.999) [-388.240] (-388.705) -- 0:01:13
88000 -- (-387.167) (-386.913) [-390.366] (-385.614) * (-386.531) (-384.873) [-386.986] (-385.073) -- 0:01:12
88500 -- (-386.605) (-386.295) (-388.534) [-388.532] * (-388.820) (-385.919) [-386.282] (-387.401) -- 0:01:12
89000 -- (-387.209) (-391.322) (-387.819) [-386.841] * (-385.690) (-385.856) (-387.392) [-387.601] -- 0:01:11
89500 -- (-387.351) (-388.942) (-389.176) [-386.051] * (-386.071) (-386.123) [-389.131] (-385.893) -- 0:01:11
90000 -- (-387.186) (-388.950) (-390.176) [-385.703] * (-385.143) (-385.776) (-388.468) [-384.931] -- 0:01:10
Average standard deviation of split frequencies: 0.015020
90500 -- (-390.386) (-386.561) (-388.902) [-384.931] * (-385.048) (-387.012) [-387.893] (-388.404) -- 0:01:10
91000 -- (-389.463) (-386.634) (-387.637) [-389.143] * (-387.667) (-390.217) [-386.687] (-386.847) -- 0:01:09
91500 -- (-388.251) (-391.658) (-385.671) [-388.779] * (-385.539) (-388.108) (-386.211) [-386.381] -- 0:01:09
92000 -- [-385.590] (-386.465) (-386.685) (-387.627) * (-388.505) [-387.786] (-385.731) (-385.260) -- 0:01:09
92500 -- (-386.652) (-385.080) (-387.067) [-388.322] * (-386.050) [-390.686] (-387.754) (-385.499) -- 0:01:08
93000 -- (-387.123) (-385.302) (-385.628) [-387.152] * (-386.094) (-388.107) [-386.430] (-387.317) -- 0:01:08
93500 -- (-385.422) [-386.529] (-386.272) (-389.677) * (-386.449) (-386.630) [-385.470] (-387.462) -- 0:01:07
94000 -- (-384.901) (-387.363) [-385.941] (-390.408) * (-389.248) [-385.168] (-388.262) (-387.767) -- 0:01:07
94500 -- [-386.694] (-386.357) (-388.266) (-387.333) * (-388.576) (-386.580) [-387.211] (-391.002) -- 0:01:07
95000 -- [-386.976] (-390.553) (-387.716) (-390.060) * (-386.543) (-386.530) [-387.033] (-387.354) -- 0:01:06
Average standard deviation of split frequencies: 0.014186
95500 -- (-388.565) [-387.440] (-387.442) (-388.754) * (-386.594) [-387.180] (-387.392) (-386.683) -- 0:01:06
96000 -- (-388.279) [-387.207] (-385.080) (-385.661) * (-386.826) [-387.012] (-385.524) (-386.978) -- 0:01:15
96500 -- (-395.303) (-385.442) (-385.656) [-386.950] * (-386.233) (-388.688) (-385.916) [-384.605] -- 0:01:14
97000 -- [-386.261] (-386.898) (-388.444) (-388.167) * (-387.004) (-384.888) [-386.463] (-385.965) -- 0:01:14
97500 -- (-385.833) (-385.864) [-390.052] (-387.221) * (-388.505) (-388.255) [-387.037] (-385.666) -- 0:01:14
98000 -- (-386.695) (-385.694) (-386.547) [-387.609] * (-390.265) (-387.608) [-385.874] (-386.397) -- 0:01:13
98500 -- (-391.191) (-389.344) (-386.085) [-386.085] * (-389.032) (-388.225) (-392.136) [-386.403] -- 0:01:13
99000 -- (-385.885) (-388.780) (-386.584) [-386.386] * (-389.546) [-385.026] (-389.545) (-390.775) -- 0:01:12
99500 -- [-386.382] (-388.206) (-386.422) (-386.007) * (-385.563) [-385.516] (-387.789) (-387.372) -- 0:01:12
100000 -- [-388.608] (-389.020) (-388.426) (-385.924) * (-386.855) [-387.443] (-386.954) (-387.017) -- 0:01:12
Average standard deviation of split frequencies: 0.014569
100500 -- (-386.115) (-392.259) (-386.445) [-385.078] * (-387.361) (-386.576) (-387.398) [-390.133] -- 0:01:11
101000 -- [-385.224] (-388.181) (-386.280) (-387.417) * (-388.793) (-386.372) (-386.382) [-388.678] -- 0:01:11
101500 -- (-386.391) [-385.757] (-387.294) (-384.995) * (-389.570) [-385.590] (-384.907) (-387.550) -- 0:01:10
102000 -- (-386.345) [-387.110] (-387.142) (-385.680) * [-385.920] (-386.454) (-387.639) (-389.375) -- 0:01:10
102500 -- (-384.816) (-387.222) [-387.114] (-387.449) * (-385.895) (-388.147) (-386.964) [-386.028] -- 0:01:10
103000 -- (-385.141) (-389.026) [-388.613] (-386.125) * (-386.978) (-387.353) [-385.944] (-387.174) -- 0:01:09
103500 -- (-386.012) (-386.147) [-385.470] (-388.669) * (-387.122) (-387.294) (-385.456) [-386.611] -- 0:01:09
104000 -- [-386.021] (-386.770) (-385.935) (-387.023) * (-387.391) (-390.263) [-386.371] (-391.937) -- 0:01:08
104500 -- (-389.182) (-386.236) [-386.443] (-387.720) * (-384.971) (-390.090) [-387.426] (-386.484) -- 0:01:08
105000 -- (-388.203) [-387.939] (-387.311) (-387.727) * (-385.861) (-392.907) [-385.548] (-389.675) -- 0:01:08
Average standard deviation of split frequencies: 0.013108
105500 -- (-385.508) (-388.727) [-388.863] (-387.029) * (-387.537) (-384.793) [-387.523] (-386.538) -- 0:01:07
106000 -- (-387.021) (-392.488) [-387.186] (-387.340) * (-386.769) (-384.875) (-387.122) [-385.588] -- 0:01:07
106500 -- (-385.523) (-386.339) (-386.101) [-387.485] * (-388.185) (-387.170) [-385.211] (-385.182) -- 0:01:07
107000 -- (-387.288) (-386.568) [-388.865] (-385.154) * (-389.732) [-386.827] (-386.592) (-385.615) -- 0:01:06
107500 -- (-386.983) [-386.767] (-390.740) (-386.212) * (-388.676) (-388.304) [-389.247] (-387.060) -- 0:01:06
108000 -- (-386.585) (-386.429) (-388.738) [-385.882] * (-387.470) [-386.901] (-387.623) (-386.337) -- 0:01:06
108500 -- [-386.713] (-386.205) (-386.821) (-385.582) * (-389.348) (-389.059) [-387.360] (-388.081) -- 0:01:05
109000 -- (-385.907) [-385.425] (-390.053) (-384.778) * (-386.268) [-388.161] (-386.368) (-387.472) -- 0:01:05
109500 -- (-387.894) (-385.173) [-388.751] (-385.758) * (-386.468) (-386.380) [-386.088] (-385.075) -- 0:01:13
110000 -- (-388.406) [-385.678] (-388.741) (-388.542) * (-388.735) (-385.166) [-387.197] (-388.183) -- 0:01:12
Average standard deviation of split frequencies: 0.013676
110500 -- (-386.957) [-388.580] (-387.079) (-387.413) * (-388.702) (-390.770) (-386.987) [-385.479] -- 0:01:12
111000 -- (-388.366) [-387.479] (-388.994) (-387.927) * (-395.218) [-386.105] (-385.522) (-385.801) -- 0:01:12
111500 -- (-388.055) (-389.764) [-387.275] (-386.737) * (-387.079) [-387.928] (-386.063) (-386.046) -- 0:01:11
112000 -- (-389.169) [-387.784] (-387.491) (-389.288) * [-389.013] (-387.459) (-388.059) (-387.046) -- 0:01:11
112500 -- (-388.963) (-387.400) (-385.790) [-391.011] * (-388.208) (-385.640) [-387.027] (-387.312) -- 0:01:11
113000 -- (-386.915) [-387.274] (-387.547) (-393.586) * (-386.365) (-393.645) (-389.171) [-385.625] -- 0:01:10
113500 -- (-392.820) (-391.787) [-386.260] (-387.927) * (-387.035) [-387.676] (-387.292) (-390.423) -- 0:01:10
114000 -- (-387.626) [-391.038] (-389.690) (-389.860) * (-388.493) [-386.190] (-387.789) (-388.210) -- 0:01:09
114500 -- (-386.557) [-388.896] (-388.458) (-389.444) * (-386.404) [-386.261] (-387.699) (-386.318) -- 0:01:09
115000 -- (-388.442) (-385.363) (-386.942) [-386.221] * [-386.870] (-388.691) (-386.484) (-388.856) -- 0:01:09
Average standard deviation of split frequencies: 0.013095
115500 -- (-385.891) (-388.383) (-394.130) [-386.536] * [-386.532] (-385.587) (-385.950) (-385.947) -- 0:01:08
116000 -- (-387.635) (-386.547) (-392.487) [-385.312] * (-385.862) (-388.382) [-385.258] (-386.395) -- 0:01:08
116500 -- (-385.662) [-385.884] (-386.898) (-386.929) * (-390.481) (-387.335) (-386.106) [-387.252] -- 0:01:08
117000 -- (-389.263) (-385.665) (-389.294) [-386.907] * [-386.681] (-385.528) (-393.583) (-385.278) -- 0:01:07
117500 -- (-389.589) (-387.927) (-386.098) [-390.197] * [-386.969] (-386.578) (-386.005) (-389.547) -- 0:01:07
118000 -- (-388.786) [-388.730] (-387.659) (-387.508) * (-388.016) [-386.086] (-387.538) (-386.266) -- 0:01:07
118500 -- [-385.708] (-385.710) (-389.201) (-386.541) * (-386.973) (-387.234) (-387.072) [-386.277] -- 0:01:06
119000 -- [-386.282] (-385.928) (-389.303) (-388.116) * (-386.057) [-385.913] (-386.678) (-386.892) -- 0:01:06
119500 -- (-385.939) [-385.415] (-387.508) (-386.198) * (-387.496) [-385.930] (-387.047) (-387.953) -- 0:01:06
120000 -- (-385.175) (-388.145) (-387.498) [-386.251] * (-386.819) [-386.090] (-386.931) (-385.324) -- 0:01:06
Average standard deviation of split frequencies: 0.015627
120500 -- (-385.794) (-388.104) (-386.923) [-387.075] * (-396.278) (-389.762) [-389.050] (-385.784) -- 0:01:05
121000 -- (-386.873) (-385.383) (-385.268) [-389.313] * [-386.076] (-385.987) (-386.558) (-387.174) -- 0:01:05
121500 -- (-385.263) [-386.041] (-388.436) (-389.547) * [-386.221] (-386.929) (-387.069) (-392.775) -- 0:01:05
122000 -- [-385.420] (-385.629) (-387.827) (-391.378) * (-385.345) [-385.944] (-390.060) (-390.823) -- 0:01:04
122500 -- [-386.921] (-385.942) (-386.345) (-388.096) * (-386.887) (-388.029) (-391.074) [-386.886] -- 0:01:04
123000 -- (-387.820) (-386.857) (-388.475) [-386.183] * (-387.014) (-385.998) [-387.044] (-387.847) -- 0:01:04
123500 -- (-387.163) (-385.422) [-386.240] (-385.127) * (-388.217) (-385.804) [-388.672] (-388.663) -- 0:01:03
124000 -- (-387.954) (-386.810) [-388.501] (-389.960) * [-386.812] (-385.100) (-388.459) (-390.133) -- 0:01:10
124500 -- (-387.222) (-386.442) [-386.446] (-389.160) * (-387.084) (-387.117) [-386.278] (-385.927) -- 0:01:10
125000 -- (-386.208) (-387.831) (-386.756) [-388.393] * (-387.195) (-385.044) [-385.461] (-388.204) -- 0:01:10
Average standard deviation of split frequencies: 0.012996
125500 -- (-386.953) (-386.476) [-385.600] (-386.064) * (-389.038) (-385.899) [-385.149] (-385.596) -- 0:01:09
126000 -- (-385.907) (-387.216) [-387.820] (-385.184) * (-388.533) [-387.935] (-388.365) (-386.070) -- 0:01:09
126500 -- (-387.248) [-388.308] (-385.626) (-386.589) * (-386.270) (-390.565) (-386.614) [-386.756] -- 0:01:09
127000 -- [-387.218] (-386.997) (-387.583) (-387.560) * (-386.365) (-385.662) (-386.686) [-386.945] -- 0:01:08
127500 -- (-385.814) [-389.324] (-388.870) (-387.546) * (-384.985) (-387.451) [-389.358] (-387.799) -- 0:01:08
128000 -- (-386.129) (-386.817) (-387.384) [-386.804] * (-385.082) (-388.821) [-387.437] (-387.419) -- 0:01:08
128500 -- (-387.766) (-386.019) [-387.192] (-387.072) * [-384.680] (-385.474) (-393.795) (-387.346) -- 0:01:07
129000 -- (-385.537) (-387.059) [-386.052] (-386.036) * [-386.441] (-385.512) (-388.472) (-386.692) -- 0:01:07
129500 -- [-386.611] (-387.966) (-385.609) (-388.513) * (-387.058) (-387.586) (-387.242) [-384.987] -- 0:01:07
130000 -- (-386.495) (-388.153) (-385.723) [-385.732] * [-389.540] (-385.201) (-387.167) (-388.148) -- 0:01:06
Average standard deviation of split frequencies: 0.016140
130500 -- (-387.252) (-385.798) (-384.982) [-392.977] * (-386.866) (-385.403) [-387.576] (-387.662) -- 0:01:06
131000 -- (-385.892) [-385.947] (-385.433) (-386.417) * (-387.210) (-385.467) (-386.795) [-387.162] -- 0:01:06
131500 -- [-386.549] (-385.468) (-386.395) (-391.820) * (-386.133) (-387.462) (-387.815) [-385.503] -- 0:01:06
132000 -- (-386.055) [-385.742] (-388.189) (-388.571) * (-388.400) [-387.783] (-388.021) (-385.856) -- 0:01:05
132500 -- (-385.373) (-386.375) (-390.106) [-386.491] * (-388.184) (-388.728) (-389.152) [-387.040] -- 0:01:05
133000 -- (-386.045) (-386.658) [-387.369] (-386.013) * (-385.189) (-386.364) [-388.123] (-388.129) -- 0:01:05
133500 -- (-386.683) [-388.167] (-386.035) (-387.686) * (-386.412) (-389.505) (-388.549) [-385.569] -- 0:01:04
134000 -- (-385.305) (-386.699) [-386.201] (-391.291) * (-386.877) (-386.655) [-386.681] (-386.948) -- 0:01:04
134500 -- (-386.866) (-386.590) [-386.043] (-387.669) * (-385.860) (-388.018) [-386.209] (-387.850) -- 0:01:04
135000 -- (-384.936) (-387.985) [-386.257] (-388.580) * (-386.199) (-387.027) (-390.638) [-386.010] -- 0:01:04
Average standard deviation of split frequencies: 0.014412
135500 -- [-388.046] (-388.542) (-389.312) (-391.732) * (-385.067) (-388.529) (-387.055) [-385.770] -- 0:01:03
136000 -- (-387.562) (-385.177) [-385.969] (-391.009) * (-384.871) [-386.839] (-390.203) (-387.060) -- 0:01:03
136500 -- [-386.397] (-386.296) (-385.687) (-385.573) * (-386.835) (-385.825) [-390.159] (-388.802) -- 0:01:03
137000 -- (-387.193) [-384.888] (-386.559) (-388.511) * [-386.589] (-387.696) (-386.179) (-385.777) -- 0:01:02
137500 -- (-388.306) [-385.052] (-385.724) (-387.807) * (-389.649) (-391.527) (-387.634) [-389.424] -- 0:01:02
138000 -- (-387.187) [-389.368] (-385.864) (-385.498) * [-385.130] (-385.911) (-388.609) (-387.164) -- 0:01:08
138500 -- (-385.464) (-389.322) (-385.861) [-386.313] * (-387.116) (-386.638) (-385.036) [-387.188] -- 0:01:08
139000 -- (-388.861) [-387.908] (-387.702) (-392.281) * (-385.511) [-391.746] (-387.036) (-393.264) -- 0:01:08
139500 -- (-390.493) (-388.264) [-386.604] (-388.196) * (-386.177) [-386.642] (-386.226) (-391.910) -- 0:01:07
140000 -- (-388.393) [-385.532] (-386.571) (-388.787) * (-385.380) (-386.648) [-387.379] (-385.725) -- 0:01:07
Average standard deviation of split frequencies: 0.015709
140500 -- (-385.355) [-385.485] (-386.549) (-386.886) * (-388.173) (-386.204) [-386.574] (-385.549) -- 0:01:07
141000 -- (-386.092) (-386.680) (-387.060) [-387.279] * (-393.003) [-386.564] (-386.575) (-388.765) -- 0:01:07
141500 -- (-386.425) (-386.177) [-387.437] (-387.498) * (-392.760) (-386.055) [-387.036] (-386.317) -- 0:01:06
142000 -- (-387.802) [-386.861] (-385.443) (-388.538) * (-390.101) (-387.409) [-385.491] (-386.034) -- 0:01:06
142500 -- [-386.711] (-387.430) (-387.802) (-391.043) * [-387.736] (-388.220) (-386.466) (-388.378) -- 0:01:06
143000 -- [-385.109] (-389.243) (-387.225) (-389.507) * [-388.757] (-385.379) (-387.289) (-389.596) -- 0:01:05
143500 -- (-385.346) (-387.770) (-384.928) [-390.389] * (-389.733) (-390.029) (-387.521) [-387.474] -- 0:01:05
144000 -- (-386.746) (-389.062) (-385.224) [-388.562] * (-390.065) (-387.953) [-389.130] (-386.598) -- 0:01:05
144500 -- [-387.522] (-386.836) (-387.557) (-393.785) * (-386.904) [-386.146] (-391.170) (-386.819) -- 0:01:05
145000 -- (-387.410) (-386.716) (-385.612) [-390.271] * (-386.659) (-386.206) [-386.033] (-386.537) -- 0:01:04
Average standard deviation of split frequencies: 0.011966
145500 -- (-386.867) (-385.056) (-389.807) [-388.042] * (-388.458) (-387.184) (-386.538) [-385.672] -- 0:01:04
146000 -- (-389.758) (-385.855) [-386.528] (-389.608) * [-387.716] (-388.088) (-386.593) (-392.746) -- 0:01:04
146500 -- (-389.757) (-390.493) [-387.429] (-385.270) * [-387.705] (-389.872) (-386.997) (-387.294) -- 0:01:04
147000 -- (-386.547) (-387.971) (-392.030) [-385.414] * (-387.040) (-385.613) [-390.322] (-388.144) -- 0:01:03
147500 -- [-385.711] (-386.449) (-388.785) (-385.775) * (-390.213) (-389.206) [-390.124] (-385.548) -- 0:01:03
148000 -- (-388.748) [-386.726] (-387.106) (-385.984) * (-389.185) (-387.942) [-390.555] (-386.268) -- 0:01:03
148500 -- (-385.876) (-386.855) (-385.510) [-387.214] * (-391.236) (-387.001) [-387.494] (-385.800) -- 0:01:03
149000 -- (-387.513) (-386.251) (-386.458) [-386.196] * [-386.021] (-387.839) (-386.794) (-385.516) -- 0:01:02
149500 -- [-386.160] (-389.249) (-387.451) (-387.913) * (-387.412) (-388.567) [-387.560] (-387.796) -- 0:01:02
150000 -- (-386.884) [-387.003] (-386.338) (-385.361) * (-385.700) (-387.880) (-387.656) [-386.318] -- 0:01:02
Average standard deviation of split frequencies: 0.011595
150500 -- (-385.901) (-387.416) (-385.191) [-385.279] * (-384.752) [-387.513] (-386.213) (-386.443) -- 0:01:02
151000 -- (-386.911) [-387.000] (-384.713) (-386.336) * [-388.155] (-389.435) (-387.621) (-389.626) -- 0:01:01
151500 -- (-386.926) (-386.946) [-386.064] (-387.763) * (-389.235) (-386.407) (-389.399) [-387.364] -- 0:01:07
152000 -- [-385.793] (-391.007) (-387.317) (-389.754) * (-387.872) (-385.142) [-385.788] (-385.798) -- 0:01:06
152500 -- [-385.412] (-385.811) (-387.050) (-387.618) * [-386.227] (-386.614) (-387.777) (-387.261) -- 0:01:06
153000 -- [-386.749] (-386.096) (-388.216) (-396.028) * (-385.502) [-384.923] (-385.606) (-387.551) -- 0:01:06
153500 -- (-386.831) [-385.502] (-388.682) (-392.037) * (-393.553) (-385.128) [-387.107] (-387.991) -- 0:01:06
154000 -- (-386.332) (-389.615) [-385.963] (-387.702) * [-390.953] (-385.566) (-388.358) (-388.258) -- 0:01:05
154500 -- (-386.960) [-386.507] (-388.251) (-387.050) * (-386.409) (-387.873) [-386.326] (-385.624) -- 0:01:05
155000 -- (-391.733) (-385.488) (-389.716) [-388.272] * (-385.371) (-386.371) (-386.570) [-386.064] -- 0:01:05
Average standard deviation of split frequencies: 0.011332
155500 -- [-385.751] (-385.896) (-388.488) (-385.261) * (-386.809) (-388.813) [-386.756] (-386.327) -- 0:01:05
156000 -- (-385.359) (-386.783) (-384.921) [-387.715] * (-386.919) (-387.511) [-386.963] (-386.681) -- 0:01:04
156500 -- (-393.234) (-385.765) (-385.083) [-386.758] * (-387.902) [-385.602] (-384.974) (-385.368) -- 0:01:04
157000 -- (-400.897) [-387.694] (-389.079) (-388.278) * [-388.572] (-386.335) (-390.888) (-386.902) -- 0:01:04
157500 -- (-388.173) (-386.877) (-386.543) [-384.902] * (-394.807) (-385.943) [-388.461] (-389.426) -- 0:01:04
158000 -- (-387.490) (-386.625) (-386.011) [-386.811] * (-387.747) (-385.483) [-387.454] (-390.018) -- 0:01:03
158500 -- (-387.198) (-386.089) [-387.575] (-390.324) * (-387.475) (-385.971) [-385.378] (-385.088) -- 0:01:03
159000 -- (-385.368) [-388.792] (-386.743) (-388.053) * [-386.449] (-386.113) (-385.800) (-385.573) -- 0:01:03
159500 -- [-385.246] (-387.440) (-385.187) (-386.646) * [-388.189] (-386.387) (-385.043) (-385.055) -- 0:01:03
160000 -- (-385.874) [-385.714] (-385.385) (-387.171) * [-388.657] (-385.364) (-385.696) (-385.090) -- 0:01:02
Average standard deviation of split frequencies: 0.010269
160500 -- (-385.466) [-388.536] (-384.923) (-386.372) * (-390.363) (-386.248) [-385.808] (-386.092) -- 0:01:02
161000 -- (-387.351) (-386.359) (-386.873) [-387.250] * (-388.329) (-386.457) (-386.300) [-388.582] -- 0:01:02
161500 -- (-388.473) [-384.922] (-385.375) (-385.298) * [-385.928] (-386.303) (-392.622) (-387.041) -- 0:01:02
162000 -- (-389.465) (-386.345) [-385.866] (-385.971) * (-388.938) (-386.135) (-388.195) [-387.775] -- 0:01:02
162500 -- [-387.671] (-385.504) (-386.447) (-385.515) * [-386.568] (-387.226) (-386.867) (-390.627) -- 0:01:01
163000 -- (-385.581) (-385.038) [-387.872] (-388.956) * (-386.816) (-389.786) (-391.899) [-391.915] -- 0:01:01
163500 -- (-386.025) (-385.405) (-386.776) [-391.482] * (-389.082) (-388.216) (-392.470) [-387.853] -- 0:01:01
164000 -- (-385.160) (-386.446) [-386.446] (-389.470) * [-390.049] (-389.257) (-388.654) (-387.877) -- 0:01:01
164500 -- (-385.257) (-389.870) [-390.707] (-386.465) * (-386.618) (-388.260) (-386.822) [-388.576] -- 0:01:00
165000 -- [-386.156] (-386.561) (-385.431) (-389.894) * [-386.453] (-387.106) (-388.240) (-390.886) -- 0:01:05
Average standard deviation of split frequencies: 0.011004
165500 -- (-386.598) [-387.069] (-387.476) (-390.428) * [-388.173] (-387.335) (-387.031) (-392.125) -- 0:01:05
166000 -- (-386.051) (-388.263) (-389.069) [-386.691] * (-388.082) (-387.266) [-385.403] (-388.322) -- 0:01:05
166500 -- (-388.101) [-389.402] (-387.913) (-387.106) * (-388.016) (-386.493) (-386.977) [-386.621] -- 0:01:05
167000 -- (-385.911) (-385.294) [-385.227] (-386.039) * [-387.238] (-387.025) (-386.373) (-388.423) -- 0:01:04
167500 -- (-386.969) (-385.849) (-387.423) [-388.002] * (-390.986) (-386.466) [-388.274] (-387.696) -- 0:01:04
168000 -- (-386.926) [-386.133] (-386.363) (-387.293) * (-385.912) (-384.970) [-386.251] (-386.736) -- 0:01:04
168500 -- (-391.896) (-388.514) [-388.607] (-390.670) * [-385.804] (-386.878) (-387.544) (-386.596) -- 0:01:04
169000 -- (-387.214) (-390.100) (-385.069) [-387.443] * [-388.732] (-386.015) (-387.098) (-386.658) -- 0:01:03
169500 -- (-389.381) [-387.266] (-385.245) (-386.786) * [-385.834] (-386.060) (-386.856) (-387.659) -- 0:01:03
170000 -- (-387.923) (-388.408) [-386.224] (-387.446) * [-385.237] (-389.785) (-392.439) (-394.013) -- 0:01:03
Average standard deviation of split frequencies: 0.010876
170500 -- (-389.161) (-389.984) [-387.229] (-385.500) * (-387.393) [-391.544] (-387.642) (-386.976) -- 0:01:03
171000 -- [-386.626] (-384.789) (-389.109) (-388.286) * (-387.524) (-385.269) (-388.881) [-390.657] -- 0:01:03
171500 -- (-386.933) (-386.687) [-388.681] (-386.298) * (-388.866) (-386.745) [-386.688] (-390.466) -- 0:01:02
172000 -- (-388.751) (-386.479) [-390.253] (-387.509) * (-392.965) [-385.413] (-386.924) (-385.346) -- 0:01:02
172500 -- (-386.746) [-385.779] (-389.363) (-385.772) * (-386.986) (-385.333) (-386.337) [-387.712] -- 0:01:02
173000 -- [-385.512] (-387.337) (-390.078) (-386.574) * (-385.434) [-387.604] (-386.516) (-388.409) -- 0:01:02
173500 -- (-385.980) [-388.684] (-387.920) (-387.614) * [-386.309] (-391.773) (-386.534) (-385.841) -- 0:01:01
174000 -- (-387.464) (-390.020) (-386.578) [-386.989] * [-388.077] (-391.262) (-387.519) (-387.585) -- 0:01:01
174500 -- (-389.924) (-387.569) (-388.022) [-389.009] * (-387.157) [-386.977] (-387.376) (-385.850) -- 0:01:01
175000 -- (-387.449) (-387.689) [-384.839] (-386.962) * [-388.954] (-389.427) (-388.726) (-391.652) -- 0:01:01
Average standard deviation of split frequencies: 0.011049
175500 -- (-385.153) (-386.509) [-389.163] (-386.629) * [-385.114] (-388.674) (-386.030) (-387.956) -- 0:01:01
176000 -- (-387.667) (-386.573) [-388.762] (-393.079) * (-388.947) (-387.448) [-385.917] (-388.550) -- 0:01:00
176500 -- [-387.148] (-387.560) (-386.863) (-389.579) * (-386.284) [-385.973] (-387.076) (-386.670) -- 0:01:00
177000 -- (-392.889) (-387.214) [-387.789] (-395.097) * (-386.060) (-389.914) [-386.857] (-385.739) -- 0:01:00
177500 -- (-388.141) (-386.631) [-386.514] (-390.375) * (-387.148) (-384.994) (-386.258) [-386.516] -- 0:01:00
178000 -- [-385.812] (-385.913) (-388.122) (-386.103) * (-387.296) (-387.493) (-386.430) [-388.429] -- 0:01:00
178500 -- (-386.965) [-387.546] (-386.145) (-385.855) * [-387.779] (-385.782) (-384.844) (-385.310) -- 0:00:59
179000 -- (-387.736) [-389.471] (-391.055) (-391.789) * (-388.577) [-386.960] (-386.687) (-386.535) -- 0:01:04
179500 -- [-388.230] (-390.754) (-384.814) (-386.806) * (-391.435) (-386.804) (-386.184) [-388.773] -- 0:01:03
180000 -- (-389.349) (-386.087) (-388.493) [-385.326] * (-386.188) [-386.177] (-388.841) (-385.724) -- 0:01:03
Average standard deviation of split frequencies: 0.011481
180500 -- [-387.944] (-387.033) (-387.244) (-386.195) * (-386.249) (-387.057) (-388.535) [-386.548] -- 0:01:03
181000 -- (-386.274) [-389.252] (-388.406) (-387.700) * [-387.301] (-386.345) (-388.408) (-386.550) -- 0:01:03
181500 -- (-391.428) (-385.659) (-386.634) [-385.718] * (-387.969) (-385.982) [-385.764] (-390.244) -- 0:01:03
182000 -- (-398.923) (-387.455) [-386.542] (-386.202) * (-386.765) (-386.975) (-385.171) [-387.281] -- 0:01:02
182500 -- (-396.614) [-392.980] (-385.715) (-389.285) * (-385.831) [-388.050] (-387.624) (-385.755) -- 0:01:02
183000 -- (-389.221) (-388.554) (-386.771) [-387.115] * [-385.284] (-387.050) (-386.992) (-386.195) -- 0:01:02
183500 -- (-386.033) (-385.026) [-386.798] (-386.599) * (-386.181) (-385.873) (-386.244) [-387.376] -- 0:01:02
184000 -- (-387.497) (-385.072) [-389.342] (-385.263) * (-387.214) [-389.202] (-385.485) (-390.485) -- 0:01:02
184500 -- [-386.412] (-385.961) (-387.330) (-385.713) * (-388.491) [-390.500] (-387.756) (-385.740) -- 0:01:01
185000 -- (-388.303) (-388.650) (-389.334) [-387.214] * (-389.254) [-389.594] (-385.393) (-389.696) -- 0:01:01
Average standard deviation of split frequencies: 0.009504
185500 -- [-386.150] (-390.466) (-385.957) (-385.936) * (-393.427) (-392.732) (-385.785) [-387.542] -- 0:01:01
186000 -- (-388.645) (-388.294) [-388.353] (-387.408) * (-389.054) [-388.588] (-385.948) (-386.789) -- 0:01:01
186500 -- [-385.723] (-385.799) (-386.987) (-387.644) * (-390.676) (-387.010) (-389.667) [-387.944] -- 0:01:01
187000 -- (-386.246) (-385.734) [-386.616] (-393.247) * (-387.293) (-388.223) (-385.754) [-388.742] -- 0:01:00
187500 -- (-392.519) [-386.129] (-388.090) (-385.972) * (-387.825) (-386.081) (-388.748) [-387.504] -- 0:01:00
188000 -- (-390.827) (-385.143) [-385.675] (-385.874) * [-388.411] (-392.766) (-392.366) (-387.725) -- 0:01:00
188500 -- [-386.815] (-385.957) (-388.467) (-385.707) * (-387.818) [-386.988] (-386.875) (-389.096) -- 0:01:00
189000 -- (-395.076) (-385.859) [-389.348] (-386.231) * (-388.302) [-384.873] (-389.167) (-386.180) -- 0:01:00
189500 -- [-388.593] (-385.761) (-388.174) (-391.550) * [-386.821] (-386.041) (-386.930) (-387.131) -- 0:00:59
190000 -- (-385.005) [-385.094] (-390.144) (-389.319) * (-386.524) [-387.345] (-387.710) (-389.985) -- 0:00:59
Average standard deviation of split frequencies: 0.009426
190500 -- (-385.004) (-386.532) (-387.530) [-385.405] * [-388.301] (-387.506) (-387.226) (-387.624) -- 0:00:59
191000 -- [-387.320] (-389.598) (-386.055) (-388.878) * (-387.141) (-390.981) (-391.007) [-386.737] -- 0:00:59
191500 -- (-392.614) (-387.472) (-386.382) [-385.315] * (-386.068) (-392.195) (-386.763) [-387.293] -- 0:00:59
192000 -- (-386.993) (-388.609) (-388.854) [-385.425] * (-386.911) (-385.927) (-386.720) [-385.877] -- 0:00:58
192500 -- [-385.290] (-391.206) (-392.223) (-385.045) * (-387.395) [-386.095] (-387.929) (-387.632) -- 0:00:58
193000 -- (-388.441) (-386.567) (-388.096) [-385.941] * (-388.743) [-386.076] (-388.666) (-387.439) -- 0:01:02
193500 -- (-386.829) [-385.463] (-385.997) (-390.287) * (-387.908) (-386.588) (-387.229) [-385.907] -- 0:01:02
194000 -- (-385.951) (-386.311) [-387.349] (-386.562) * [-386.466] (-384.781) (-388.734) (-388.103) -- 0:01:02
194500 -- [-385.746] (-390.765) (-391.592) (-388.080) * (-387.338) (-384.865) [-389.417] (-387.961) -- 0:01:02
195000 -- [-388.626] (-387.590) (-384.927) (-388.301) * [-388.090] (-385.334) (-386.915) (-386.376) -- 0:01:01
Average standard deviation of split frequencies: 0.010222
195500 -- (-388.051) (-388.468) [-385.466] (-386.331) * (-392.306) (-386.269) (-387.127) [-388.417] -- 0:01:01
196000 -- (-385.253) [-386.242] (-387.137) (-386.443) * [-386.971] (-387.673) (-387.865) (-388.499) -- 0:01:01
196500 -- [-386.372] (-385.635) (-389.247) (-389.770) * [-387.396] (-385.571) (-390.005) (-386.652) -- 0:01:01
197000 -- [-385.422] (-390.631) (-384.933) (-386.009) * [-386.861] (-385.275) (-391.525) (-386.401) -- 0:01:01
197500 -- (-385.750) (-386.085) [-387.808] (-386.886) * (-386.400) (-389.841) (-388.227) [-389.082] -- 0:01:00
198000 -- (-390.628) (-387.702) (-384.922) [-386.927] * [-387.196] (-389.722) (-389.448) (-386.937) -- 0:01:00
198500 -- (-385.653) (-387.733) (-387.192) [-387.948] * (-385.480) [-384.894] (-391.084) (-388.441) -- 0:01:00
199000 -- (-386.756) (-392.825) [-386.630] (-385.599) * [-389.060] (-385.963) (-387.609) (-387.276) -- 0:01:00
199500 -- (-388.925) [-386.372] (-387.686) (-386.309) * [-386.279] (-386.510) (-386.394) (-388.258) -- 0:01:00
200000 -- (-385.427) (-387.229) (-385.538) [-386.847] * (-386.362) (-387.413) (-386.041) [-388.888] -- 0:00:59
Average standard deviation of split frequencies: 0.011305
200500 -- [-385.078] (-386.839) (-386.586) (-388.670) * (-386.795) (-387.528) [-386.509] (-385.860) -- 0:00:59
201000 -- (-387.513) [-392.198] (-386.564) (-390.485) * (-388.167) (-387.360) (-388.765) [-386.830] -- 0:00:59
201500 -- (-386.998) [-389.291] (-388.410) (-387.009) * (-388.118) (-385.887) [-386.849] (-385.844) -- 0:00:59
202000 -- (-385.290) [-386.787] (-388.350) (-386.029) * [-386.898] (-390.034) (-386.690) (-389.058) -- 0:00:59
202500 -- (-388.060) (-387.950) [-388.728] (-386.883) * [-386.066] (-391.069) (-386.622) (-387.499) -- 0:00:59
203000 -- (-390.179) (-387.922) [-385.206] (-387.369) * [-386.996] (-386.128) (-385.853) (-386.251) -- 0:00:58
203500 -- (-387.926) (-388.447) (-390.564) [-388.068] * (-387.416) [-388.136] (-387.846) (-387.494) -- 0:00:58
204000 -- [-385.509] (-386.198) (-392.553) (-390.803) * (-386.585) (-388.827) [-386.415] (-388.497) -- 0:00:58
204500 -- (-390.793) (-387.645) (-387.678) [-391.573] * (-385.051) [-387.725] (-386.877) (-386.809) -- 0:00:58
205000 -- [-387.740] (-386.872) (-394.134) (-398.178) * (-386.482) [-385.475] (-388.286) (-385.493) -- 0:00:58
Average standard deviation of split frequencies: 0.011711
205500 -- (-387.416) (-385.289) [-392.485] (-389.473) * (-388.048) [-384.679] (-389.080) (-386.677) -- 0:00:57
206000 -- [-387.319] (-385.039) (-387.991) (-388.442) * [-386.541] (-385.861) (-386.704) (-390.137) -- 0:00:57
206500 -- (-387.927) (-385.756) (-386.990) [-385.414] * [-385.953] (-385.386) (-386.665) (-389.118) -- 0:01:01
207000 -- (-389.578) (-389.370) [-385.889] (-386.828) * [-385.302] (-385.550) (-385.621) (-385.782) -- 0:01:01
207500 -- [-387.588] (-387.362) (-388.503) (-385.248) * (-388.904) [-389.390] (-387.961) (-386.846) -- 0:01:01
208000 -- (-386.597) [-390.516] (-387.572) (-386.333) * (-387.441) (-389.870) (-385.802) [-387.104] -- 0:01:00
208500 -- (-386.608) (-387.372) (-385.662) [-385.528] * [-389.724] (-387.035) (-385.968) (-385.010) -- 0:01:00
209000 -- [-386.848] (-388.667) (-389.989) (-386.596) * (-385.201) (-385.382) [-385.991] (-387.522) -- 0:01:00
209500 -- (-388.964) (-386.404) (-388.693) [-388.697] * (-388.556) (-386.085) (-387.490) [-386.796] -- 0:01:00
210000 -- (-386.833) (-386.666) [-384.777] (-385.399) * (-387.103) (-386.901) (-386.155) [-386.437] -- 0:01:00
Average standard deviation of split frequencies: 0.013053
210500 -- (-386.345) (-388.634) (-385.303) [-389.200] * (-385.486) [-385.249] (-390.212) (-385.895) -- 0:01:00
211000 -- (-387.739) [-388.527] (-385.314) (-387.511) * (-386.834) [-385.025] (-387.888) (-386.610) -- 0:00:59
211500 -- [-385.285] (-387.225) (-385.611) (-386.149) * (-387.218) [-385.583] (-386.225) (-385.536) -- 0:00:59
212000 -- (-387.438) (-386.442) (-385.895) [-386.102] * [-385.722] (-385.944) (-385.440) (-385.428) -- 0:00:59
212500 -- (-385.032) [-387.388] (-386.039) (-388.752) * (-386.978) (-385.690) (-386.371) [-386.168] -- 0:00:59
213000 -- (-385.738) [-386.975] (-386.044) (-392.600) * (-387.037) [-385.637] (-386.690) (-386.963) -- 0:00:59
213500 -- (-389.153) (-385.560) (-387.475) [-389.365] * [-385.705] (-385.580) (-387.725) (-388.363) -- 0:00:58
214000 -- (-389.853) (-385.574) (-387.954) [-386.022] * (-388.492) (-387.146) (-386.497) [-387.527] -- 0:00:58
214500 -- (-390.730) [-388.685] (-385.601) (-386.202) * [-389.811] (-385.255) (-386.138) (-386.618) -- 0:00:58
215000 -- (-386.981) (-386.429) [-385.779] (-386.697) * (-387.801) (-386.780) [-386.842] (-386.390) -- 0:00:58
Average standard deviation of split frequencies: 0.012980
215500 -- (-390.251) [-385.407] (-388.316) (-387.541) * [-385.238] (-386.615) (-390.125) (-386.801) -- 0:00:58
216000 -- [-385.711] (-388.512) (-386.353) (-388.896) * [-385.592] (-391.710) (-389.022) (-388.950) -- 0:00:58
216500 -- (-386.956) (-386.220) [-388.925] (-394.679) * (-384.894) (-385.448) (-388.251) [-389.721] -- 0:00:57
217000 -- [-387.697] (-387.578) (-387.527) (-386.114) * [-389.890] (-387.336) (-386.798) (-386.691) -- 0:00:57
217500 -- (-387.149) (-388.845) (-389.592) [-387.777] * (-387.975) (-386.827) [-386.411] (-388.763) -- 0:00:57
218000 -- (-386.981) (-385.297) [-389.996] (-385.569) * [-385.013] (-388.277) (-385.405) (-387.030) -- 0:00:57
218500 -- (-387.600) (-387.779) (-391.611) [-385.316] * (-384.915) (-387.546) [-387.318] (-385.133) -- 0:00:57
219000 -- [-387.206] (-386.621) (-385.263) (-391.982) * (-385.876) [-385.876] (-387.592) (-388.332) -- 0:00:57
219500 -- (-386.265) (-387.902) [-385.538] (-388.888) * (-389.412) [-385.461] (-389.403) (-387.985) -- 0:00:56
220000 -- (-385.639) [-386.719] (-385.130) (-387.841) * (-385.304) (-385.985) (-386.438) [-388.140] -- 0:00:56
Average standard deviation of split frequencies: 0.012951
220500 -- [-385.004] (-386.548) (-386.497) (-389.515) * (-386.768) (-387.099) (-386.985) [-385.863] -- 0:01:00
221000 -- (-391.371) (-387.822) (-385.828) [-387.334] * (-388.079) (-387.091) (-386.568) [-386.100] -- 0:00:59
221500 -- [-386.218] (-386.729) (-390.075) (-387.542) * [-388.140] (-392.044) (-386.303) (-389.592) -- 0:00:59
222000 -- (-387.088) (-387.387) (-387.818) [-391.045] * [-387.724] (-385.020) (-387.238) (-389.167) -- 0:00:59
222500 -- [-386.800] (-387.194) (-386.506) (-385.953) * (-387.618) (-386.137) [-385.462] (-387.903) -- 0:00:59
223000 -- (-389.378) (-386.575) [-386.541] (-389.294) * [-387.396] (-386.868) (-385.452) (-386.985) -- 0:00:59
223500 -- (-386.036) (-384.999) (-386.384) [-386.083] * [-388.681] (-387.182) (-389.201) (-393.113) -- 0:00:59
224000 -- (-387.228) (-385.647) (-387.345) [-388.350] * [-386.426] (-389.221) (-385.419) (-388.920) -- 0:00:58
224500 -- (-392.641) [-385.496] (-385.181) (-387.276) * (-386.345) (-385.500) [-386.780] (-386.835) -- 0:00:58
225000 -- (-386.971) [-386.060] (-388.921) (-385.724) * (-388.284) (-385.135) (-386.162) [-390.499] -- 0:00:58
Average standard deviation of split frequencies: 0.013442
225500 -- [-388.444] (-384.964) (-387.807) (-388.810) * (-388.822) (-386.926) (-386.590) [-389.712] -- 0:00:58
226000 -- (-385.614) (-386.615) (-386.169) [-386.339] * (-391.949) (-389.719) [-385.719] (-387.838) -- 0:00:58
226500 -- (-386.929) (-388.155) [-384.835] (-387.318) * (-385.513) [-390.486] (-385.246) (-385.777) -- 0:00:58
227000 -- (-387.955) (-387.496) [-385.243] (-389.456) * (-386.702) [-389.424] (-385.613) (-384.896) -- 0:00:57
227500 -- (-387.455) (-387.632) (-386.294) [-385.948] * (-388.621) [-385.277] (-386.423) (-387.586) -- 0:00:57
228000 -- [-385.040] (-388.105) (-387.146) (-387.550) * (-385.712) (-386.367) [-386.221] (-388.573) -- 0:00:57
228500 -- (-386.687) [-390.043] (-385.943) (-386.665) * (-387.225) (-386.803) (-387.282) [-388.020] -- 0:00:57
229000 -- (-389.543) [-386.610] (-386.622) (-386.655) * (-389.455) [-387.039] (-387.759) (-388.194) -- 0:00:57
229500 -- (-387.464) (-386.231) [-386.900] (-387.892) * (-389.323) (-386.028) [-385.208] (-385.139) -- 0:00:57
230000 -- (-385.793) (-387.670) [-388.861] (-389.125) * [-388.181] (-385.049) (-389.352) (-386.852) -- 0:00:56
Average standard deviation of split frequencies: 0.012376
230500 -- (-385.310) [-386.113] (-385.386) (-388.234) * (-387.242) [-386.010] (-387.934) (-385.695) -- 0:00:56
231000 -- [-386.595] (-385.192) (-390.251) (-390.262) * (-387.258) [-386.471] (-387.577) (-385.941) -- 0:00:56
231500 -- (-387.952) (-392.375) [-385.653] (-387.903) * [-389.356] (-385.092) (-388.387) (-386.945) -- 0:00:56
232000 -- [-385.667] (-389.091) (-386.448) (-390.205) * [-387.181] (-390.793) (-389.754) (-385.770) -- 0:00:56
232500 -- (-386.095) (-388.400) [-388.511] (-385.816) * (-387.847) (-389.069) [-387.724] (-388.251) -- 0:00:56
233000 -- (-386.303) [-386.694] (-390.081) (-386.226) * [-388.125] (-387.581) (-394.058) (-385.984) -- 0:00:55
233500 -- (-386.923) (-387.098) [-388.089] (-389.545) * [-386.214] (-390.539) (-386.887) (-387.441) -- 0:00:55
234000 -- (-386.200) [-388.262] (-388.545) (-389.774) * (-391.828) (-389.422) [-386.186] (-388.188) -- 0:00:58
234500 -- (-388.031) [-387.835] (-388.177) (-386.604) * (-391.949) (-388.985) [-385.887] (-391.194) -- 0:00:58
235000 -- (-385.772) (-386.675) (-386.724) [-392.464] * (-390.741) [-388.395] (-387.892) (-391.059) -- 0:00:58
Average standard deviation of split frequencies: 0.012807
235500 -- (-384.708) [-386.789] (-387.404) (-385.691) * (-385.757) (-387.412) [-389.113] (-386.608) -- 0:00:58
236000 -- (-386.996) [-387.377] (-386.816) (-387.089) * (-385.506) (-388.376) (-385.986) [-386.880] -- 0:00:58
236500 -- (-390.379) (-388.181) [-386.688] (-385.484) * [-384.823] (-386.754) (-385.360) (-387.035) -- 0:00:58
237000 -- (-386.476) (-384.966) (-386.451) [-386.542] * (-386.604) (-387.787) (-387.503) [-385.440] -- 0:00:57
237500 -- (-385.880) [-387.194] (-391.640) (-385.414) * (-386.559) (-386.326) [-387.920] (-385.989) -- 0:00:57
238000 -- [-387.850] (-386.746) (-385.736) (-386.340) * [-386.150] (-390.122) (-388.534) (-386.296) -- 0:00:57
238500 -- (-387.195) [-385.476] (-385.255) (-385.682) * (-389.401) (-390.611) (-384.802) [-385.728] -- 0:00:57
239000 -- (-387.749) (-389.108) (-387.763) [-385.102] * [-387.209] (-386.244) (-388.628) (-388.534) -- 0:00:57
239500 -- (-387.718) (-394.596) (-388.308) [-386.033] * [-388.549] (-385.482) (-385.196) (-389.282) -- 0:00:57
240000 -- (-386.954) (-386.873) (-386.313) [-390.047] * (-387.211) [-386.250] (-389.972) (-387.696) -- 0:00:56
Average standard deviation of split frequencies: 0.014038
240500 -- (-391.783) (-385.240) (-388.055) [-387.638] * (-385.314) (-386.490) (-387.786) [-386.562] -- 0:00:56
241000 -- (-395.294) (-387.437) [-386.643] (-387.198) * [-387.182] (-387.177) (-386.515) (-388.083) -- 0:00:56
241500 -- (-387.642) [-387.509] (-391.766) (-387.510) * (-387.489) [-388.427] (-387.390) (-387.033) -- 0:00:56
242000 -- (-388.455) (-386.570) (-389.549) [-388.015] * [-386.025] (-385.793) (-386.288) (-387.642) -- 0:00:56
242500 -- [-385.215] (-390.155) (-387.194) (-390.254) * [-388.364] (-387.344) (-387.334) (-392.472) -- 0:00:56
243000 -- [-385.922] (-388.563) (-387.856) (-393.429) * (-388.786) [-385.486] (-386.914) (-385.609) -- 0:00:56
243500 -- [-385.478] (-389.531) (-387.080) (-390.646) * (-389.797) [-386.487] (-385.751) (-384.913) -- 0:00:55
244000 -- [-387.539] (-391.340) (-388.940) (-385.447) * (-386.185) [-385.964] (-385.022) (-385.534) -- 0:00:55
244500 -- (-391.577) [-387.856] (-386.529) (-388.996) * [-386.670] (-391.788) (-385.807) (-390.702) -- 0:00:55
245000 -- (-385.691) [-386.248] (-385.852) (-388.375) * (-389.615) [-385.460] (-385.638) (-388.233) -- 0:00:55
Average standard deviation of split frequencies: 0.014523
245500 -- [-388.230] (-387.843) (-386.768) (-389.750) * [-387.899] (-386.997) (-385.497) (-387.243) -- 0:00:55
246000 -- [-386.564] (-386.919) (-386.741) (-385.019) * (-387.310) (-387.160) [-385.144] (-390.326) -- 0:00:55
246500 -- [-387.470] (-389.384) (-387.588) (-387.311) * [-385.148] (-386.812) (-387.546) (-391.030) -- 0:00:55
247000 -- (-385.033) [-388.072] (-390.933) (-387.980) * (-385.633) [-385.761] (-386.909) (-387.244) -- 0:00:54
247500 -- (-387.404) (-385.173) (-390.011) [-387.325] * [-386.554] (-386.792) (-387.284) (-386.463) -- 0:00:54
248000 -- (-385.598) [-385.287] (-387.880) (-388.183) * (-387.644) (-387.579) (-387.547) [-385.935] -- 0:00:57
248500 -- [-386.186] (-386.780) (-386.018) (-387.861) * (-386.447) (-388.399) [-390.513] (-388.734) -- 0:00:57
249000 -- (-389.969) (-386.765) (-389.256) [-385.505] * (-388.281) (-394.531) (-385.997) [-386.922] -- 0:00:57
249500 -- (-388.483) (-389.879) [-387.827] (-387.079) * (-387.535) (-386.930) (-386.523) [-385.858] -- 0:00:57
250000 -- (-385.522) (-388.274) [-385.640] (-386.788) * (-387.855) (-384.863) [-387.454] (-385.742) -- 0:00:57
Average standard deviation of split frequencies: 0.014313
250500 -- (-385.503) (-385.845) (-386.275) [-387.319] * (-386.713) [-385.719] (-386.236) (-385.872) -- 0:00:56
251000 -- [-386.157] (-389.926) (-385.353) (-386.270) * (-387.586) (-386.894) [-385.575] (-385.966) -- 0:00:56
251500 -- (-385.817) (-389.003) (-388.222) [-385.937] * (-386.112) [-386.278] (-385.303) (-385.937) -- 0:00:56
252000 -- (-385.789) (-388.263) [-386.840] (-386.802) * (-386.707) (-387.686) (-388.678) [-387.060] -- 0:00:56
252500 -- (-387.231) (-387.733) (-393.207) [-386.009] * (-386.999) (-389.743) (-388.494) [-386.119] -- 0:00:56
253000 -- (-386.224) [-388.840] (-389.714) (-387.044) * (-390.331) (-388.275) [-385.567] (-385.862) -- 0:00:56
253500 -- (-388.404) [-385.378] (-386.906) (-389.068) * [-385.136] (-389.427) (-386.586) (-385.246) -- 0:00:55
254000 -- (-388.303) (-385.869) [-386.360] (-387.195) * (-390.112) [-387.073] (-387.988) (-385.696) -- 0:00:55
254500 -- (-388.001) [-385.833] (-388.172) (-392.124) * (-387.410) (-386.309) (-386.590) [-392.901] -- 0:00:55
255000 -- (-386.515) (-385.380) [-388.893] (-389.772) * (-392.116) [-388.446] (-386.041) (-391.257) -- 0:00:55
Average standard deviation of split frequencies: 0.014220
255500 -- (-385.475) (-385.280) (-388.327) [-385.250] * (-387.159) (-387.588) (-387.524) [-387.632] -- 0:00:55
256000 -- [-391.983] (-390.677) (-390.092) (-390.576) * (-390.294) [-390.947] (-387.499) (-386.591) -- 0:00:55
256500 -- (-386.536) [-386.297] (-387.048) (-386.791) * (-388.152) (-385.817) [-386.567] (-388.831) -- 0:00:55
257000 -- [-387.234] (-387.795) (-386.385) (-386.463) * (-387.109) (-387.437) (-390.938) [-385.189] -- 0:00:54
257500 -- [-388.309] (-384.836) (-387.773) (-386.570) * (-388.215) [-386.904] (-388.422) (-388.848) -- 0:00:54
258000 -- [-388.888] (-386.832) (-386.423) (-385.877) * (-386.315) [-386.157] (-387.933) (-388.821) -- 0:00:54
258500 -- (-387.920) [-384.815] (-387.722) (-390.687) * (-389.223) [-386.041] (-386.010) (-388.654) -- 0:00:54
259000 -- (-390.060) (-387.050) [-384.952] (-385.246) * (-387.077) (-387.529) [-389.202] (-387.758) -- 0:00:54
259500 -- (-387.517) (-385.830) [-386.603] (-388.488) * (-385.391) (-387.548) [-389.206] (-386.500) -- 0:00:54
260000 -- (-390.395) (-386.028) (-387.039) [-387.984] * (-385.288) (-387.695) (-387.060) [-385.233] -- 0:00:54
Average standard deviation of split frequencies: 0.012320
260500 -- [-386.534] (-387.886) (-386.920) (-390.733) * [-387.079] (-386.028) (-387.422) (-386.811) -- 0:00:53
261000 -- [-386.897] (-385.496) (-386.710) (-387.210) * (-386.533) (-388.023) (-386.338) [-385.507] -- 0:00:53
261500 -- (-386.068) [-387.921] (-395.159) (-389.958) * (-387.279) [-386.548] (-385.744) (-386.081) -- 0:00:56
262000 -- (-388.118) (-395.452) [-391.599] (-388.742) * (-386.550) (-385.510) [-390.169] (-386.109) -- 0:00:56
262500 -- [-386.115] (-386.919) (-392.701) (-389.155) * [-385.655] (-386.633) (-388.706) (-388.212) -- 0:00:56
263000 -- (-387.355) (-386.300) [-389.559] (-385.934) * (-388.730) (-386.137) (-391.338) [-386.486] -- 0:00:56
263500 -- (-387.172) (-387.078) (-387.351) [-386.424] * (-390.532) (-389.595) [-385.949] (-387.496) -- 0:00:55
264000 -- (-389.127) (-386.959) (-386.182) [-387.178] * (-389.988) [-389.357] (-386.819) (-386.298) -- 0:00:55
264500 -- (-387.218) [-388.333] (-387.265) (-391.056) * (-386.894) (-396.384) [-389.967] (-385.799) -- 0:00:55
265000 -- [-388.916] (-391.388) (-389.638) (-386.689) * (-384.773) (-389.240) [-387.194] (-387.221) -- 0:00:55
Average standard deviation of split frequencies: 0.011780
265500 -- [-385.714] (-392.981) (-386.984) (-385.308) * (-387.811) (-387.116) (-385.975) [-386.054] -- 0:00:55
266000 -- [-391.652] (-387.579) (-386.229) (-388.050) * (-385.285) [-386.938] (-385.907) (-386.258) -- 0:00:55
266500 -- [-386.264] (-388.130) (-385.781) (-385.505) * (-386.128) [-388.045] (-387.878) (-389.237) -- 0:00:55
267000 -- (-391.409) (-385.251) (-385.962) [-390.189] * (-386.416) [-386.891] (-389.520) (-386.171) -- 0:00:54
267500 -- (-391.638) (-386.659) (-384.828) [-386.200] * (-387.787) [-388.890] (-389.731) (-386.058) -- 0:00:54
268000 -- (-387.708) [-387.509] (-386.500) (-388.256) * [-387.004] (-387.668) (-386.721) (-386.301) -- 0:00:54
268500 -- (-385.721) (-386.556) (-385.069) [-387.878] * (-386.163) (-389.810) (-388.339) [-385.403] -- 0:00:54
269000 -- [-387.721] (-386.024) (-386.507) (-386.869) * [-385.589] (-387.810) (-389.026) (-385.628) -- 0:00:54
269500 -- (-387.096) (-386.305) (-388.611) [-390.796] * [-386.585] (-387.847) (-390.655) (-386.136) -- 0:00:54
270000 -- (-388.989) [-387.341] (-387.133) (-392.205) * [-385.303] (-387.539) (-389.530) (-386.485) -- 0:00:54
Average standard deviation of split frequencies: 0.013498
270500 -- (-387.172) [-386.266] (-390.446) (-388.762) * (-385.581) [-386.153] (-391.014) (-387.253) -- 0:00:53
271000 -- (-387.571) [-386.463] (-386.411) (-391.867) * (-388.414) (-384.876) [-388.076] (-386.602) -- 0:00:53
271500 -- (-387.578) (-388.125) (-387.349) [-389.895] * [-389.597] (-385.306) (-386.391) (-385.934) -- 0:00:53
272000 -- [-385.740] (-390.385) (-388.856) (-391.547) * (-390.469) [-385.498] (-391.750) (-387.831) -- 0:00:53
272500 -- [-388.928] (-387.592) (-387.183) (-388.470) * [-385.580] (-392.015) (-387.637) (-386.042) -- 0:00:53
273000 -- (-388.582) [-386.104] (-389.834) (-389.072) * (-395.577) (-390.003) [-384.990] (-386.305) -- 0:00:53
273500 -- (-389.996) [-387.954] (-388.903) (-387.355) * (-392.512) (-387.896) (-386.005) [-392.439] -- 0:00:53
274000 -- [-386.178] (-391.925) (-386.492) (-389.167) * [-387.567] (-386.414) (-386.356) (-386.624) -- 0:00:52
274500 -- (-390.663) (-388.385) (-386.619) [-387.853] * [-387.975] (-387.317) (-388.573) (-386.277) -- 0:00:52
275000 -- (-386.704) (-389.146) (-385.648) [-386.016] * [-388.193] (-388.965) (-388.517) (-385.889) -- 0:00:52
Average standard deviation of split frequencies: 0.013023
275500 -- (-387.581) [-386.583] (-386.611) (-387.791) * [-389.219] (-386.172) (-392.110) (-387.409) -- 0:00:52
276000 -- [-385.145] (-387.422) (-387.472) (-386.779) * (-387.598) (-385.620) (-397.900) [-386.982] -- 0:00:55
276500 -- (-385.473) (-385.765) (-385.470) [-392.441] * (-386.754) (-384.728) (-402.508) [-387.053] -- 0:00:54
277000 -- [-387.314] (-386.014) (-387.067) (-388.263) * (-385.585) [-391.688] (-393.906) (-387.290) -- 0:00:54
277500 -- (-387.986) (-390.700) (-384.991) [-392.852] * [-388.286] (-388.779) (-390.858) (-385.813) -- 0:00:54
278000 -- [-390.421] (-387.638) (-386.320) (-390.587) * (-390.442) [-387.658] (-393.049) (-391.247) -- 0:00:54
278500 -- (-387.429) (-386.517) [-384.940] (-389.226) * (-387.085) [-385.839] (-386.140) (-389.063) -- 0:00:54
279000 -- (-390.147) (-387.438) (-385.782) [-386.223] * (-388.489) (-386.370) [-386.780] (-390.300) -- 0:00:54
279500 -- [-386.792] (-387.185) (-385.633) (-388.293) * (-386.931) (-388.302) (-386.039) [-388.636] -- 0:00:54
280000 -- [-386.443] (-389.265) (-386.743) (-387.814) * [-390.511] (-390.118) (-391.816) (-388.137) -- 0:00:53
Average standard deviation of split frequencies: 0.013437
280500 -- [-385.213] (-388.635) (-386.506) (-389.400) * [-387.767] (-385.765) (-386.605) (-389.651) -- 0:00:53
281000 -- (-386.105) (-391.420) (-388.086) [-386.412] * (-385.619) (-386.560) (-387.225) [-386.635] -- 0:00:53
281500 -- [-387.093] (-390.002) (-386.561) (-387.539) * [-386.138] (-384.747) (-386.651) (-388.595) -- 0:00:53
282000 -- (-387.495) [-386.750] (-387.915) (-386.058) * (-387.050) (-385.576) (-390.488) [-386.147] -- 0:00:53
282500 -- (-387.695) (-388.454) [-389.531] (-388.783) * (-388.147) [-389.604] (-391.746) (-387.354) -- 0:00:53
283000 -- (-386.744) (-387.780) (-389.869) [-387.179] * (-390.946) (-390.058) (-386.208) [-385.166] -- 0:00:53
283500 -- (-386.662) [-387.340] (-386.155) (-388.592) * (-387.058) (-391.270) [-387.864] (-385.087) -- 0:00:53
284000 -- [-385.642] (-388.816) (-388.812) (-387.357) * (-386.387) (-388.876) (-386.898) [-385.797] -- 0:00:52
284500 -- (-388.209) [-385.557] (-392.512) (-389.270) * (-390.925) (-389.002) [-386.788] (-386.630) -- 0:00:52
285000 -- (-386.875) (-384.976) (-387.263) [-388.144] * (-387.899) (-386.604) (-387.669) [-386.338] -- 0:00:52
Average standard deviation of split frequencies: 0.012507
285500 -- [-385.430] (-388.830) (-388.687) (-387.281) * (-389.928) (-386.395) [-386.507] (-388.300) -- 0:00:52
286000 -- (-386.988) [-389.617] (-388.485) (-386.902) * [-389.665] (-386.881) (-385.244) (-385.618) -- 0:00:52
286500 -- [-386.477] (-386.501) (-388.844) (-387.903) * [-391.623] (-390.476) (-387.531) (-386.156) -- 0:00:52
287000 -- (-385.084) [-385.593] (-390.962) (-387.046) * (-386.921) (-387.591) (-390.743) [-386.050] -- 0:00:52
287500 -- (-389.501) (-386.771) (-388.627) [-385.136] * (-387.833) (-387.871) (-385.837) [-384.904] -- 0:00:52
288000 -- (-387.511) [-387.489] (-388.344) (-385.279) * (-388.870) [-385.284] (-388.726) (-388.682) -- 0:00:51
288500 -- (-390.460) [-387.322] (-389.644) (-389.946) * [-391.060] (-387.090) (-388.583) (-386.041) -- 0:00:51
289000 -- (-388.023) (-388.434) (-387.619) [-386.768] * (-386.782) (-385.235) (-386.353) [-386.198] -- 0:00:51
289500 -- [-385.637] (-387.393) (-386.621) (-387.144) * [-387.334] (-387.327) (-387.248) (-387.983) -- 0:00:51
290000 -- (-386.241) (-390.489) (-386.168) [-386.630] * (-386.691) [-387.288] (-387.965) (-386.460) -- 0:00:51
Average standard deviation of split frequencies: 0.011543
290500 -- (-385.892) (-385.990) (-386.720) [-388.662] * [-384.989] (-386.947) (-390.052) (-385.418) -- 0:00:53
291000 -- (-389.194) (-387.786) (-386.911) [-386.947] * (-385.962) [-385.618] (-387.445) (-388.764) -- 0:00:53
291500 -- (-388.223) [-386.828] (-390.263) (-386.123) * (-387.243) [-386.101] (-386.943) (-387.435) -- 0:00:53
292000 -- (-385.899) (-391.208) (-388.467) [-388.383] * (-386.386) [-386.599] (-386.631) (-388.892) -- 0:00:53
292500 -- (-389.216) (-387.428) [-390.547] (-394.740) * [-386.595] (-388.067) (-387.418) (-386.443) -- 0:00:53
293000 -- (-388.096) (-388.169) [-389.161] (-392.170) * (-387.539) [-388.024] (-386.438) (-390.816) -- 0:00:53
293500 -- (-392.162) [-386.211] (-388.375) (-386.013) * (-387.720) (-388.528) (-386.062) [-389.283] -- 0:00:52
294000 -- (-390.853) (-386.427) [-391.308] (-388.122) * (-388.446) (-387.384) [-388.379] (-388.758) -- 0:00:52
294500 -- (-392.278) [-387.202] (-386.791) (-387.853) * (-387.550) [-385.808] (-386.594) (-385.641) -- 0:00:52
295000 -- (-387.374) [-385.742] (-388.627) (-387.326) * (-385.321) (-390.225) (-386.543) [-386.097] -- 0:00:52
Average standard deviation of split frequencies: 0.012085
295500 -- (-384.937) [-384.895] (-390.626) (-387.681) * (-390.717) (-385.845) [-386.605] (-387.271) -- 0:00:52
296000 -- (-387.305) (-385.112) [-387.936] (-385.681) * (-391.368) (-387.344) [-387.688] (-386.637) -- 0:00:52
296500 -- [-386.125] (-385.182) (-386.771) (-389.370) * [-386.177] (-388.841) (-387.606) (-388.894) -- 0:00:52
297000 -- [-386.305] (-385.288) (-386.157) (-386.717) * (-386.624) (-388.723) [-389.912] (-387.207) -- 0:00:52
297500 -- (-387.109) [-386.049] (-385.956) (-386.710) * (-389.095) (-385.368) [-387.284] (-387.707) -- 0:00:51
298000 -- (-385.087) [-385.183] (-387.613) (-386.073) * (-385.782) (-385.843) (-385.602) [-386.075] -- 0:00:51
298500 -- (-386.204) (-386.352) [-388.839] (-388.897) * (-386.816) (-388.810) (-389.071) [-390.196] -- 0:00:51
299000 -- [-385.927] (-389.665) (-385.515) (-387.206) * (-388.178) [-387.529] (-388.031) (-390.798) -- 0:00:51
299500 -- (-386.433) (-389.888) [-386.064] (-386.102) * (-389.352) (-392.492) (-386.868) [-389.438] -- 0:00:51
300000 -- (-386.293) (-387.304) (-384.882) [-386.920] * (-388.566) [-389.992] (-386.013) (-385.366) -- 0:00:51
Average standard deviation of split frequencies: 0.013373
300500 -- [-388.078] (-388.044) (-386.851) (-388.050) * (-393.375) (-388.989) [-387.335] (-387.472) -- 0:00:51
301000 -- (-388.061) (-389.014) [-388.196] (-386.571) * (-389.343) (-389.163) [-387.057] (-386.012) -- 0:00:51
301500 -- (-388.018) (-385.808) (-385.456) [-387.916] * (-387.129) [-386.567] (-386.128) (-386.928) -- 0:00:50
302000 -- (-386.362) [-385.775] (-385.476) (-386.802) * [-386.426] (-391.729) (-392.259) (-387.749) -- 0:00:50
302500 -- [-387.470] (-388.480) (-385.415) (-387.963) * (-386.662) [-390.548] (-387.556) (-386.572) -- 0:00:50
303000 -- [-385.198] (-389.219) (-386.686) (-390.610) * (-385.049) (-388.469) (-386.495) [-384.790] -- 0:00:50
303500 -- [-385.590] (-388.460) (-387.758) (-385.962) * [-386.093] (-386.636) (-386.946) (-386.841) -- 0:00:50
304000 -- [-385.779] (-390.722) (-390.274) (-386.369) * (-388.297) (-385.535) (-389.486) [-390.049] -- 0:00:52
304500 -- (-390.671) (-385.489) (-391.382) [-386.217] * (-386.883) (-385.751) (-388.679) [-386.401] -- 0:00:52
305000 -- (-390.199) (-385.360) [-386.993] (-386.795) * (-387.081) [-389.092] (-386.917) (-386.951) -- 0:00:52
Average standard deviation of split frequencies: 0.012811
305500 -- [-385.675] (-385.349) (-385.629) (-385.767) * (-387.715) (-390.442) (-386.897) [-386.078] -- 0:00:52
306000 -- (-387.514) [-387.019] (-386.853) (-387.227) * [-391.752] (-386.348) (-386.284) (-389.507) -- 0:00:52
306500 -- (-390.583) (-387.475) [-385.110] (-388.469) * [-385.487] (-388.933) (-387.704) (-388.843) -- 0:00:52
307000 -- (-388.933) [-388.534] (-386.263) (-388.333) * (-393.266) (-388.710) (-390.175) [-386.078] -- 0:00:51
307500 -- (-386.048) [-386.672] (-387.759) (-386.150) * (-386.112) (-388.653) (-386.672) [-385.261] -- 0:00:51
308000 -- (-390.002) [-387.872] (-387.789) (-386.281) * (-388.532) [-391.008] (-388.758) (-387.232) -- 0:00:51
308500 -- (-391.163) (-386.132) (-385.268) [-386.458] * (-387.009) (-385.823) (-387.220) [-386.220] -- 0:00:51
309000 -- [-387.009] (-385.514) (-386.058) (-388.782) * (-386.003) (-387.630) (-390.160) [-385.863] -- 0:00:51
309500 -- (-386.308) (-385.783) [-385.225] (-387.597) * (-385.136) (-385.740) [-389.495] (-389.451) -- 0:00:51
310000 -- (-387.444) (-386.925) (-385.655) [-387.691] * (-385.225) (-386.971) [-386.215] (-386.001) -- 0:00:51
Average standard deviation of split frequencies: 0.013994
310500 -- (-385.678) (-387.027) [-385.901] (-388.011) * [-385.360] (-387.226) (-387.045) (-385.886) -- 0:00:51
311000 -- [-386.184] (-387.669) (-386.583) (-389.807) * (-386.352) (-388.767) [-386.613] (-389.044) -- 0:00:50
311500 -- (-385.823) (-391.375) (-386.784) [-386.072] * (-384.652) (-385.212) [-392.391] (-387.697) -- 0:00:50
312000 -- (-388.334) [-389.612] (-385.322) (-385.152) * (-386.421) (-387.525) (-386.935) [-386.336] -- 0:00:50
312500 -- (-384.922) (-387.768) (-387.092) [-385.437] * (-390.454) (-385.917) [-385.991] (-386.126) -- 0:00:50
313000 -- (-386.657) (-386.302) (-387.406) [-385.572] * (-385.160) (-387.352) [-386.995] (-388.013) -- 0:00:50
313500 -- (-387.799) (-388.726) [-390.220] (-387.382) * (-385.559) (-385.261) (-386.750) [-386.219] -- 0:00:50
314000 -- (-393.875) [-386.628] (-384.895) (-386.535) * (-390.489) (-392.439) [-385.757] (-389.001) -- 0:00:50
314500 -- (-387.103) (-386.005) [-385.266] (-386.856) * (-389.302) (-386.410) [-385.550] (-386.553) -- 0:00:50
315000 -- (-388.067) (-386.891) (-389.941) [-386.106] * (-388.197) (-387.533) (-385.362) [-390.410] -- 0:00:50
Average standard deviation of split frequencies: 0.013675
315500 -- [-387.611] (-385.694) (-389.678) (-389.999) * [-388.182] (-386.364) (-387.686) (-389.474) -- 0:00:49
316000 -- (-385.851) (-388.011) [-386.186] (-390.495) * (-385.879) [-387.642] (-386.028) (-390.689) -- 0:00:49
316500 -- [-385.501] (-385.713) (-386.438) (-389.089) * (-388.334) (-387.761) [-388.787] (-388.412) -- 0:00:49
317000 -- (-388.766) (-386.034) (-391.233) [-388.173] * (-387.140) (-388.569) [-385.331] (-386.567) -- 0:00:49
317500 -- [-386.676] (-386.213) (-390.608) (-388.453) * (-386.916) [-387.957] (-385.336) (-393.034) -- 0:00:49
318000 -- [-388.112] (-386.109) (-396.518) (-386.847) * [-388.203] (-390.349) (-390.778) (-386.067) -- 0:00:49
318500 -- (-386.471) [-387.633] (-393.338) (-384.755) * (-389.409) (-389.664) (-386.171) [-385.539] -- 0:00:51
319000 -- (-393.288) (-385.848) [-387.691] (-385.216) * (-385.464) (-390.227) [-385.745] (-389.380) -- 0:00:51
319500 -- (-390.110) (-391.229) (-385.529) [-385.895] * [-386.032] (-389.803) (-386.377) (-387.009) -- 0:00:51
320000 -- (-386.522) [-387.079] (-385.946) (-385.557) * (-387.861) (-394.841) (-390.117) [-386.750] -- 0:00:50
Average standard deviation of split frequencies: 0.013557
320500 -- (-388.838) (-385.798) [-386.748] (-388.014) * (-386.410) [-391.079] (-390.365) (-386.755) -- 0:00:50
321000 -- (-387.310) [-390.719] (-388.672) (-387.852) * (-385.975) (-391.625) (-385.879) [-388.775] -- 0:00:50
321500 -- (-387.583) (-387.295) [-386.029] (-385.471) * (-386.439) (-386.351) [-385.123] (-386.507) -- 0:00:50
322000 -- (-389.840) (-385.082) (-387.709) [-384.927] * (-387.265) (-389.962) (-385.191) [-386.271] -- 0:00:50
322500 -- (-387.381) (-385.656) (-388.793) [-391.084] * [-385.529] (-386.342) (-386.102) (-387.574) -- 0:00:50
323000 -- (-386.872) [-386.265] (-387.872) (-387.875) * (-388.141) [-389.503] (-386.965) (-386.850) -- 0:00:50
323500 -- (-392.700) (-385.525) [-386.217] (-389.008) * (-391.753) (-386.444) (-387.724) [-387.770] -- 0:00:50
324000 -- (-392.083) (-385.977) [-386.348] (-385.094) * (-392.365) (-387.176) (-386.717) [-385.849] -- 0:00:50
324500 -- (-388.039) [-384.880] (-386.178) (-386.297) * (-388.300) [-385.472] (-391.942) (-387.054) -- 0:00:49
325000 -- [-385.653] (-386.373) (-384.953) (-388.159) * (-388.158) (-389.385) (-387.685) [-385.600] -- 0:00:49
Average standard deviation of split frequencies: 0.013014
325500 -- [-386.828] (-385.646) (-389.360) (-386.613) * (-388.766) (-386.243) (-386.075) [-385.988] -- 0:00:49
326000 -- (-389.909) (-388.590) [-388.904] (-385.273) * [-389.999] (-387.330) (-388.697) (-386.542) -- 0:00:49
326500 -- (-388.723) (-385.116) [-390.212] (-386.745) * (-388.118) [-386.968] (-386.395) (-385.627) -- 0:00:49
327000 -- (-390.820) [-387.137] (-388.756) (-386.854) * (-387.752) (-391.049) (-389.709) [-385.462] -- 0:00:49
327500 -- (-389.009) [-387.385] (-391.483) (-392.073) * (-387.466) [-388.667] (-385.499) (-385.439) -- 0:00:49
328000 -- [-386.230] (-385.731) (-385.232) (-386.860) * (-390.806) (-392.348) (-389.036) [-384.961] -- 0:00:49
328500 -- (-387.528) [-385.854] (-386.338) (-387.849) * (-390.370) (-388.054) [-387.901] (-385.484) -- 0:00:49
329000 -- (-387.748) (-385.792) (-388.011) [-385.893] * (-389.281) [-385.735] (-385.890) (-386.289) -- 0:00:48
329500 -- (-387.002) (-387.578) (-386.041) [-387.501] * (-390.544) (-386.323) (-387.302) [-390.315] -- 0:00:48
330000 -- (-389.193) (-388.117) [-386.019] (-388.476) * (-388.689) [-386.706] (-387.556) (-386.801) -- 0:00:48
Average standard deviation of split frequencies: 0.012514
330500 -- (-388.869) [-386.142] (-388.097) (-388.438) * (-388.154) (-386.475) [-386.893] (-386.556) -- 0:00:48
331000 -- (-386.484) (-386.704) [-388.212] (-386.282) * (-390.535) [-387.143] (-388.738) (-386.127) -- 0:00:48
331500 -- [-387.275] (-393.429) (-386.820) (-388.321) * (-386.686) [-387.669] (-385.640) (-386.200) -- 0:00:48
332000 -- (-386.140) (-386.588) (-386.297) [-386.936] * (-387.150) [-387.952] (-388.930) (-388.280) -- 0:00:48
332500 -- [-385.927] (-388.003) (-389.810) (-388.374) * (-391.152) (-385.338) (-385.882) [-386.831] -- 0:00:50
333000 -- (-386.913) [-389.983] (-388.462) (-389.471) * (-388.961) (-387.596) [-387.699] (-387.797) -- 0:00:50
333500 -- (-385.528) [-386.705] (-386.660) (-387.439) * (-387.103) [-387.465] (-385.636) (-389.443) -- 0:00:49
334000 -- (-386.043) (-387.706) (-385.364) [-385.279] * (-389.082) (-388.110) (-387.205) [-390.383] -- 0:00:49
334500 -- (-388.251) (-388.462) (-387.015) [-387.069] * (-389.150) (-385.125) (-390.108) [-386.252] -- 0:00:49
335000 -- [-388.362] (-386.133) (-387.225) (-386.540) * [-386.447] (-386.003) (-388.196) (-388.044) -- 0:00:49
Average standard deviation of split frequencies: 0.012315
335500 -- (-387.020) (-388.740) (-392.754) [-385.957] * [-385.390] (-386.920) (-387.742) (-387.580) -- 0:00:49
336000 -- (-386.821) [-385.759] (-387.753) (-386.952) * [-387.768] (-386.280) (-390.285) (-388.116) -- 0:00:49
336500 -- [-390.263] (-386.017) (-387.143) (-388.610) * [-389.953] (-387.277) (-387.374) (-385.355) -- 0:00:49
337000 -- (-392.693) (-387.277) (-387.023) [-387.231] * [-387.795] (-385.664) (-387.367) (-387.167) -- 0:00:49
337500 -- (-387.481) (-386.630) (-392.596) [-385.430] * (-389.855) [-389.646] (-386.618) (-386.783) -- 0:00:49
338000 -- (-385.767) (-385.486) [-389.146] (-386.005) * (-386.373) (-391.165) (-387.251) [-389.990] -- 0:00:48
338500 -- (-386.530) (-386.693) [-385.884] (-385.285) * [-386.305] (-387.394) (-387.676) (-386.575) -- 0:00:48
339000 -- (-387.031) (-386.851) (-384.928) [-387.059] * (-385.294) [-390.869] (-388.765) (-388.250) -- 0:00:48
339500 -- (-388.297) (-386.683) (-385.917) [-386.257] * (-387.443) (-391.670) (-386.256) [-386.465] -- 0:00:48
340000 -- (-388.359) (-386.404) (-386.613) [-387.350] * (-386.691) [-386.946] (-388.610) (-387.689) -- 0:00:48
Average standard deviation of split frequencies: 0.013761
340500 -- (-386.753) (-387.847) (-386.776) [-387.190] * [-386.350] (-387.415) (-387.073) (-390.552) -- 0:00:48
341000 -- (-386.441) [-386.824] (-385.812) (-387.879) * (-386.455) (-388.585) [-387.599] (-387.342) -- 0:00:48
341500 -- (-393.687) (-388.160) [-389.369] (-387.312) * [-388.135] (-388.287) (-385.513) (-388.799) -- 0:00:48
342000 -- (-388.428) (-387.155) (-386.900) [-386.101] * [-386.590] (-390.809) (-389.125) (-387.648) -- 0:00:48
342500 -- [-386.833] (-388.918) (-385.286) (-386.319) * (-386.460) (-385.881) [-385.246] (-387.579) -- 0:00:47
343000 -- (-386.869) [-388.867] (-386.061) (-387.552) * (-388.071) (-387.000) [-386.611] (-386.623) -- 0:00:47
343500 -- (-386.214) (-390.002) [-388.937] (-386.221) * (-387.887) (-388.856) [-386.796] (-385.339) -- 0:00:47
344000 -- [-387.281] (-387.140) (-385.902) (-388.888) * (-385.771) [-386.063] (-389.032) (-389.283) -- 0:00:47
344500 -- (-385.924) [-384.862] (-387.495) (-388.169) * (-391.591) (-386.280) [-387.597] (-391.461) -- 0:00:47
345000 -- (-388.112) [-388.793] (-388.061) (-387.652) * (-386.495) (-387.521) (-386.835) [-389.874] -- 0:00:47
Average standard deviation of split frequencies: 0.012983
345500 -- [-386.679] (-385.822) (-391.694) (-394.691) * [-387.985] (-388.452) (-387.914) (-389.310) -- 0:00:47
346000 -- [-386.873] (-391.877) (-394.403) (-389.939) * (-389.498) [-385.960] (-388.523) (-385.516) -- 0:00:47
346500 -- [-390.516] (-386.732) (-388.022) (-386.137) * (-389.135) [-389.271] (-387.185) (-390.157) -- 0:00:47
347000 -- (-392.670) [-386.443] (-387.737) (-388.264) * (-388.239) (-387.653) (-388.270) [-385.760] -- 0:00:48
347500 -- (-392.385) (-385.247) [-387.030] (-388.187) * (-387.677) (-385.402) (-386.090) [-385.894] -- 0:00:48
348000 -- [-389.212] (-387.110) (-390.232) (-387.848) * (-387.397) [-386.736] (-389.669) (-386.539) -- 0:00:48
348500 -- (-391.335) (-391.815) [-387.322] (-387.380) * (-385.616) [-387.826] (-388.685) (-385.901) -- 0:00:48
349000 -- (-389.394) (-385.983) [-390.147] (-389.193) * (-387.330) (-386.191) [-386.254] (-386.214) -- 0:00:48
349500 -- (-387.334) (-386.861) (-389.252) [-388.598] * (-392.161) (-387.364) [-387.238] (-385.171) -- 0:00:48
350000 -- (-385.785) (-392.923) (-387.792) [-385.809] * [-387.675] (-385.185) (-386.958) (-390.926) -- 0:00:48
Average standard deviation of split frequencies: 0.013759
350500 -- (-386.827) (-387.613) (-387.416) [-385.124] * (-391.405) (-387.815) (-389.396) [-386.280] -- 0:00:48
351000 -- [-385.636] (-387.015) (-387.516) (-387.937) * (-390.797) [-387.207] (-386.260) (-385.051) -- 0:00:48
351500 -- (-388.384) [-389.546] (-385.774) (-387.150) * (-386.799) (-386.470) (-386.431) [-388.593] -- 0:00:47
352000 -- (-389.794) (-387.148) (-386.465) [-388.427] * (-386.474) (-385.769) (-386.794) [-387.404] -- 0:00:47
352500 -- (-387.638) (-387.514) [-388.153] (-387.264) * [-387.964] (-386.115) (-386.372) (-389.864) -- 0:00:47
353000 -- (-386.127) [-386.885] (-385.920) (-386.603) * (-389.279) [-385.802] (-385.646) (-387.739) -- 0:00:47
353500 -- [-385.936] (-388.172) (-385.943) (-386.155) * (-390.252) (-387.598) [-385.244] (-385.625) -- 0:00:47
354000 -- (-389.156) [-388.183] (-387.177) (-385.937) * (-389.038) [-387.191] (-385.990) (-386.607) -- 0:00:47
354500 -- (-387.544) (-391.106) [-386.742] (-389.108) * [-386.419] (-385.117) (-387.623) (-390.400) -- 0:00:47
355000 -- (-387.991) [-386.809] (-387.753) (-390.508) * (-387.289) [-386.167] (-386.063) (-394.238) -- 0:00:47
Average standard deviation of split frequencies: 0.013320
355500 -- (-386.464) (-387.448) (-385.302) [-386.688] * [-387.762] (-385.557) (-388.683) (-388.835) -- 0:00:47
356000 -- (-386.514) (-388.637) (-386.011) [-389.140] * (-388.766) (-386.562) (-385.825) [-387.432] -- 0:00:47
356500 -- (-387.190) [-386.168] (-386.287) (-387.583) * (-386.363) (-385.687) (-386.386) [-386.096] -- 0:00:46
357000 -- (-386.498) [-385.521] (-385.259) (-387.297) * (-385.313) (-386.188) [-385.618] (-387.764) -- 0:00:46
357500 -- (-387.115) (-387.667) (-388.713) [-385.761] * [-388.329] (-392.074) (-387.177) (-388.564) -- 0:00:46
358000 -- (-387.510) [-387.449] (-387.111) (-386.711) * (-388.535) (-393.721) (-386.222) [-385.004] -- 0:00:46
358500 -- (-386.546) (-386.450) [-388.177] (-386.564) * (-384.961) (-393.116) [-386.464] (-385.540) -- 0:00:46
359000 -- [-394.100] (-386.995) (-386.778) (-387.129) * (-384.911) (-385.529) [-388.585] (-385.591) -- 0:00:46
359500 -- (-388.182) [-386.985] (-386.271) (-387.824) * [-385.813] (-386.691) (-386.575) (-386.118) -- 0:00:46
360000 -- [-387.087] (-387.157) (-387.202) (-386.533) * (-388.981) (-388.349) [-387.068] (-389.742) -- 0:00:46
Average standard deviation of split frequencies: 0.013762
360500 -- (-391.126) [-389.192] (-385.889) (-387.311) * (-392.865) (-386.323) [-387.135] (-387.692) -- 0:00:46
361000 -- (-386.768) (-388.546) (-386.312) [-385.946] * (-385.787) [-385.319] (-388.270) (-386.279) -- 0:00:46
361500 -- (-386.283) (-385.281) (-386.826) [-386.878] * (-386.581) [-387.612] (-387.185) (-387.110) -- 0:00:47
362000 -- (-389.270) (-385.127) [-386.990] (-386.004) * (-386.358) (-387.501) [-387.012] (-390.072) -- 0:00:47
362500 -- (-386.117) [-388.023] (-388.800) (-386.196) * [-388.354] (-393.595) (-385.027) (-384.932) -- 0:00:47
363000 -- (-390.211) (-388.172) (-388.080) [-388.710] * (-388.740) [-389.048] (-388.290) (-385.611) -- 0:00:47
363500 -- (-387.028) (-387.225) (-391.011) [-390.688] * (-385.861) [-389.564] (-389.015) (-386.344) -- 0:00:47
364000 -- (-387.724) (-388.035) [-385.824] (-389.523) * (-390.811) (-388.510) [-389.256] (-394.749) -- 0:00:47
364500 -- [-386.211] (-385.337) (-391.415) (-388.410) * [-385.656] (-388.520) (-388.138) (-387.762) -- 0:00:47
365000 -- [-385.234] (-388.757) (-386.070) (-389.258) * [-385.847] (-387.885) (-389.742) (-387.737) -- 0:00:46
Average standard deviation of split frequencies: 0.014016
365500 -- [-386.087] (-391.468) (-387.564) (-388.232) * (-385.265) [-385.661] (-387.605) (-387.361) -- 0:00:46
366000 -- (-385.198) (-386.384) [-385.766] (-387.604) * (-388.990) [-385.933] (-389.345) (-390.140) -- 0:00:46
366500 -- (-388.113) (-385.283) (-392.169) [-387.639] * (-390.042) (-389.799) (-384.994) [-386.381] -- 0:00:46
367000 -- (-387.196) [-386.279] (-385.032) (-387.410) * [-388.715] (-387.844) (-388.321) (-387.641) -- 0:00:46
367500 -- (-386.407) [-386.585] (-389.521) (-393.545) * (-386.711) [-387.151] (-387.962) (-385.479) -- 0:00:46
368000 -- [-388.662] (-386.741) (-386.201) (-388.595) * (-385.339) (-386.434) [-385.699] (-385.532) -- 0:00:46
368500 -- (-386.074) (-386.318) [-387.967] (-385.544) * (-384.960) [-388.943] (-386.806) (-386.444) -- 0:00:46
369000 -- (-387.462) (-386.126) [-386.493] (-385.550) * (-385.781) (-385.170) [-385.722] (-386.528) -- 0:00:46
369500 -- [-386.133] (-386.716) (-386.746) (-388.134) * [-395.001] (-387.903) (-386.365) (-392.873) -- 0:00:46
370000 -- (-387.524) (-387.477) [-386.042] (-394.219) * [-388.300] (-386.475) (-389.794) (-387.613) -- 0:00:45
Average standard deviation of split frequencies: 0.014289
370500 -- (-385.848) (-386.535) [-388.139] (-392.335) * (-387.322) [-387.068] (-387.699) (-387.294) -- 0:00:45
371000 -- (-388.976) (-389.074) (-388.054) [-387.085] * (-385.719) (-387.069) [-387.787] (-385.966) -- 0:00:45
371500 -- (-386.212) (-385.290) (-387.233) [-385.320] * [-386.563] (-385.849) (-387.850) (-388.982) -- 0:00:45
372000 -- (-385.534) (-388.429) (-386.699) [-386.527] * (-390.170) (-386.018) [-386.396] (-390.858) -- 0:00:45
372500 -- (-387.322) (-385.199) [-387.655] (-385.965) * (-385.686) (-388.232) (-386.978) [-387.517] -- 0:00:45
373000 -- (-385.529) [-386.029] (-385.758) (-385.526) * (-386.983) (-386.469) (-388.758) [-390.138] -- 0:00:45
373500 -- (-385.636) (-389.400) [-385.787] (-385.235) * [-385.964] (-386.975) (-386.331) (-387.850) -- 0:00:45
374000 -- (-386.166) [-388.709] (-386.307) (-388.050) * (-386.602) (-390.223) [-385.255] (-389.246) -- 0:00:45
374500 -- (-386.923) [-387.074] (-386.270) (-387.650) * (-387.310) (-389.952) [-386.460] (-388.845) -- 0:00:45
375000 -- [-386.044] (-385.084) (-385.606) (-389.445) * (-387.021) (-387.957) (-388.619) [-386.622] -- 0:00:45
Average standard deviation of split frequencies: 0.014529
375500 -- [-385.365] (-387.159) (-388.159) (-386.496) * (-388.172) (-386.497) [-387.470] (-385.746) -- 0:00:46
376000 -- [-388.639] (-386.825) (-387.293) (-388.753) * (-389.589) (-386.034) [-388.041] (-388.136) -- 0:00:46
376500 -- (-386.345) (-386.669) [-388.376] (-389.193) * (-388.649) (-389.886) [-389.695] (-386.641) -- 0:00:46
377000 -- [-387.945] (-389.969) (-387.496) (-385.245) * (-386.035) (-389.500) (-387.349) [-385.978] -- 0:00:46
377500 -- (-386.585) [-390.356] (-388.055) (-386.595) * (-387.234) [-387.469] (-386.837) (-388.629) -- 0:00:46
378000 -- (-386.856) (-387.501) (-386.573) [-386.851] * (-389.122) (-386.469) (-393.394) [-387.017] -- 0:00:46
378500 -- (-392.981) (-385.328) (-390.098) [-386.882] * (-385.593) [-390.460] (-391.552) (-386.256) -- 0:00:45
379000 -- (-385.294) (-387.011) (-388.859) [-386.162] * (-392.178) (-386.213) (-389.260) [-387.192] -- 0:00:45
379500 -- (-386.554) [-385.728] (-387.083) (-387.312) * (-392.185) (-385.002) [-386.610] (-385.541) -- 0:00:45
380000 -- (-388.401) (-385.710) (-387.767) [-385.893] * (-388.369) [-386.015] (-386.138) (-385.596) -- 0:00:45
Average standard deviation of split frequencies: 0.015079
380500 -- (-387.038) (-386.004) (-387.726) [-385.871] * [-391.155] (-384.680) (-386.691) (-393.190) -- 0:00:45
381000 -- (-386.033) (-385.298) [-387.944] (-387.677) * (-388.359) (-386.493) [-385.997] (-387.192) -- 0:00:45
381500 -- (-387.155) (-392.887) (-385.809) [-387.302] * [-385.478] (-390.261) (-393.567) (-387.298) -- 0:00:45
382000 -- (-388.026) (-391.197) (-386.902) [-390.066] * [-385.186] (-389.663) (-388.107) (-386.830) -- 0:00:45
382500 -- [-394.788] (-386.394) (-390.142) (-385.460) * (-386.426) (-387.258) (-391.050) [-390.379] -- 0:00:45
383000 -- (-390.540) (-391.454) (-387.799) [-386.384] * (-390.195) [-385.692] (-387.797) (-388.843) -- 0:00:45
383500 -- (-387.086) (-385.379) [-388.078] (-385.030) * (-390.422) (-385.133) (-387.772) [-387.568] -- 0:00:45
384000 -- (-385.026) (-386.236) (-386.555) [-385.043] * (-387.840) (-385.282) (-389.567) [-387.087] -- 0:00:44
384500 -- (-386.883) [-386.107] (-387.108) (-387.723) * (-385.924) (-386.351) [-386.250] (-388.878) -- 0:00:44
385000 -- [-386.303] (-388.330) (-389.942) (-386.555) * (-389.784) (-386.257) (-388.490) [-386.059] -- 0:00:44
Average standard deviation of split frequencies: 0.015733
385500 -- [-386.882] (-386.761) (-391.510) (-390.588) * [-388.730] (-390.969) (-387.505) (-384.896) -- 0:00:44
386000 -- [-385.528] (-386.027) (-389.069) (-387.005) * (-385.504) (-389.836) (-387.052) [-385.310] -- 0:00:44
386500 -- (-387.503) (-387.525) [-390.922] (-387.724) * (-387.095) [-386.494] (-385.803) (-387.775) -- 0:00:44
387000 -- [-388.140] (-387.025) (-390.162) (-385.591) * [-386.716] (-386.933) (-387.639) (-387.885) -- 0:00:44
387500 -- [-386.130] (-386.546) (-387.387) (-384.970) * (-389.715) (-390.498) (-388.226) [-386.302] -- 0:00:44
388000 -- [-386.279] (-388.217) (-388.446) (-387.331) * [-387.068] (-389.291) (-386.536) (-385.197) -- 0:00:44
388500 -- (-387.617) (-385.988) [-385.890] (-388.340) * (-388.373) (-387.497) [-385.653] (-388.602) -- 0:00:44
389000 -- (-386.803) [-389.031] (-386.142) (-385.814) * (-390.485) (-388.235) (-385.716) [-386.193] -- 0:00:43
389500 -- (-387.501) (-386.098) [-385.960] (-386.517) * (-385.329) (-387.608) [-386.388] (-386.499) -- 0:00:45
390000 -- [-387.483] (-388.024) (-386.355) (-386.156) * [-388.004] (-389.288) (-387.046) (-386.740) -- 0:00:45
Average standard deviation of split frequencies: 0.014254
390500 -- (-390.328) (-388.517) (-386.395) [-388.525] * [-386.137] (-390.310) (-386.447) (-385.540) -- 0:00:45
391000 -- [-387.276] (-390.757) (-387.145) (-386.420) * (-391.061) (-385.337) [-386.573] (-385.507) -- 0:00:45
391500 -- [-386.924] (-385.802) (-387.256) (-386.741) * [-386.709] (-390.743) (-386.554) (-388.102) -- 0:00:45
392000 -- (-385.826) (-387.884) [-386.291] (-385.317) * (-387.496) (-396.336) (-386.478) [-386.973] -- 0:00:44
392500 -- (-385.228) (-389.173) [-386.374] (-385.741) * (-386.981) (-386.744) (-386.932) [-385.769] -- 0:00:44
393000 -- [-387.070] (-389.852) (-389.271) (-389.447) * (-390.127) (-390.622) (-385.338) [-389.455] -- 0:00:44
393500 -- (-386.796) (-386.678) (-389.662) [-388.066] * (-386.259) (-384.942) (-386.790) [-387.748] -- 0:00:44
394000 -- (-385.547) (-385.524) (-387.941) [-385.971] * (-390.742) [-387.503] (-386.729) (-394.401) -- 0:00:44
394500 -- [-385.025] (-385.757) (-398.212) (-385.934) * (-388.569) (-387.115) [-387.567] (-389.602) -- 0:00:44
395000 -- (-385.385) [-386.037] (-399.227) (-388.672) * (-388.142) (-385.891) [-389.270] (-385.719) -- 0:00:44
Average standard deviation of split frequencies: 0.014136
395500 -- (-387.460) (-385.718) (-390.021) [-387.531] * (-387.424) [-385.612] (-389.078) (-388.642) -- 0:00:44
396000 -- (-389.006) [-387.113] (-386.768) (-387.082) * (-386.255) (-388.027) (-385.587) [-387.438] -- 0:00:44
396500 -- (-388.475) (-390.452) [-385.178] (-387.791) * (-389.897) (-393.796) [-385.284] (-387.699) -- 0:00:44
397000 -- (-387.312) (-385.403) (-387.965) [-384.998] * [-391.561] (-388.700) (-386.337) (-387.316) -- 0:00:44
397500 -- (-386.933) (-388.741) [-385.931] (-385.013) * (-385.756) (-386.999) [-386.276] (-386.878) -- 0:00:43
398000 -- (-385.620) (-386.005) [-386.654] (-388.571) * (-386.429) (-396.463) [-386.009] (-386.362) -- 0:00:43
398500 -- [-386.054] (-387.826) (-387.103) (-388.258) * (-388.556) (-390.418) [-385.850] (-389.203) -- 0:00:43
399000 -- (-387.267) [-386.552] (-389.744) (-388.385) * (-386.166) (-390.756) [-388.122] (-385.810) -- 0:00:43
399500 -- [-387.349] (-386.804) (-387.841) (-389.103) * [-388.172] (-393.897) (-387.982) (-385.854) -- 0:00:43
400000 -- (-386.526) (-388.683) [-385.991] (-387.573) * (-384.943) (-389.561) (-386.646) [-385.665] -- 0:00:43
Average standard deviation of split frequencies: 0.013457
400500 -- (-386.992) (-384.981) [-390.188] (-387.402) * (-386.044) [-388.887] (-389.968) (-386.694) -- 0:00:43
401000 -- [-387.001] (-388.672) (-390.907) (-387.208) * (-386.038) (-387.304) [-386.570] (-389.786) -- 0:00:43
401500 -- (-385.629) [-386.284] (-391.124) (-388.634) * (-388.457) (-385.638) [-385.765] (-390.435) -- 0:00:43
402000 -- [-385.914] (-385.666) (-387.038) (-388.428) * [-389.421] (-385.456) (-388.683) (-387.773) -- 0:00:43
402500 -- (-385.382) (-386.861) (-387.987) [-385.801] * (-386.677) (-387.492) (-389.423) [-388.628] -- 0:00:43
403000 -- (-384.898) [-386.236] (-385.282) (-385.248) * [-387.595] (-389.983) (-387.755) (-389.410) -- 0:00:42
403500 -- (-386.254) [-389.282] (-388.830) (-385.396) * (-385.090) (-389.298) (-390.625) [-387.174] -- 0:00:44
404000 -- (-386.098) (-390.665) (-389.225) [-387.995] * (-385.350) (-385.620) (-386.411) [-385.862] -- 0:00:44
404500 -- (-385.896) (-392.916) [-386.690] (-388.350) * (-386.023) (-389.133) [-386.367] (-388.131) -- 0:00:44
405000 -- (-388.082) (-392.397) [-387.099] (-388.645) * (-386.021) (-388.768) [-385.850] (-386.360) -- 0:00:44
Average standard deviation of split frequencies: 0.014206
405500 -- (-388.782) [-387.848] (-387.511) (-386.496) * (-386.393) [-386.452] (-386.216) (-386.338) -- 0:00:43
406000 -- (-387.064) (-386.466) (-386.469) [-387.618] * (-387.017) (-387.341) [-386.808] (-388.774) -- 0:00:43
406500 -- (-389.063) [-385.901] (-387.900) (-390.525) * (-391.182) (-389.839) [-388.850] (-387.624) -- 0:00:43
407000 -- [-385.544] (-385.528) (-387.808) (-389.460) * (-389.227) (-388.036) (-388.459) [-385.671] -- 0:00:43
407500 -- (-386.346) (-385.167) [-386.605] (-392.636) * [-389.842] (-386.437) (-388.492) (-386.446) -- 0:00:43
408000 -- (-386.720) [-388.990] (-386.373) (-388.972) * (-386.991) (-388.855) [-386.752] (-389.056) -- 0:00:43
408500 -- (-388.925) (-389.995) (-386.190) [-385.453] * (-389.541) (-387.658) (-387.478) [-387.401] -- 0:00:43
409000 -- [-387.916] (-386.639) (-387.874) (-384.948) * [-388.135] (-388.303) (-388.522) (-387.769) -- 0:00:43
409500 -- (-388.762) (-385.529) (-385.977) [-388.712] * [-389.761] (-390.837) (-385.612) (-387.797) -- 0:00:43
410000 -- (-386.863) [-387.705] (-384.886) (-388.747) * (-387.646) [-390.813] (-386.937) (-388.156) -- 0:00:43
Average standard deviation of split frequencies: 0.014383
410500 -- (-390.862) (-388.115) [-386.165] (-386.541) * [-387.040] (-391.618) (-391.732) (-385.625) -- 0:00:43
411000 -- (-390.573) (-387.365) [-385.777] (-388.340) * [-386.119] (-385.688) (-391.980) (-388.256) -- 0:00:42
411500 -- (-387.857) (-386.650) [-384.954] (-386.811) * [-386.140] (-390.595) (-387.879) (-388.564) -- 0:00:42
412000 -- (-388.540) (-387.362) (-387.455) [-385.910] * (-385.386) (-386.237) [-393.205] (-388.598) -- 0:00:42
412500 -- (-386.141) (-386.654) (-390.608) [-386.926] * (-390.199) (-386.569) (-387.982) [-387.116] -- 0:00:42
413000 -- (-390.082) [-386.246] (-386.244) (-391.257) * (-386.459) (-386.591) [-386.084] (-386.915) -- 0:00:42
413500 -- [-387.700] (-387.329) (-385.936) (-387.373) * [-386.706] (-386.847) (-388.325) (-385.739) -- 0:00:42
414000 -- (-389.049) (-385.348) (-387.544) [-387.142] * [-386.020] (-385.230) (-387.008) (-387.051) -- 0:00:42
414500 -- [-387.139] (-386.192) (-388.165) (-385.938) * (-385.512) [-387.306] (-387.196) (-386.079) -- 0:00:42
415000 -- [-387.548] (-386.502) (-388.611) (-386.921) * [-386.299] (-385.511) (-386.273) (-388.613) -- 0:00:42
Average standard deviation of split frequencies: 0.013527
415500 -- (-386.105) [-386.414] (-386.611) (-391.607) * (-385.731) (-387.589) (-391.267) [-386.288] -- 0:00:42
416000 -- [-385.923] (-387.139) (-387.800) (-389.357) * [-387.652] (-384.999) (-390.899) (-387.157) -- 0:00:42
416500 -- (-385.889) (-387.478) [-388.784] (-387.566) * (-386.068) (-385.729) [-387.775] (-385.770) -- 0:00:42
417000 -- (-388.382) (-389.544) (-388.949) [-386.818] * (-389.336) [-390.222] (-387.731) (-386.560) -- 0:00:41
417500 -- (-389.073) (-392.089) (-385.704) [-386.467] * (-388.802) (-385.890) [-385.921] (-388.336) -- 0:00:41
418000 -- (-387.337) (-387.987) (-385.475) [-386.463] * [-384.922] (-387.668) (-389.636) (-385.656) -- 0:00:43
418500 -- (-386.799) (-388.543) [-387.224] (-387.680) * (-385.649) (-387.389) [-385.710] (-386.241) -- 0:00:43
419000 -- (-389.694) (-388.726) [-388.557] (-387.079) * [-385.288] (-389.181) (-385.535) (-393.172) -- 0:00:42
419500 -- (-386.467) (-385.505) [-388.213] (-387.865) * (-386.318) (-387.335) [-388.843] (-388.951) -- 0:00:42
420000 -- (-387.832) (-386.807) (-388.655) [-388.353] * (-386.356) (-390.128) [-389.098] (-386.644) -- 0:00:42
Average standard deviation of split frequencies: 0.014218
420500 -- (-388.407) [-387.224] (-389.037) (-386.948) * (-388.421) [-391.076] (-386.330) (-390.314) -- 0:00:42
421000 -- (-387.947) (-385.509) (-386.664) [-384.833] * [-391.996] (-387.568) (-386.782) (-388.535) -- 0:00:42
421500 -- (-388.358) (-388.413) [-385.623] (-386.230) * (-386.619) (-388.387) (-391.767) [-387.254] -- 0:00:42
422000 -- [-385.295] (-387.974) (-388.123) (-386.080) * (-385.820) (-389.300) (-389.834) [-385.899] -- 0:00:42
422500 -- (-387.434) (-385.744) [-388.208] (-385.196) * [-386.191] (-391.455) (-385.494) (-387.565) -- 0:00:42
423000 -- (-394.435) [-388.567] (-385.784) (-387.184) * (-388.204) (-391.056) [-388.189] (-389.276) -- 0:00:42
423500 -- (-387.971) [-385.143] (-385.249) (-389.989) * [-387.037] (-389.073) (-392.505) (-388.503) -- 0:00:42
424000 -- (-386.202) (-385.581) [-386.675] (-387.330) * (-387.581) (-386.611) (-391.114) [-386.517] -- 0:00:42
424500 -- [-386.554] (-389.278) (-386.620) (-388.174) * (-385.397) (-391.249) [-387.176] (-389.760) -- 0:00:42
425000 -- (-385.748) (-389.738) [-387.910] (-387.683) * [-385.804] (-388.561) (-385.120) (-384.870) -- 0:00:41
Average standard deviation of split frequencies: 0.015232
425500 -- (-385.376) (-386.547) (-385.890) [-386.115] * (-386.833) (-388.656) (-389.127) [-387.797] -- 0:00:41
426000 -- [-385.645] (-386.978) (-386.233) (-385.297) * [-388.390] (-387.447) (-386.011) (-389.688) -- 0:00:41
426500 -- (-386.638) (-389.627) (-388.654) [-386.213] * [-388.839] (-386.424) (-389.642) (-394.218) -- 0:00:41
427000 -- (-390.063) [-390.947] (-387.763) (-388.938) * (-385.760) (-387.641) (-385.589) [-385.621] -- 0:00:41
427500 -- (-387.791) [-387.586] (-385.747) (-389.344) * (-386.316) (-386.412) [-385.394] (-387.370) -- 0:00:41
428000 -- (-387.968) [-390.510] (-389.375) (-386.351) * (-386.003) (-389.438) [-385.548] (-386.442) -- 0:00:41
428500 -- [-385.660] (-389.794) (-385.360) (-388.318) * (-385.533) (-385.725) [-387.071] (-386.904) -- 0:00:41
429000 -- (-387.530) (-388.717) [-385.636] (-388.024) * (-387.349) (-387.747) (-387.510) [-385.302] -- 0:00:41
429500 -- (-385.869) (-387.888) [-388.154] (-386.203) * (-387.643) (-388.298) [-385.480] (-389.363) -- 0:00:41
430000 -- (-388.036) (-389.473) [-389.112] (-387.398) * (-389.630) [-386.201] (-386.604) (-385.743) -- 0:00:41
Average standard deviation of split frequencies: 0.015196
430500 -- (-387.266) (-384.967) (-386.363) [-388.442] * (-387.408) (-385.593) [-387.677] (-389.904) -- 0:00:41
431000 -- (-390.448) (-389.418) (-389.682) [-387.230] * (-387.858) (-390.137) (-392.122) [-387.277] -- 0:00:40
431500 -- [-386.270] (-385.507) (-386.594) (-387.513) * (-387.970) (-386.941) (-389.176) [-388.053] -- 0:00:40
432000 -- (-386.057) (-389.178) [-386.738] (-386.491) * (-386.634) (-387.582) (-389.579) [-387.954] -- 0:00:40
432500 -- (-387.619) [-390.729] (-387.763) (-391.345) * [-385.767] (-386.472) (-387.007) (-387.583) -- 0:00:41
433000 -- (-385.676) [-385.518] (-388.770) (-387.550) * (-387.577) (-388.943) [-384.783] (-386.466) -- 0:00:41
433500 -- [-386.034] (-389.575) (-387.605) (-394.282) * [-388.563] (-387.590) (-385.633) (-384.811) -- 0:00:41
434000 -- (-385.995) (-386.290) [-387.461] (-392.206) * (-387.098) [-386.879] (-387.314) (-389.605) -- 0:00:41
434500 -- (-385.324) (-387.338) [-385.516] (-388.548) * (-388.023) [-386.609] (-386.327) (-389.148) -- 0:00:41
435000 -- (-388.894) (-386.487) [-388.501] (-388.342) * (-386.470) (-385.630) [-389.960] (-390.176) -- 0:00:41
Average standard deviation of split frequencies: 0.014799
435500 -- (-392.129) [-389.178] (-385.249) (-392.503) * [-387.631] (-386.509) (-390.408) (-386.914) -- 0:00:41
436000 -- (-385.441) [-385.138] (-388.724) (-388.848) * [-385.507] (-385.595) (-388.350) (-386.644) -- 0:00:41
436500 -- (-386.387) (-385.792) [-387.148] (-386.934) * [-389.773] (-390.671) (-387.768) (-386.869) -- 0:00:41
437000 -- (-386.829) (-388.432) [-385.666] (-387.289) * (-386.817) (-386.692) (-387.995) [-385.152] -- 0:00:41
437500 -- (-385.341) (-388.933) [-387.385] (-387.217) * (-386.750) [-384.798] (-388.012) (-385.404) -- 0:00:41
438000 -- (-385.531) [-386.525] (-385.224) (-385.014) * (-386.557) (-386.093) (-387.185) [-385.635] -- 0:00:41
438500 -- (-387.408) (-387.311) [-385.856] (-386.575) * (-387.443) (-391.552) [-385.073] (-387.068) -- 0:00:40
439000 -- (-387.003) [-387.307] (-386.516) (-387.485) * (-385.773) (-387.319) (-392.451) [-388.135] -- 0:00:40
439500 -- (-386.335) (-392.833) [-386.848] (-386.158) * (-393.535) (-387.222) [-387.889] (-388.864) -- 0:00:40
440000 -- [-385.275] (-389.082) (-385.669) (-386.920) * (-390.682) [-389.622] (-385.498) (-390.553) -- 0:00:40
Average standard deviation of split frequencies: 0.015190
440500 -- (-385.906) [-386.620] (-389.938) (-387.786) * (-389.639) (-390.734) [-385.451] (-388.602) -- 0:00:40
441000 -- (-388.254) (-386.533) [-389.726] (-389.713) * [-389.097] (-387.342) (-388.783) (-390.044) -- 0:00:40
441500 -- [-386.237] (-388.343) (-389.308) (-387.396) * (-389.478) (-386.989) [-387.494] (-388.705) -- 0:00:40
442000 -- (-387.498) [-385.809] (-387.295) (-385.295) * (-386.415) [-386.107] (-387.678) (-387.799) -- 0:00:40
442500 -- (-387.193) (-386.562) [-386.954] (-385.663) * (-385.569) (-390.938) [-385.625] (-386.682) -- 0:00:40
443000 -- (-388.106) (-388.649) [-385.245] (-390.108) * (-386.446) (-387.637) (-386.470) [-386.293] -- 0:00:40
443500 -- (-386.445) (-386.150) [-386.830] (-387.655) * (-386.158) (-388.463) (-388.257) [-385.620] -- 0:00:40
444000 -- (-389.698) [-388.388] (-386.771) (-385.570) * [-385.692] (-386.803) (-387.507) (-386.327) -- 0:00:40
444500 -- (-387.335) [-386.419] (-388.248) (-390.020) * (-386.155) (-389.587) (-387.145) [-388.269] -- 0:00:39
445000 -- (-385.168) (-386.749) [-386.840] (-388.290) * [-386.636] (-386.890) (-385.942) (-386.803) -- 0:00:39
Average standard deviation of split frequencies: 0.015788
445500 -- (-385.078) (-388.282) [-386.963] (-385.954) * (-387.919) (-385.889) (-385.575) [-388.489] -- 0:00:39
446000 -- (-387.869) (-389.646) (-393.610) [-388.140] * (-386.687) [-385.415] (-388.283) (-388.789) -- 0:00:39
446500 -- (-387.574) (-385.956) (-388.836) [-385.443] * (-387.479) (-388.829) [-389.556] (-388.314) -- 0:00:40
447000 -- (-386.048) (-387.632) [-388.969] (-385.853) * [-387.383] (-387.449) (-386.128) (-387.578) -- 0:00:40
447500 -- [-388.275] (-386.518) (-386.046) (-388.150) * (-387.099) [-386.857] (-387.412) (-388.672) -- 0:00:40
448000 -- (-386.370) (-388.379) [-387.555] (-384.703) * (-387.867) (-386.345) [-386.777] (-389.737) -- 0:00:40
448500 -- [-389.640] (-389.276) (-385.727) (-385.988) * (-385.645) (-385.887) (-386.154) [-386.937] -- 0:00:40
449000 -- (-386.442) [-386.291] (-386.425) (-389.172) * [-388.938] (-386.212) (-392.534) (-391.146) -- 0:00:40
449500 -- (-388.089) (-386.642) (-392.332) [-387.981] * (-390.264) [-386.644] (-387.007) (-387.035) -- 0:00:40
450000 -- (-386.533) (-387.204) [-385.525] (-385.991) * [-387.471] (-386.931) (-387.685) (-385.294) -- 0:00:40
Average standard deviation of split frequencies: 0.015102
450500 -- [-385.778] (-385.546) (-385.833) (-386.034) * [-387.244] (-389.866) (-389.810) (-387.051) -- 0:00:40
451000 -- (-385.919) (-386.997) (-386.628) [-385.747] * (-387.841) [-385.877] (-389.149) (-387.184) -- 0:00:40
451500 -- (-386.920) (-387.965) (-386.500) [-385.926] * [-387.139] (-386.709) (-388.029) (-385.812) -- 0:00:40
452000 -- (-386.119) (-385.757) [-390.874] (-391.672) * (-387.273) (-387.723) [-385.371] (-386.327) -- 0:00:40
452500 -- (-385.519) (-385.289) (-387.332) [-384.950] * (-387.342) (-388.022) [-386.124] (-387.461) -- 0:00:39
453000 -- (-387.179) (-385.987) [-386.196] (-386.979) * (-389.029) [-388.087] (-386.527) (-387.856) -- 0:00:39
453500 -- (-387.153) [-386.732] (-385.287) (-387.465) * (-386.172) [-387.023] (-386.877) (-385.320) -- 0:00:39
454000 -- (-387.761) [-387.264] (-388.219) (-386.558) * (-387.141) (-387.589) (-385.858) [-385.616] -- 0:00:39
454500 -- [-388.575] (-387.598) (-386.720) (-391.005) * (-387.199) [-387.384] (-385.624) (-386.310) -- 0:00:39
455000 -- [-385.847] (-386.755) (-387.012) (-386.152) * (-387.961) (-387.510) [-387.766] (-385.705) -- 0:00:39
Average standard deviation of split frequencies: 0.015093
455500 -- [-385.466] (-388.660) (-387.951) (-392.368) * (-387.937) [-386.392] (-386.486) (-387.191) -- 0:00:39
456000 -- (-388.060) [-385.574] (-388.256) (-386.873) * (-385.730) [-385.332] (-386.832) (-393.638) -- 0:00:39
456500 -- (-388.590) (-389.715) [-389.049] (-392.260) * (-385.946) (-385.891) (-386.388) [-386.025] -- 0:00:39
457000 -- (-388.862) (-389.629) (-390.659) [-386.635] * (-386.615) (-387.397) [-386.992] (-386.552) -- 0:00:39
457500 -- [-385.970] (-388.293) (-389.908) (-389.384) * [-384.927] (-387.184) (-389.724) (-386.389) -- 0:00:39
458000 -- (-386.335) (-389.628) (-385.253) [-385.976] * (-388.280) (-385.867) [-387.021] (-386.403) -- 0:00:39
458500 -- (-391.013) (-390.124) (-389.266) [-385.835] * [-387.384] (-386.544) (-387.550) (-386.365) -- 0:00:38
459000 -- (-393.070) [-387.927] (-391.501) (-387.136) * (-388.233) (-386.420) (-386.169) [-386.664] -- 0:00:38
459500 -- (-393.859) [-388.561] (-389.084) (-387.570) * (-387.899) (-386.387) [-386.542] (-386.472) -- 0:00:39
460000 -- [-387.056] (-393.536) (-389.753) (-386.346) * [-387.887] (-387.289) (-385.366) (-384.793) -- 0:00:39
Average standard deviation of split frequencies: 0.016168
460500 -- [-391.477] (-391.535) (-386.704) (-386.532) * (-391.749) [-386.340] (-386.049) (-385.553) -- 0:00:39
461000 -- (-387.228) (-387.629) (-385.659) [-384.798] * (-391.757) (-390.263) [-385.049] (-385.710) -- 0:00:39
461500 -- (-386.455) (-387.551) (-388.488) [-385.919] * (-387.039) (-387.918) [-387.784] (-388.134) -- 0:00:39
462000 -- (-386.497) (-385.834) (-386.351) [-386.186] * (-388.998) (-386.344) [-386.887] (-386.941) -- 0:00:39
462500 -- [-386.811] (-387.150) (-385.055) (-386.382) * (-385.946) (-385.349) [-386.857] (-389.747) -- 0:00:39
463000 -- [-388.842] (-387.774) (-385.765) (-385.834) * [-386.782] (-385.811) (-388.818) (-386.490) -- 0:00:39
463500 -- (-386.333) (-387.397) (-390.604) [-385.574] * (-386.449) [-389.170] (-386.255) (-386.582) -- 0:00:39
464000 -- (-389.383) (-389.192) [-386.630] (-385.159) * (-385.597) (-385.604) [-386.138] (-386.372) -- 0:00:39
464500 -- (-386.007) (-386.674) [-385.463] (-387.031) * (-389.227) [-388.739] (-385.769) (-389.096) -- 0:00:39
465000 -- [-387.587] (-385.618) (-385.607) (-392.768) * (-388.662) (-388.571) [-385.614] (-386.338) -- 0:00:39
Average standard deviation of split frequencies: 0.014795
465500 -- [-385.506] (-390.929) (-385.680) (-387.529) * [-387.111] (-385.338) (-390.558) (-387.481) -- 0:00:39
466000 -- (-390.457) [-386.281] (-387.327) (-387.141) * (-388.980) [-384.967] (-389.174) (-385.678) -- 0:00:38
466500 -- (-386.610) (-386.170) (-387.070) [-385.588] * (-393.838) [-384.710] (-389.480) (-388.245) -- 0:00:38
467000 -- (-384.989) (-388.619) [-385.903] (-386.532) * (-396.380) (-391.884) [-388.260] (-388.698) -- 0:00:38
467500 -- (-386.908) (-388.492) [-389.782] (-387.427) * (-390.255) [-388.190] (-387.008) (-390.159) -- 0:00:38
468000 -- [-385.995] (-388.032) (-387.077) (-386.228) * (-390.387) (-390.336) [-388.162] (-390.593) -- 0:00:38
468500 -- (-386.357) [-386.912] (-388.193) (-387.755) * [-387.797] (-385.698) (-386.695) (-387.533) -- 0:00:38
469000 -- (-391.123) (-385.855) [-386.138] (-385.075) * (-388.223) (-387.490) [-391.500] (-387.760) -- 0:00:38
469500 -- (-386.285) (-387.630) [-386.239] (-387.811) * (-390.690) [-389.174] (-392.682) (-386.179) -- 0:00:38
470000 -- [-385.808] (-385.534) (-386.331) (-388.223) * (-390.393) (-388.305) (-386.159) [-386.953] -- 0:00:38
Average standard deviation of split frequencies: 0.014847
470500 -- (-388.872) [-385.890] (-387.181) (-387.082) * [-389.231] (-387.614) (-386.901) (-386.203) -- 0:00:38
471000 -- [-385.879] (-385.649) (-390.796) (-388.105) * (-385.971) [-386.463] (-386.127) (-386.016) -- 0:00:38
471500 -- (-393.879) [-385.986] (-388.568) (-388.653) * [-385.907] (-386.882) (-385.303) (-386.300) -- 0:00:38
472000 -- (-388.026) (-387.442) [-387.219] (-385.525) * (-387.687) (-386.622) (-387.488) [-389.301] -- 0:00:38
472500 -- [-393.825] (-386.021) (-387.519) (-386.814) * (-387.459) (-385.682) [-386.537] (-386.023) -- 0:00:37
473000 -- (-386.471) [-387.182] (-386.146) (-390.444) * [-385.471] (-385.394) (-386.754) (-385.913) -- 0:00:37
473500 -- (-386.486) (-388.050) (-390.441) [-385.218] * [-386.037] (-386.159) (-386.900) (-387.868) -- 0:00:37
474000 -- (-386.713) (-387.124) [-389.521] (-387.055) * (-387.623) [-388.997] (-387.376) (-387.800) -- 0:00:38
474500 -- (-386.559) (-390.235) (-386.246) [-388.826] * (-388.180) (-385.987) (-387.646) [-389.173] -- 0:00:38
475000 -- (-384.787) (-386.843) (-388.639) [-387.606] * (-386.840) (-385.601) (-387.642) [-387.281] -- 0:00:38
Average standard deviation of split frequencies: 0.013927
475500 -- (-387.390) [-386.865] (-388.232) (-388.915) * (-386.521) (-386.805) [-386.396] (-388.564) -- 0:00:38
476000 -- [-386.651] (-387.105) (-387.620) (-386.754) * [-386.994] (-386.920) (-387.793) (-386.462) -- 0:00:38
476500 -- [-385.987] (-393.381) (-388.695) (-387.373) * [-386.436] (-384.755) (-386.614) (-386.740) -- 0:00:38
477000 -- (-389.305) (-388.079) (-390.503) [-387.678] * (-385.691) (-387.208) [-386.944] (-387.417) -- 0:00:38
477500 -- [-387.754] (-389.404) (-387.186) (-387.292) * (-387.226) (-386.334) [-386.715] (-387.743) -- 0:00:38
478000 -- (-386.636) [-387.005] (-391.728) (-387.000) * (-386.712) [-387.387] (-388.715) (-386.574) -- 0:00:38
478500 -- (-387.699) (-387.313) (-388.153) [-385.418] * (-387.278) [-389.808] (-393.642) (-390.705) -- 0:00:38
479000 -- (-386.555) (-387.737) [-385.808] (-386.391) * (-385.239) [-387.000] (-388.411) (-389.077) -- 0:00:38
479500 -- (-386.939) [-386.443] (-387.165) (-386.949) * [-388.962] (-386.006) (-387.465) (-385.223) -- 0:00:37
480000 -- [-385.966] (-385.319) (-387.581) (-388.175) * (-385.962) (-389.140) (-389.295) [-388.302] -- 0:00:37
Average standard deviation of split frequencies: 0.013975
480500 -- (-387.070) (-385.397) (-387.205) [-388.347] * (-385.300) (-386.268) [-386.590] (-385.349) -- 0:00:37
481000 -- (-386.547) [-387.441] (-389.410) (-387.506) * (-385.892) (-385.619) [-385.643] (-385.609) -- 0:00:37
481500 -- (-391.140) (-389.419) [-388.977] (-386.029) * [-389.061] (-389.402) (-391.502) (-388.699) -- 0:00:37
482000 -- (-387.337) (-386.696) [-389.528] (-390.105) * (-386.471) (-388.500) [-385.996] (-390.371) -- 0:00:37
482500 -- (-387.091) [-387.762] (-387.911) (-390.014) * (-387.511) [-388.951] (-387.627) (-386.447) -- 0:00:37
483000 -- [-389.816] (-386.186) (-389.829) (-385.574) * (-388.138) [-388.337] (-385.872) (-386.350) -- 0:00:37
483500 -- [-387.388] (-388.591) (-387.484) (-384.814) * (-387.622) (-391.798) [-388.870] (-386.719) -- 0:00:37
484000 -- (-388.802) [-388.208] (-386.664) (-387.433) * (-386.322) (-393.099) (-389.561) [-386.411] -- 0:00:37
484500 -- [-387.636] (-385.800) (-390.855) (-389.503) * (-385.195) (-393.450) [-387.446] (-386.360) -- 0:00:37
485000 -- (-388.770) [-388.679] (-389.311) (-387.614) * (-385.447) (-386.597) [-386.276] (-389.190) -- 0:00:37
Average standard deviation of split frequencies: 0.014435
485500 -- (-389.011) (-387.281) (-385.681) [-387.312] * [-388.233] (-385.915) (-388.416) (-390.468) -- 0:00:37
486000 -- (-397.277) [-386.161] (-387.284) (-388.229) * [-386.440] (-388.668) (-386.071) (-387.375) -- 0:00:37
486500 -- (-389.271) (-389.633) (-385.736) [-385.631] * (-387.443) [-385.764] (-385.660) (-387.302) -- 0:00:36
487000 -- (-389.273) (-387.644) (-390.085) [-386.061] * [-395.203] (-387.101) (-387.885) (-386.220) -- 0:00:36
487500 -- (-385.270) [-385.290] (-388.841) (-389.637) * (-385.585) [-385.790] (-387.744) (-388.123) -- 0:00:37
488000 -- (-385.318) (-387.388) (-387.782) [-385.383] * [-385.410] (-386.207) (-388.717) (-388.800) -- 0:00:37
488500 -- (-387.531) (-385.818) (-386.116) [-388.038] * (-386.337) (-387.282) (-389.175) [-385.377] -- 0:00:37
489000 -- (-385.281) (-386.191) (-385.822) [-386.188] * (-387.129) [-388.231] (-385.939) (-386.784) -- 0:00:37
489500 -- (-388.249) (-386.245) [-384.757] (-390.352) * (-385.608) (-389.828) [-385.707] (-385.891) -- 0:00:37
490000 -- (-387.824) [-386.147] (-385.276) (-386.507) * (-388.678) [-386.198] (-389.402) (-389.272) -- 0:00:37
Average standard deviation of split frequencies: 0.014242
490500 -- [-387.341] (-386.475) (-386.360) (-388.643) * (-387.075) [-385.719] (-389.240) (-385.975) -- 0:00:37
491000 -- (-388.223) [-387.126] (-385.633) (-386.474) * (-390.984) (-385.948) [-387.005] (-386.107) -- 0:00:37
491500 -- (-387.883) (-385.514) (-388.428) [-386.951] * (-387.532) (-387.433) (-386.837) [-387.308] -- 0:00:37
492000 -- [-388.759] (-385.713) (-387.943) (-389.085) * (-385.782) (-389.384) (-388.278) [-386.109] -- 0:00:37
492500 -- [-390.418] (-394.922) (-386.891) (-388.029) * (-391.148) (-388.258) (-388.862) [-386.282] -- 0:00:37
493000 -- (-394.065) (-394.933) (-387.530) [-386.942] * (-386.992) (-386.127) (-386.575) [-389.836] -- 0:00:37
493500 -- [-386.524] (-387.669) (-386.004) (-385.359) * [-386.296] (-387.622) (-388.557) (-387.034) -- 0:00:36
494000 -- (-389.034) (-388.673) (-390.168) [-388.533] * (-384.987) [-389.069] (-385.971) (-389.828) -- 0:00:36
494500 -- [-385.106] (-387.224) (-388.208) (-387.866) * [-388.231] (-393.191) (-385.466) (-386.095) -- 0:00:36
495000 -- (-386.333) [-388.108] (-392.692) (-387.207) * (-387.539) [-389.296] (-386.939) (-386.452) -- 0:00:36
Average standard deviation of split frequencies: 0.013865
495500 -- (-386.943) [-386.316] (-395.570) (-388.222) * (-385.740) (-390.426) [-386.638] (-385.632) -- 0:00:36
496000 -- [-387.309] (-389.447) (-392.243) (-388.951) * (-386.501) [-386.726] (-390.593) (-386.115) -- 0:00:36
496500 -- (-385.838) (-389.186) (-391.041) [-387.530] * [-389.124] (-389.249) (-385.014) (-390.165) -- 0:00:36
497000 -- (-385.921) (-388.622) (-388.082) [-387.469] * (-386.775) [-385.888] (-386.121) (-388.257) -- 0:00:36
497500 -- (-385.138) [-389.709] (-387.197) (-385.104) * (-385.600) [-386.146] (-388.089) (-385.276) -- 0:00:36
498000 -- (-385.843) (-386.569) (-385.287) [-389.563] * [-385.200] (-385.240) (-388.611) (-386.411) -- 0:00:36
498500 -- (-392.459) (-386.863) [-385.980] (-386.028) * (-388.273) (-390.194) (-385.943) [-385.551] -- 0:00:36
499000 -- (-390.021) [-387.362] (-389.973) (-385.189) * [-385.689] (-386.722) (-389.257) (-389.938) -- 0:00:36
499500 -- (-386.206) (-387.854) (-388.014) [-386.405] * [-386.205] (-388.555) (-386.385) (-387.842) -- 0:00:36
500000 -- [-385.426] (-387.975) (-389.467) (-386.347) * (-385.668) [-387.659] (-385.663) (-386.726) -- 0:00:36
Average standard deviation of split frequencies: 0.013902
500500 -- [-385.546] (-389.953) (-388.162) (-387.034) * (-386.049) [-385.346] (-385.256) (-386.462) -- 0:00:35
501000 -- (-385.094) [-393.977] (-385.946) (-388.304) * [-388.222] (-387.697) (-386.059) (-386.984) -- 0:00:35
501500 -- (-389.434) (-388.421) (-386.332) [-388.702] * [-388.302] (-386.554) (-387.382) (-384.992) -- 0:00:36
502000 -- (-385.278) (-386.998) (-387.899) [-388.809] * (-387.304) (-385.907) (-387.380) [-385.138] -- 0:00:36
502500 -- [-385.569] (-386.242) (-388.013) (-385.114) * (-387.661) [-385.707] (-386.604) (-385.872) -- 0:00:36
503000 -- (-389.168) (-388.479) (-386.905) [-386.359] * [-388.948] (-385.008) (-386.985) (-388.856) -- 0:00:36
503500 -- (-389.178) (-387.963) [-387.761] (-389.106) * (-388.212) [-388.170] (-387.169) (-385.861) -- 0:00:36
504000 -- (-385.118) [-385.484] (-388.792) (-385.671) * (-386.576) (-388.126) (-391.377) [-385.683] -- 0:00:36
504500 -- [-386.607] (-386.979) (-387.660) (-385.070) * [-388.664] (-389.745) (-389.778) (-386.542) -- 0:00:36
505000 -- (-386.568) [-388.026] (-387.532) (-385.207) * (-388.147) (-387.903) (-388.487) [-389.749] -- 0:00:36
Average standard deviation of split frequencies: 0.013646
505500 -- (-392.051) [-385.955] (-388.337) (-385.339) * (-388.086) [-386.383] (-386.585) (-386.220) -- 0:00:36
506000 -- [-386.866] (-387.799) (-394.364) (-385.378) * (-387.293) [-389.024] (-387.083) (-387.401) -- 0:00:36
506500 -- [-386.460] (-387.193) (-385.359) (-385.179) * (-387.927) (-384.710) [-385.938] (-388.133) -- 0:00:36
507000 -- [-385.825] (-387.632) (-388.748) (-385.145) * (-386.788) (-387.501) [-386.493] (-386.972) -- 0:00:35
507500 -- (-390.485) (-386.514) (-394.904) [-386.794] * (-386.123) (-385.930) (-390.576) [-387.842] -- 0:00:35
508000 -- (-386.347) (-390.477) [-392.836] (-387.961) * (-386.469) [-385.860] (-387.812) (-386.729) -- 0:00:35
508500 -- (-387.154) [-389.981] (-386.009) (-386.782) * (-385.181) [-387.147] (-391.191) (-389.189) -- 0:00:35
509000 -- (-388.705) [-386.648] (-386.224) (-390.639) * (-388.115) [-388.062] (-387.380) (-386.741) -- 0:00:35
509500 -- [-389.323] (-388.225) (-385.514) (-386.534) * (-388.399) (-393.423) [-388.884] (-386.703) -- 0:00:35
510000 -- (-386.103) (-386.520) [-388.115] (-386.114) * (-385.663) (-390.264) (-386.821) [-390.023] -- 0:00:35
Average standard deviation of split frequencies: 0.013693
510500 -- (-386.027) (-386.990) (-387.732) [-388.304] * (-385.944) (-387.481) (-388.054) [-386.165] -- 0:00:35
511000 -- (-386.375) (-386.153) [-385.882] (-386.377) * (-388.154) (-387.699) [-385.213] (-385.692) -- 0:00:35
511500 -- (-385.858) (-388.328) [-386.461] (-387.977) * (-389.690) [-387.213] (-386.048) (-385.636) -- 0:00:35
512000 -- [-384.776] (-388.547) (-387.540) (-387.803) * (-387.692) (-385.992) (-386.367) [-388.275] -- 0:00:35
512500 -- (-386.573) (-388.892) [-388.058] (-388.457) * (-386.005) (-391.604) (-387.097) [-391.511] -- 0:00:35
513000 -- [-386.342] (-385.306) (-387.245) (-388.024) * [-385.316] (-387.700) (-385.976) (-386.200) -- 0:00:35
513500 -- (-386.799) [-391.957] (-387.368) (-387.990) * [-388.032] (-386.786) (-385.911) (-387.333) -- 0:00:35
514000 -- (-386.101) (-385.134) [-385.964] (-390.422) * (-387.227) [-385.197] (-389.459) (-388.611) -- 0:00:34
514500 -- [-386.277] (-385.136) (-386.375) (-391.356) * (-386.262) [-386.067] (-389.044) (-386.668) -- 0:00:34
515000 -- [-385.233] (-388.576) (-392.967) (-393.325) * (-391.417) (-387.925) [-388.335] (-386.127) -- 0:00:35
Average standard deviation of split frequencies: 0.013489
515500 -- (-387.046) [-388.607] (-389.932) (-394.183) * (-388.645) (-385.527) [-385.987] (-388.186) -- 0:00:35
516000 -- [-388.805] (-386.516) (-385.870) (-393.380) * (-388.220) (-385.586) (-387.301) [-390.284] -- 0:00:35
516500 -- (-385.025) (-386.479) (-387.967) [-386.871] * (-387.160) (-386.805) [-386.671] (-386.721) -- 0:00:35
517000 -- [-387.569] (-385.832) (-385.900) (-389.240) * (-392.248) (-386.786) (-385.525) [-385.614] -- 0:00:35
517500 -- (-389.346) [-392.482] (-388.743) (-385.683) * (-385.914) (-385.198) [-387.951] (-386.682) -- 0:00:35
518000 -- (-386.187) (-391.980) [-386.406] (-387.294) * (-386.354) [-385.282] (-388.547) (-387.114) -- 0:00:35
518500 -- (-388.964) [-388.623] (-384.871) (-385.534) * (-388.925) (-390.940) [-389.117] (-389.443) -- 0:00:35
519000 -- (-387.876) (-386.746) [-385.264] (-387.013) * (-386.215) (-391.660) [-385.114] (-385.419) -- 0:00:35
519500 -- (-386.231) (-389.276) (-385.533) [-386.473] * [-387.839] (-391.164) (-394.043) (-385.049) -- 0:00:35
520000 -- [-386.088] (-386.413) (-386.360) (-387.410) * (-388.436) [-389.605] (-394.245) (-385.718) -- 0:00:35
Average standard deviation of split frequencies: 0.013208
520500 -- (-385.198) (-388.061) [-385.740] (-387.703) * (-389.389) (-386.164) [-387.265] (-385.807) -- 0:00:35
521000 -- (-387.519) (-388.106) (-385.681) [-386.224] * (-388.506) [-386.845] (-390.279) (-385.526) -- 0:00:34
521500 -- (-386.112) [-386.666] (-390.432) (-388.037) * (-392.985) [-389.237] (-387.581) (-388.696) -- 0:00:34
522000 -- (-388.303) (-386.874) [-387.253] (-386.064) * (-386.759) (-385.831) [-386.176] (-385.405) -- 0:00:34
522500 -- (-387.925) [-387.747] (-389.438) (-388.689) * [-389.819] (-387.615) (-385.553) (-385.293) -- 0:00:34
523000 -- [-385.532] (-386.441) (-388.249) (-385.070) * (-385.760) (-385.811) [-386.044] (-387.384) -- 0:00:34
523500 -- (-386.188) (-387.692) (-388.957) [-388.183] * (-390.947) (-386.850) (-386.265) [-385.976] -- 0:00:34
524000 -- (-392.315) [-388.474] (-387.055) (-388.928) * (-389.304) (-388.816) (-388.237) [-387.647] -- 0:00:34
524500 -- (-390.763) [-388.545] (-386.240) (-384.985) * (-386.265) (-386.488) [-391.491] (-386.485) -- 0:00:34
525000 -- (-387.606) (-386.790) [-385.782] (-385.260) * [-385.501] (-388.485) (-386.648) (-388.417) -- 0:00:34
Average standard deviation of split frequencies: 0.013390
525500 -- (-388.105) (-388.140) [-385.783] (-390.744) * [-387.030] (-389.937) (-386.793) (-387.257) -- 0:00:34
526000 -- (-386.124) (-387.713) [-386.183] (-391.049) * [-387.154] (-386.917) (-386.125) (-387.736) -- 0:00:34
526500 -- (-386.612) (-385.965) [-385.355] (-389.836) * (-385.975) [-387.197] (-386.568) (-387.057) -- 0:00:34
527000 -- (-386.336) (-388.094) [-384.962] (-386.247) * (-390.672) (-387.048) [-385.780] (-385.789) -- 0:00:34
527500 -- (-386.990) (-395.517) [-386.630] (-386.400) * (-387.934) [-386.036] (-386.463) (-386.170) -- 0:00:34
528000 -- (-385.453) (-390.326) [-386.352] (-387.740) * (-394.268) (-384.961) (-389.657) [-387.680] -- 0:00:33
528500 -- (-386.041) [-388.409] (-389.029) (-390.078) * (-391.323) (-386.579) (-387.276) [-389.512] -- 0:00:33
529000 -- (-386.119) [-386.926] (-388.374) (-386.992) * (-387.330) (-384.933) (-392.373) [-389.723] -- 0:00:34
529500 -- (-385.916) (-387.827) (-389.870) [-385.713] * (-387.717) (-388.248) [-386.307] (-386.459) -- 0:00:34
530000 -- (-387.965) [-390.945] (-385.596) (-391.719) * [-386.383] (-386.393) (-387.049) (-387.583) -- 0:00:34
Average standard deviation of split frequencies: 0.013638
530500 -- (-387.396) (-387.807) (-388.671) [-386.050] * (-386.722) (-389.118) [-385.862] (-388.560) -- 0:00:34
531000 -- (-390.292) [-388.427] (-385.104) (-385.827) * (-387.018) [-387.950] (-388.388) (-386.276) -- 0:00:34
531500 -- (-389.430) (-385.875) [-386.875] (-386.596) * [-386.729] (-389.986) (-387.590) (-385.996) -- 0:00:34
532000 -- [-390.258] (-392.356) (-386.111) (-387.848) * [-387.979] (-389.948) (-387.307) (-386.186) -- 0:00:34
532500 -- (-387.979) (-386.440) [-385.639] (-385.909) * (-386.143) (-384.940) [-387.920] (-387.558) -- 0:00:34
533000 -- [-388.294] (-388.259) (-385.963) (-388.951) * (-391.339) (-384.931) (-389.327) [-384.923] -- 0:00:34
533500 -- [-386.308] (-388.383) (-387.477) (-386.288) * (-386.991) [-385.134] (-387.934) (-386.726) -- 0:00:34
534000 -- (-387.162) (-389.101) (-386.505) [-387.147] * (-393.104) [-386.831] (-392.379) (-385.689) -- 0:00:34
534500 -- (-386.999) [-386.068] (-388.110) (-388.333) * (-385.175) (-390.349) (-386.721) [-386.348] -- 0:00:33
535000 -- (-385.580) [-386.069] (-388.641) (-386.104) * (-385.518) (-388.343) (-390.114) [-385.501] -- 0:00:33
Average standard deviation of split frequencies: 0.013503
535500 -- (-390.785) (-387.369) (-389.141) [-388.599] * (-386.019) [-386.539] (-384.732) (-387.699) -- 0:00:33
536000 -- (-389.235) (-385.713) [-387.926] (-389.582) * (-391.020) (-389.943) [-389.429] (-386.554) -- 0:00:33
536500 -- (-386.156) (-388.600) [-387.659] (-388.631) * (-389.234) (-386.807) (-390.405) [-390.832] -- 0:00:33
537000 -- [-386.484] (-386.686) (-386.044) (-386.478) * (-385.264) [-387.857] (-386.122) (-386.915) -- 0:00:33
537500 -- [-389.019] (-386.084) (-385.819) (-387.818) * (-386.288) (-385.381) (-386.468) [-389.628] -- 0:00:33
538000 -- (-387.848) (-391.344) (-386.228) [-387.038] * (-386.413) [-387.443] (-385.678) (-388.676) -- 0:00:33
538500 -- (-389.251) (-389.527) [-388.565] (-387.544) * (-385.130) [-385.979] (-388.674) (-386.330) -- 0:00:33
539000 -- [-386.637] (-386.294) (-389.263) (-388.518) * (-386.719) (-385.139) (-388.388) [-389.334] -- 0:00:33
539500 -- (-385.647) [-386.343] (-390.770) (-386.256) * (-385.534) (-386.942) (-386.677) [-387.668] -- 0:00:33
540000 -- (-388.974) (-385.192) [-385.981] (-387.090) * (-385.255) (-386.757) [-385.777] (-385.596) -- 0:00:33
Average standard deviation of split frequencies: 0.013899
540500 -- (-385.164) [-389.191] (-388.184) (-387.750) * (-387.327) (-388.218) (-388.593) [-388.838] -- 0:00:33
541000 -- [-386.621] (-387.094) (-386.520) (-386.999) * (-390.814) [-391.478] (-388.816) (-387.956) -- 0:00:33
541500 -- (-386.837) (-384.969) [-387.151] (-388.240) * (-387.959) (-392.312) (-387.317) [-386.423] -- 0:00:33
542000 -- [-387.591] (-388.121) (-387.103) (-387.490) * (-386.455) (-387.587) [-387.245] (-385.499) -- 0:00:32
542500 -- [-388.204] (-385.782) (-385.636) (-387.969) * [-388.479] (-386.150) (-388.921) (-389.241) -- 0:00:32
543000 -- (-388.215) (-389.059) [-387.181] (-386.884) * (-389.603) (-387.195) [-387.533] (-389.897) -- 0:00:33
543500 -- (-388.225) (-384.908) (-384.916) [-388.825] * (-388.410) [-386.733] (-390.246) (-387.741) -- 0:00:33
544000 -- (-387.522) [-386.260] (-387.921) (-385.457) * [-385.801] (-385.954) (-388.425) (-388.883) -- 0:00:33
544500 -- (-386.865) [-384.964] (-387.282) (-386.090) * (-387.167) [-387.194] (-386.828) (-387.341) -- 0:00:33
545000 -- (-389.311) (-387.179) (-385.674) [-385.593] * (-385.231) (-388.546) [-387.618] (-386.366) -- 0:00:33
Average standard deviation of split frequencies: 0.013763
545500 -- (-390.304) (-389.407) (-386.155) [-388.545] * (-389.533) (-385.489) (-386.970) [-390.025] -- 0:00:33
546000 -- (-386.318) [-388.772] (-386.710) (-387.000) * (-387.214) (-388.067) [-385.281] (-387.147) -- 0:00:33
546500 -- (-386.794) [-384.601] (-387.255) (-389.227) * (-391.195) (-388.987) (-387.463) [-386.930] -- 0:00:33
547000 -- [-387.057] (-388.128) (-386.194) (-386.184) * (-389.423) (-387.057) [-385.818] (-386.819) -- 0:00:33
547500 -- (-385.233) (-386.863) [-386.381] (-387.143) * (-388.566) (-385.411) (-386.173) [-386.482] -- 0:00:33
548000 -- (-385.359) (-387.463) (-389.458) [-388.202] * [-385.247] (-389.136) (-388.083) (-386.087) -- 0:00:32
548500 -- (-386.453) (-388.597) (-386.451) [-385.658] * (-387.344) (-391.395) [-386.998] (-386.036) -- 0:00:32
549000 -- (-385.202) (-392.778) [-385.697] (-386.551) * (-387.756) (-385.068) [-386.054] (-386.113) -- 0:00:32
549500 -- [-385.436] (-388.302) (-389.292) (-386.656) * (-386.821) (-385.426) (-385.514) [-386.659] -- 0:00:32
550000 -- [-388.166] (-389.476) (-387.118) (-386.820) * [-386.057] (-389.670) (-385.087) (-386.801) -- 0:00:32
Average standard deviation of split frequencies: 0.013143
550500 -- [-385.646] (-387.729) (-388.129) (-387.002) * (-385.274) (-389.334) [-384.986] (-386.949) -- 0:00:32
551000 -- [-385.766] (-386.286) (-391.080) (-388.460) * [-385.379] (-388.116) (-387.233) (-387.874) -- 0:00:32
551500 -- [-386.391] (-385.284) (-389.957) (-386.158) * (-385.566) (-386.638) [-385.920] (-386.449) -- 0:00:32
552000 -- (-388.976) [-385.409] (-385.072) (-386.494) * (-386.723) [-385.842] (-388.068) (-385.568) -- 0:00:32
552500 -- (-388.921) [-386.365] (-386.141) (-386.723) * (-388.658) (-393.073) (-386.174) [-385.064] -- 0:00:32
553000 -- [-386.420] (-388.052) (-395.922) (-388.095) * (-388.801) (-388.081) (-386.406) [-387.685] -- 0:00:32
553500 -- [-387.417] (-387.648) (-390.093) (-387.146) * (-386.517) (-386.796) (-390.109) [-388.562] -- 0:00:32
554000 -- [-387.544] (-387.629) (-386.777) (-385.518) * (-388.480) (-386.334) [-385.886] (-387.730) -- 0:00:32
554500 -- (-387.142) (-387.534) (-386.591) [-386.335] * (-387.761) (-389.967) (-386.343) [-385.561] -- 0:00:32
555000 -- (-386.988) (-387.463) [-391.462] (-386.347) * (-385.961) (-390.482) (-386.180) [-385.977] -- 0:00:32
Average standard deviation of split frequencies: 0.012568
555500 -- (-387.670) (-388.602) [-387.100] (-386.812) * [-388.650] (-389.030) (-390.539) (-385.409) -- 0:00:32
556000 -- (-388.811) (-391.512) [-386.079] (-385.760) * (-386.279) (-387.710) [-388.055] (-390.699) -- 0:00:31
556500 -- (-390.682) (-386.767) [-386.903] (-389.807) * (-386.527) (-386.401) (-387.232) [-386.186] -- 0:00:32
557000 -- (-387.019) (-386.242) [-386.125] (-390.285) * (-385.431) (-390.471) [-387.468] (-386.311) -- 0:00:32
557500 -- (-386.664) (-385.346) [-385.246] (-386.701) * [-387.828] (-385.922) (-386.188) (-386.826) -- 0:00:32
558000 -- [-386.184] (-384.702) (-386.376) (-386.108) * (-390.260) (-386.967) [-387.836] (-385.772) -- 0:00:32
558500 -- (-387.295) [-385.413] (-386.841) (-388.979) * (-388.609) (-388.103) (-388.451) [-393.511] -- 0:00:32
559000 -- [-386.069] (-386.103) (-387.790) (-386.767) * [-389.544] (-386.676) (-386.918) (-391.163) -- 0:00:32
559500 -- (-389.443) (-388.394) [-386.410] (-388.116) * [-386.741] (-388.995) (-387.549) (-388.616) -- 0:00:32
560000 -- [-389.914] (-390.030) (-389.110) (-386.273) * (-385.924) (-386.019) [-385.431] (-387.219) -- 0:00:32
Average standard deviation of split frequencies: 0.012661
560500 -- (-387.282) (-385.769) (-394.846) [-386.560] * (-386.496) (-387.536) (-388.137) [-386.608] -- 0:00:32
561000 -- (-388.141) [-386.786] (-386.078) (-388.848) * (-386.678) (-387.142) [-387.876] (-387.039) -- 0:00:32
561500 -- (-386.522) (-385.223) [-386.960] (-391.757) * [-388.025] (-385.951) (-386.797) (-388.228) -- 0:00:32
562000 -- (-389.601) [-385.498] (-387.554) (-390.469) * (-385.610) [-385.552] (-389.884) (-386.946) -- 0:00:31
562500 -- (-392.107) (-388.097) (-385.957) [-385.869] * (-385.951) [-385.220] (-385.385) (-389.563) -- 0:00:31
563000 -- (-385.265) (-385.618) (-386.737) [-385.635] * (-392.255) (-387.126) [-385.087] (-385.391) -- 0:00:31
563500 -- (-386.391) (-389.019) [-386.099] (-386.011) * (-386.669) (-386.424) (-384.877) [-385.405] -- 0:00:31
564000 -- [-388.912] (-385.583) (-385.761) (-385.607) * (-386.998) [-386.466] (-386.060) (-386.242) -- 0:00:31
564500 -- (-387.533) (-388.118) (-385.786) [-387.120] * (-387.260) [-389.882] (-385.978) (-386.718) -- 0:00:31
565000 -- (-388.167) (-385.366) (-385.522) [-385.363] * [-389.042] (-385.761) (-385.985) (-385.374) -- 0:00:31
Average standard deviation of split frequencies: 0.012738
565500 -- (-391.112) [-384.945] (-386.419) (-386.035) * [-385.740] (-387.788) (-389.886) (-387.702) -- 0:00:31
566000 -- (-385.958) [-387.405] (-388.499) (-386.772) * (-386.315) [-386.927] (-387.670) (-386.218) -- 0:00:31
566500 -- [-387.375] (-385.797) (-388.896) (-389.002) * [-387.538] (-386.194) (-387.155) (-385.325) -- 0:00:31
567000 -- (-389.277) (-385.723) (-385.546) [-385.474] * (-386.822) (-386.728) [-384.883] (-386.760) -- 0:00:31
567500 -- (-386.415) (-386.064) (-389.565) [-386.537] * (-386.100) (-386.448) (-390.256) [-387.129] -- 0:00:31
568000 -- (-389.052) (-386.276) [-388.170] (-385.224) * (-385.839) (-388.911) (-395.316) [-386.960] -- 0:00:31
568500 -- (-387.525) [-388.196] (-388.019) (-386.975) * (-384.932) (-387.151) [-388.157] (-388.704) -- 0:00:31
569000 -- (-387.045) [-385.681] (-385.934) (-390.039) * [-385.492] (-386.889) (-389.243) (-387.404) -- 0:00:31
569500 -- (-388.510) [-386.026] (-387.017) (-385.608) * (-387.591) (-385.292) [-386.761] (-389.194) -- 0:00:30
570000 -- [-388.225] (-385.519) (-386.427) (-387.155) * (-387.469) [-385.196] (-390.644) (-391.384) -- 0:00:30
Average standard deviation of split frequencies: 0.012245
570500 -- (-388.079) [-389.590] (-388.763) (-385.736) * (-385.970) [-386.711] (-385.717) (-390.715) -- 0:00:31
571000 -- [-386.744] (-388.739) (-386.883) (-384.910) * (-389.564) [-385.919] (-384.851) (-385.240) -- 0:00:31
571500 -- (-385.643) [-387.626] (-387.642) (-385.083) * [-389.112] (-385.543) (-388.142) (-387.375) -- 0:00:31
572000 -- (-384.974) (-387.092) (-387.154) [-387.021] * (-385.372) (-389.167) (-385.811) [-385.735] -- 0:00:31
572500 -- (-385.976) (-392.417) (-386.039) [-386.272] * (-386.138) (-388.342) [-386.832] (-387.166) -- 0:00:31
573000 -- (-385.441) [-388.933] (-387.307) (-387.525) * (-386.686) (-387.355) [-387.876] (-385.887) -- 0:00:31
573500 -- (-389.588) [-387.346] (-385.835) (-385.781) * [-388.757] (-389.710) (-385.902) (-388.247) -- 0:00:31
574000 -- (-385.070) (-386.852) [-385.478] (-386.060) * [-388.822] (-385.183) (-385.414) (-386.726) -- 0:00:31
574500 -- [-386.370] (-390.507) (-390.968) (-391.419) * (-391.362) (-386.775) (-386.293) [-387.162] -- 0:00:31
575000 -- (-388.082) (-385.306) (-384.873) [-386.132] * (-389.054) (-390.879) (-386.189) [-387.045] -- 0:00:31
Average standard deviation of split frequencies: 0.011939
575500 -- (-385.085) [-386.458] (-388.288) (-386.451) * (-388.963) [-385.218] (-387.703) (-389.304) -- 0:00:30
576000 -- (-387.013) (-390.529) (-388.858) [-387.463] * (-387.806) [-385.083] (-386.850) (-385.795) -- 0:00:30
576500 -- (-386.286) (-389.287) (-385.988) [-385.776] * (-385.721) (-385.980) (-386.924) [-385.502] -- 0:00:30
577000 -- [-385.111] (-386.627) (-390.170) (-389.203) * (-390.042) (-386.053) [-388.954] (-386.479) -- 0:00:30
577500 -- (-387.118) (-386.161) [-392.408] (-387.064) * (-385.745) [-387.454] (-385.235) (-384.650) -- 0:00:30
578000 -- [-385.889] (-390.644) (-389.762) (-391.330) * (-386.761) [-388.375] (-387.336) (-387.012) -- 0:00:30
578500 -- (-388.526) (-386.444) (-386.557) [-388.315] * (-388.077) [-386.500] (-386.649) (-391.674) -- 0:00:30
579000 -- (-391.660) (-387.302) [-385.114] (-386.871) * (-386.380) (-389.422) (-385.525) [-386.493] -- 0:00:30
579500 -- (-388.322) (-389.412) (-387.565) [-389.046] * (-387.326) (-387.798) [-387.341] (-386.969) -- 0:00:30
580000 -- (-394.360) (-385.554) [-385.432] (-389.152) * (-387.130) (-385.353) (-386.802) [-385.892] -- 0:00:30
Average standard deviation of split frequencies: 0.012273
580500 -- (-385.390) [-385.076] (-387.081) (-385.466) * (-386.157) (-386.881) [-387.914] (-385.877) -- 0:00:30
581000 -- [-385.832] (-386.950) (-385.141) (-385.406) * (-385.860) (-388.304) [-388.081] (-385.259) -- 0:00:30
581500 -- (-384.884) (-388.670) (-387.953) [-384.965] * [-386.086] (-389.209) (-392.220) (-385.597) -- 0:00:30
582000 -- [-385.760] (-388.702) (-388.822) (-386.143) * [-389.551] (-389.184) (-386.467) (-388.720) -- 0:00:30
582500 -- (-388.443) (-386.956) (-389.297) [-386.740] * (-388.205) (-389.197) (-386.271) [-384.868] -- 0:00:30
583000 -- (-386.919) (-386.989) [-387.530] (-386.719) * (-389.037) (-391.510) (-386.955) [-386.555] -- 0:00:30
583500 -- [-385.358] (-385.515) (-389.113) (-386.550) * (-388.682) (-389.566) (-388.787) [-389.839] -- 0:00:29
584000 -- (-389.541) (-388.562) (-390.998) [-387.216] * (-387.582) (-388.820) (-387.891) [-388.179] -- 0:00:29
584500 -- (-390.696) (-390.622) [-388.900] (-391.278) * (-386.497) (-390.033) (-386.530) [-385.293] -- 0:00:30
585000 -- (-385.428) (-390.158) (-388.249) [-386.683] * (-388.484) (-386.828) (-385.787) [-385.888] -- 0:00:30
Average standard deviation of split frequencies: 0.012114
585500 -- (-386.583) [-389.283] (-384.872) (-385.240) * (-386.645) [-387.669] (-385.152) (-387.420) -- 0:00:30
586000 -- (-386.787) (-387.724) [-385.799] (-387.209) * (-389.638) (-388.880) (-385.626) [-391.970] -- 0:00:30
586500 -- (-386.618) (-388.682) (-387.412) [-387.854] * [-387.015] (-386.627) (-388.928) (-396.648) -- 0:00:30
587000 -- (-389.173) (-386.789) [-387.722] (-387.728) * (-385.911) (-387.643) (-389.865) [-389.330] -- 0:00:30
587500 -- (-386.406) (-386.658) (-387.286) [-387.819] * (-389.388) (-385.373) (-386.944) [-389.368] -- 0:00:30
588000 -- (-386.570) [-388.473] (-388.556) (-387.222) * [-385.991] (-386.435) (-386.252) (-387.529) -- 0:00:30
588500 -- (-386.279) [-386.818] (-389.639) (-386.367) * (-386.293) (-387.080) [-389.436] (-388.871) -- 0:00:30
589000 -- (-385.937) (-386.661) [-386.261] (-395.472) * [-386.837] (-385.540) (-387.065) (-390.669) -- 0:00:30
589500 -- [-386.743] (-385.798) (-388.458) (-390.767) * [-385.739] (-385.393) (-387.650) (-385.013) -- 0:00:29
590000 -- [-388.315] (-385.340) (-388.259) (-387.225) * (-388.972) (-386.664) (-387.433) [-384.926] -- 0:00:29
Average standard deviation of split frequencies: 0.011596
590500 -- (-386.950) (-386.466) [-385.698] (-387.600) * (-385.829) (-389.236) (-385.552) [-388.510] -- 0:00:29
591000 -- [-386.747] (-386.137) (-385.036) (-384.758) * (-385.158) (-386.176) (-387.067) [-385.093] -- 0:00:29
591500 -- (-388.434) (-386.189) (-384.873) [-384.894] * (-385.539) [-390.275] (-385.585) (-386.988) -- 0:00:29
592000 -- [-388.811] (-386.512) (-387.195) (-387.121) * [-386.864] (-385.390) (-385.721) (-387.595) -- 0:00:29
592500 -- (-391.710) (-391.282) (-387.525) [-385.872] * [-387.001] (-385.932) (-386.774) (-385.655) -- 0:00:29
593000 -- (-386.539) (-385.696) (-389.835) [-385.656] * (-386.629) (-387.258) [-387.247] (-385.965) -- 0:00:29
593500 -- (-384.988) (-387.720) (-388.733) [-385.660] * [-387.116] (-386.050) (-384.849) (-385.870) -- 0:00:29
594000 -- [-388.331] (-387.162) (-386.772) (-388.154) * (-385.380) (-387.731) [-386.282] (-386.899) -- 0:00:29
594500 -- (-392.259) [-386.640] (-388.661) (-387.422) * (-386.496) (-387.055) (-388.702) [-388.000] -- 0:00:29
595000 -- (-385.185) (-386.308) [-385.449] (-386.552) * (-388.975) (-387.847) (-387.050) [-391.332] -- 0:00:29
Average standard deviation of split frequencies: 0.010925
595500 -- (-386.000) (-385.424) (-391.908) [-389.225] * (-385.968) (-387.192) (-385.623) [-387.982] -- 0:00:29
596000 -- (-385.695) (-388.535) [-387.313] (-388.620) * (-386.422) (-385.458) [-386.222] (-387.459) -- 0:00:29
596500 -- [-387.289] (-386.491) (-387.114) (-387.490) * [-386.165] (-387.777) (-385.750) (-386.824) -- 0:00:29
597000 -- (-386.317) (-388.013) [-387.397] (-385.993) * (-386.676) (-386.334) [-386.398] (-389.117) -- 0:00:29
597500 -- [-386.444] (-387.397) (-387.952) (-389.039) * (-386.439) [-385.001] (-385.626) (-386.471) -- 0:00:28
598000 -- (-387.251) [-387.463] (-385.206) (-386.853) * (-385.803) [-386.692] (-387.819) (-386.303) -- 0:00:28
598500 -- (-386.710) (-387.637) [-387.640] (-385.314) * (-389.062) (-386.544) [-388.949] (-387.069) -- 0:00:28
599000 -- (-385.047) (-388.233) (-386.084) [-385.430] * (-385.844) [-388.253] (-388.662) (-387.329) -- 0:00:29
599500 -- [-385.704] (-393.736) (-389.067) (-388.681) * [-387.020] (-385.439) (-388.209) (-386.231) -- 0:00:29
600000 -- (-386.599) (-386.726) (-387.943) [-389.697] * [-387.535] (-391.402) (-388.708) (-386.676) -- 0:00:29
Average standard deviation of split frequencies: 0.011634
600500 -- (-385.716) (-385.707) (-386.743) [-388.365] * [-386.679] (-386.266) (-386.389) (-388.560) -- 0:00:29
601000 -- (-386.387) (-386.188) [-385.414] (-385.886) * (-386.993) (-390.519) (-385.711) [-386.742] -- 0:00:29
601500 -- [-385.100] (-387.392) (-385.034) (-388.640) * [-387.717] (-387.623) (-386.514) (-385.847) -- 0:00:29
602000 -- (-385.109) (-386.671) (-385.981) [-386.455] * (-386.863) [-387.867] (-384.973) (-386.058) -- 0:00:29
602500 -- (-387.927) (-392.572) (-385.536) [-385.907] * (-386.583) [-387.183] (-385.802) (-386.871) -- 0:00:29
603000 -- (-387.049) (-386.758) (-385.961) [-385.389] * (-386.475) [-387.131] (-388.205) (-385.313) -- 0:00:28
603500 -- (-389.623) (-385.906) (-385.737) [-387.426] * (-390.500) [-389.382] (-389.766) (-385.104) -- 0:00:28
604000 -- (-386.574) [-385.893] (-385.321) (-391.665) * (-385.738) (-385.826) [-386.828] (-386.636) -- 0:00:28
604500 -- (-388.385) (-386.449) [-386.229] (-392.508) * (-387.041) (-385.893) (-389.837) [-393.489] -- 0:00:28
605000 -- (-386.103) (-386.880) [-385.162] (-391.634) * [-385.740] (-387.070) (-385.419) (-388.518) -- 0:00:28
Average standard deviation of split frequencies: 0.012126
605500 -- (-385.863) (-385.244) [-388.540] (-390.063) * (-385.406) (-386.226) (-388.736) [-387.301] -- 0:00:28
606000 -- (-386.111) [-388.476] (-387.577) (-387.657) * (-387.539) (-385.954) [-385.222] (-387.444) -- 0:00:28
606500 -- (-385.351) (-390.229) (-390.193) [-387.595] * [-388.355] (-390.279) (-385.241) (-386.641) -- 0:00:28
607000 -- (-387.240) [-386.680] (-386.890) (-388.202) * (-385.934) [-387.398] (-386.876) (-387.031) -- 0:00:28
607500 -- (-387.249) [-386.239] (-386.432) (-385.425) * (-390.550) [-390.280] (-387.371) (-385.336) -- 0:00:28
608000 -- (-386.554) (-386.953) (-386.270) [-386.406] * [-386.357] (-389.025) (-386.382) (-387.864) -- 0:00:28
608500 -- (-388.113) (-387.379) [-386.303] (-386.107) * (-385.122) [-388.467] (-386.376) (-387.799) -- 0:00:28
609000 -- (-391.411) (-386.804) (-390.186) [-385.362] * (-385.675) (-388.073) (-388.755) [-391.041] -- 0:00:28
609500 -- (-388.687) (-385.794) (-390.464) [-390.113] * [-385.572] (-387.266) (-385.537) (-385.993) -- 0:00:28
610000 -- (-384.926) (-385.768) (-386.324) [-385.890] * (-387.097) (-386.905) [-386.588] (-387.446) -- 0:00:28
Average standard deviation of split frequencies: 0.011820
610500 -- (-385.576) (-386.522) [-387.123] (-386.848) * (-389.128) [-387.614] (-386.915) (-387.732) -- 0:00:28
611000 -- (-385.682) (-386.069) (-386.701) [-391.952] * [-387.871] (-388.686) (-385.648) (-387.777) -- 0:00:28
611500 -- (-386.104) (-389.211) [-385.086] (-386.101) * (-389.318) [-386.303] (-391.231) (-385.299) -- 0:00:27
612000 -- (-387.802) (-386.010) (-386.886) [-387.646] * (-386.694) [-387.728] (-390.006) (-386.401) -- 0:00:27
612500 -- (-390.270) (-389.701) [-386.244] (-386.447) * (-387.665) (-386.893) (-393.348) [-385.312] -- 0:00:28
613000 -- [-390.122] (-388.793) (-387.289) (-385.051) * (-388.145) (-388.528) (-391.403) [-386.528] -- 0:00:28
613500 -- (-387.511) [-387.332] (-393.271) (-389.528) * (-387.268) (-395.173) [-386.539] (-385.895) -- 0:00:28
614000 -- (-386.199) (-386.370) [-388.282] (-386.401) * (-386.489) (-390.408) [-384.965] (-385.949) -- 0:00:28
614500 -- (-386.673) (-385.045) [-387.378] (-389.557) * (-385.446) (-387.250) (-385.807) [-386.979] -- 0:00:28
615000 -- [-389.162] (-387.398) (-388.033) (-390.397) * (-386.893) (-385.967) [-386.542] (-386.789) -- 0:00:28
Average standard deviation of split frequencies: 0.011144
615500 -- (-388.293) [-385.281] (-386.829) (-388.089) * (-387.890) (-389.564) (-388.895) [-385.966] -- 0:00:28
616000 -- [-385.969] (-385.845) (-390.380) (-387.604) * [-386.114] (-386.161) (-386.771) (-384.911) -- 0:00:28
616500 -- (-388.082) [-386.290] (-388.876) (-385.876) * (-386.728) (-386.001) (-387.094) [-386.754] -- 0:00:27
617000 -- (-389.169) (-385.497) [-387.128] (-386.884) * (-388.716) (-387.640) (-387.449) [-384.818] -- 0:00:27
617500 -- (-390.189) (-386.515) [-388.211] (-386.128) * (-388.010) (-387.533) (-388.061) [-386.738] -- 0:00:27
618000 -- (-387.207) (-387.630) [-387.962] (-385.479) * (-388.584) (-390.251) [-387.930] (-387.271) -- 0:00:27
618500 -- (-386.327) (-385.261) (-387.199) [-385.384] * (-384.926) (-393.259) (-384.812) [-386.128] -- 0:00:27
619000 -- [-385.265] (-385.636) (-385.740) (-388.393) * [-387.328] (-385.118) (-390.101) (-386.024) -- 0:00:27
619500 -- (-388.205) (-386.884) (-386.401) [-391.003] * (-385.897) [-384.906] (-389.534) (-386.877) -- 0:00:27
620000 -- (-385.848) (-386.622) [-387.690] (-386.140) * [-385.752] (-387.323) (-389.627) (-389.008) -- 0:00:27
Average standard deviation of split frequencies: 0.011060
620500 -- (-389.313) (-387.344) [-388.513] (-385.791) * (-386.924) (-387.518) (-387.105) [-384.830] -- 0:00:27
621000 -- (-388.639) (-388.855) (-388.629) [-384.913] * (-385.318) (-388.581) [-385.656] (-389.905) -- 0:00:27
621500 -- [-388.089] (-386.858) (-387.897) (-387.776) * (-387.703) (-388.301) (-385.824) [-387.705] -- 0:00:27
622000 -- (-390.442) (-387.622) [-385.085] (-386.712) * (-388.120) [-387.879] (-390.086) (-391.997) -- 0:00:27
622500 -- [-385.953] (-392.262) (-386.236) (-387.782) * [-387.756] (-390.391) (-387.434) (-387.990) -- 0:00:27
623000 -- (-385.442) [-388.157] (-386.570) (-387.569) * (-387.452) [-387.193] (-386.193) (-388.632) -- 0:00:27
623500 -- [-385.832] (-385.667) (-385.782) (-387.098) * (-385.352) (-386.400) [-386.063] (-387.336) -- 0:00:27
624000 -- (-385.982) (-386.934) (-386.926) [-386.726] * (-386.266) (-386.904) [-385.409] (-390.160) -- 0:00:27
624500 -- [-386.585] (-390.268) (-391.365) (-387.163) * (-391.104) [-386.308] (-387.475) (-387.258) -- 0:00:27
625000 -- (-389.364) (-386.408) (-387.355) [-387.706] * (-388.033) (-386.033) [-385.288] (-386.369) -- 0:00:27
Average standard deviation of split frequencies: 0.010260
625500 -- (-386.868) [-385.613] (-386.775) (-385.297) * (-388.066) (-389.818) [-386.481] (-386.923) -- 0:00:26
626000 -- (-385.306) (-389.089) (-387.341) [-385.218] * (-387.006) (-387.116) [-385.989] (-387.301) -- 0:00:27
626500 -- [-389.515] (-386.040) (-385.255) (-387.768) * (-387.730) [-386.705] (-386.680) (-385.003) -- 0:00:27
627000 -- [-388.253] (-388.794) (-388.879) (-392.364) * (-392.165) (-385.225) [-386.833] (-389.791) -- 0:00:27
627500 -- (-388.756) (-387.319) (-387.383) [-386.549] * (-391.865) [-386.849] (-387.673) (-390.769) -- 0:00:27
628000 -- (-387.258) (-386.532) [-385.203] (-386.464) * (-388.229) (-385.085) (-388.168) [-386.963] -- 0:00:27
628500 -- [-385.750] (-389.203) (-385.933) (-388.457) * (-388.611) [-387.580] (-385.809) (-394.994) -- 0:00:27
629000 -- (-385.705) (-385.881) (-387.915) [-386.460] * (-387.867) (-386.426) [-386.822] (-388.344) -- 0:00:27
629500 -- (-387.764) [-390.022] (-385.939) (-388.327) * [-385.556] (-386.414) (-389.898) (-385.767) -- 0:00:27
630000 -- [-387.869] (-387.823) (-389.042) (-389.268) * (-386.838) (-386.207) [-387.602] (-392.871) -- 0:00:27
Average standard deviation of split frequencies: 0.010184
630500 -- (-387.580) [-386.309] (-385.214) (-387.576) * [-386.742] (-386.038) (-387.400) (-393.525) -- 0:00:26
631000 -- (-390.702) [-387.189] (-387.077) (-389.407) * (-386.103) [-387.942] (-384.868) (-390.569) -- 0:00:26
631500 -- (-385.686) (-387.470) [-386.323] (-389.066) * (-388.339) (-388.776) [-387.113] (-388.893) -- 0:00:26
632000 -- [-388.502] (-389.544) (-385.442) (-390.458) * [-385.134] (-386.731) (-386.236) (-387.582) -- 0:00:26
632500 -- [-385.095] (-385.565) (-387.124) (-389.459) * (-387.938) [-387.184] (-389.064) (-385.169) -- 0:00:26
633000 -- (-388.113) (-389.831) (-389.496) [-386.522] * (-388.457) (-387.689) [-388.151] (-386.788) -- 0:00:26
633500 -- (-386.714) [-385.051] (-388.274) (-387.896) * (-386.581) (-389.471) (-388.033) [-384.767] -- 0:00:26
634000 -- [-390.279] (-389.453) (-386.813) (-387.765) * (-387.908) (-385.216) [-387.212] (-388.472) -- 0:00:26
634500 -- (-386.883) (-386.366) [-388.964] (-385.843) * (-386.921) (-387.010) (-389.188) [-387.287] -- 0:00:26
635000 -- [-387.332] (-389.293) (-385.081) (-387.757) * (-386.077) (-387.132) [-386.191] (-386.029) -- 0:00:26
Average standard deviation of split frequencies: 0.009821
635500 -- (-390.274) [-387.289] (-387.905) (-386.243) * (-387.976) [-387.601] (-388.167) (-386.345) -- 0:00:26
636000 -- (-386.777) [-390.418] (-387.943) (-390.124) * [-387.842] (-386.765) (-385.952) (-386.538) -- 0:00:26
636500 -- (-385.599) (-385.517) [-385.447] (-388.648) * (-387.662) (-388.104) (-389.568) [-388.243] -- 0:00:26
637000 -- (-386.811) [-387.571] (-387.001) (-386.004) * (-386.574) [-385.658] (-386.222) (-386.651) -- 0:00:26
637500 -- (-386.784) (-386.067) (-385.809) [-385.468] * (-386.066) (-390.019) (-388.859) [-390.084] -- 0:00:26
638000 -- [-385.663] (-387.587) (-385.273) (-385.921) * [-387.356] (-387.027) (-388.437) (-386.205) -- 0:00:26
638500 -- (-386.549) [-388.038] (-385.153) (-386.449) * (-386.073) [-388.217] (-386.107) (-385.953) -- 0:00:26
639000 -- (-385.974) [-389.472] (-384.732) (-385.688) * (-388.005) (-388.260) [-385.794] (-389.188) -- 0:00:25
639500 -- (-386.768) (-388.348) [-387.755] (-386.835) * (-384.822) [-385.376] (-388.955) (-387.386) -- 0:00:25
640000 -- [-388.512] (-388.426) (-390.792) (-386.302) * (-387.728) (-385.739) [-387.056] (-388.268) -- 0:00:25
Average standard deviation of split frequencies: 0.009519
640500 -- (-387.422) [-385.031] (-386.761) (-385.989) * (-388.487) [-384.937] (-386.503) (-391.085) -- 0:00:26
641000 -- (-391.632) (-385.769) (-387.858) [-385.889] * (-387.459) (-388.518) (-387.110) [-386.091] -- 0:00:26
641500 -- (-386.219) (-387.006) [-387.358] (-386.473) * (-390.069) (-387.032) (-386.215) [-386.061] -- 0:00:26
642000 -- (-385.457) (-387.306) [-385.969] (-389.468) * (-388.373) (-387.289) [-386.393] (-391.385) -- 0:00:26
642500 -- (-387.372) (-386.028) [-387.526] (-388.988) * (-387.814) [-386.021] (-386.751) (-385.369) -- 0:00:26
643000 -- (-386.698) [-385.785] (-386.682) (-386.942) * (-389.969) (-387.095) [-385.897] (-386.823) -- 0:00:26
643500 -- [-388.448] (-385.814) (-392.013) (-387.481) * [-388.625] (-387.398) (-386.265) (-386.077) -- 0:00:26
644000 -- (-386.579) [-386.402] (-386.661) (-386.481) * (-387.167) (-391.806) (-385.256) [-387.468] -- 0:00:25
644500 -- (-386.915) [-385.607] (-389.753) (-388.972) * (-388.306) (-386.695) [-385.803] (-386.849) -- 0:00:25
645000 -- (-386.970) [-385.435] (-386.856) (-390.849) * (-390.080) (-386.894) (-385.043) [-388.111] -- 0:00:25
Average standard deviation of split frequencies: 0.009532
645500 -- (-387.658) (-388.936) (-385.676) [-388.827] * (-387.875) (-390.265) (-386.592) [-388.693] -- 0:00:25
646000 -- (-386.640) (-386.960) [-386.942] (-385.700) * [-387.161] (-391.338) (-386.494) (-385.672) -- 0:00:25
646500 -- (-386.982) [-386.003] (-393.673) (-386.350) * [-387.193] (-386.133) (-390.228) (-391.374) -- 0:00:25
647000 -- (-388.487) (-387.230) (-385.979) [-388.175] * (-387.309) [-386.280] (-389.330) (-387.350) -- 0:00:25
647500 -- [-387.566] (-385.885) (-386.685) (-386.592) * (-385.894) [-386.805] (-386.447) (-388.995) -- 0:00:25
648000 -- [-385.926] (-386.757) (-386.256) (-389.355) * (-389.617) (-387.040) (-388.112) [-387.033] -- 0:00:25
648500 -- (-388.034) (-386.889) (-386.993) [-386.849] * (-385.174) (-389.535) (-386.385) [-390.750] -- 0:00:25
649000 -- [-385.889] (-387.812) (-387.655) (-388.248) * (-387.291) [-390.686] (-386.043) (-386.729) -- 0:00:25
649500 -- (-391.392) (-390.333) [-385.910] (-386.664) * [-385.775] (-387.230) (-384.886) (-390.662) -- 0:00:25
650000 -- (-387.439) (-385.972) [-386.172] (-389.151) * (-385.330) (-389.598) [-386.564] (-390.939) -- 0:00:25
Average standard deviation of split frequencies: 0.010098
650500 -- (-387.517) (-387.727) (-388.482) [-387.147] * (-389.489) [-385.993] (-387.466) (-384.928) -- 0:00:25
651000 -- (-387.408) (-387.551) [-388.818] (-385.494) * (-388.327) (-387.887) (-385.638) [-387.667] -- 0:00:25
651500 -- (-390.039) (-388.440) (-390.142) [-385.499] * (-391.245) (-389.061) [-387.467] (-389.934) -- 0:00:25
652000 -- (-388.546) (-385.332) (-385.651) [-386.203] * [-391.164] (-389.022) (-389.892) (-386.853) -- 0:00:25
652500 -- [-389.269] (-390.334) (-387.921) (-387.160) * (-388.026) (-385.697) [-386.448] (-385.363) -- 0:00:25
653000 -- (-386.604) (-395.081) (-387.818) [-389.522] * (-387.658) (-392.973) [-387.597] (-388.365) -- 0:00:24
653500 -- (-385.361) (-385.908) (-388.432) [-386.650] * (-387.437) [-387.789] (-386.573) (-388.563) -- 0:00:24
654000 -- (-386.031) (-388.301) [-385.931] (-387.332) * (-385.382) (-388.033) (-385.695) [-387.160] -- 0:00:24
654500 -- [-386.483] (-386.196) (-391.114) (-394.129) * (-390.587) (-387.497) (-388.766) [-386.572] -- 0:00:25
655000 -- (-393.984) (-390.147) [-385.389] (-390.006) * (-386.101) [-386.376] (-387.775) (-385.746) -- 0:00:25
Average standard deviation of split frequencies: 0.010150
655500 -- [-385.342] (-389.349) (-390.075) (-387.665) * (-387.563) (-385.918) [-386.302] (-386.607) -- 0:00:25
656000 -- [-387.758] (-387.959) (-386.838) (-385.423) * [-386.425] (-386.267) (-387.236) (-385.662) -- 0:00:25
656500 -- (-390.484) (-390.711) (-388.067) [-388.227] * [-392.241] (-386.162) (-386.791) (-387.982) -- 0:00:25
657000 -- (-393.148) (-385.522) (-385.920) [-387.121] * (-386.552) [-386.466] (-389.406) (-385.407) -- 0:00:25
657500 -- (-389.756) (-385.181) [-388.985] (-389.661) * (-386.300) [-389.452] (-391.716) (-386.125) -- 0:00:25
658000 -- [-385.341] (-386.292) (-387.881) (-386.161) * [-385.018] (-391.915) (-387.551) (-389.495) -- 0:00:24
658500 -- (-387.698) (-390.468) (-387.892) [-385.316] * (-387.520) (-386.209) (-390.160) [-387.410] -- 0:00:24
659000 -- (-389.400) (-388.118) (-389.475) [-385.406] * (-385.898) [-384.761] (-387.326) (-390.599) -- 0:00:24
659500 -- [-385.790] (-386.355) (-389.702) (-386.474) * (-385.608) [-388.125] (-388.364) (-390.644) -- 0:00:24
660000 -- (-387.426) (-385.270) (-387.593) [-386.309] * (-386.170) [-386.342] (-386.451) (-387.226) -- 0:00:24
Average standard deviation of split frequencies: 0.009945
660500 -- (-385.779) (-387.042) [-386.293] (-386.692) * (-388.804) [-386.005] (-387.029) (-386.120) -- 0:00:24
661000 -- (-385.604) [-385.772] (-386.461) (-386.442) * (-386.490) (-387.494) [-389.320] (-385.491) -- 0:00:24
661500 -- (-388.675) (-388.000) (-387.910) [-387.422] * [-386.886] (-386.548) (-388.439) (-385.503) -- 0:00:24
662000 -- [-386.363] (-386.238) (-388.558) (-389.224) * (-385.605) (-386.798) (-389.304) [-385.733] -- 0:00:24
662500 -- (-386.514) (-386.020) (-385.336) [-387.559] * (-386.625) (-388.817) [-385.344] (-385.678) -- 0:00:24
663000 -- (-389.446) [-387.503] (-386.976) (-388.756) * (-389.992) (-389.608) [-385.265] (-386.177) -- 0:00:24
663500 -- [-386.189] (-386.131) (-389.887) (-391.355) * (-387.992) (-385.935) (-385.237) [-387.968] -- 0:00:24
664000 -- (-385.859) (-387.637) [-388.669] (-386.826) * [-389.313] (-386.299) (-387.070) (-387.797) -- 0:00:24
664500 -- (-384.920) (-386.186) [-386.779] (-385.288) * (-387.836) (-386.683) [-391.886] (-387.320) -- 0:00:24
665000 -- (-387.401) (-388.756) (-388.461) [-389.949] * (-387.614) [-386.113] (-385.293) (-386.685) -- 0:00:24
Average standard deviation of split frequencies: 0.009732
665500 -- (-386.464) (-387.603) [-389.475] (-387.924) * (-386.484) (-386.812) (-385.704) [-386.597] -- 0:00:24
666000 -- (-386.590) (-386.870) (-387.589) [-387.551] * (-389.149) (-385.310) [-385.253] (-387.631) -- 0:00:24
666500 -- [-385.916] (-387.889) (-387.459) (-386.824) * (-388.071) (-387.601) [-387.206] (-385.170) -- 0:00:24
667000 -- (-387.374) (-386.631) [-385.191] (-385.716) * (-385.457) (-388.757) [-387.657] (-390.811) -- 0:00:23
667500 -- [-387.510] (-386.413) (-386.695) (-387.678) * [-387.013] (-387.161) (-388.147) (-391.919) -- 0:00:23
668000 -- (-388.545) [-385.783] (-388.573) (-384.931) * [-388.157] (-388.382) (-387.778) (-386.330) -- 0:00:23
668500 -- (-388.499) [-388.999] (-390.021) (-385.937) * [-389.691] (-384.929) (-384.829) (-386.565) -- 0:00:24
669000 -- (-387.428) [-385.742] (-387.707) (-387.320) * (-387.058) (-386.116) [-385.924] (-387.509) -- 0:00:24
669500 -- [-385.905] (-388.236) (-389.384) (-385.842) * (-386.587) [-385.658] (-386.806) (-388.753) -- 0:00:24
670000 -- (-386.356) (-387.388) (-386.529) [-386.777] * (-391.027) (-389.996) [-385.455] (-385.361) -- 0:00:24
Average standard deviation of split frequencies: 0.009401
670500 -- (-386.705) [-390.369] (-390.323) (-386.514) * [-385.983] (-391.259) (-386.439) (-386.724) -- 0:00:24
671000 -- (-386.480) (-386.052) (-389.962) [-385.300] * (-385.299) (-390.141) [-385.533] (-388.645) -- 0:00:24
671500 -- (-391.409) (-385.573) (-385.966) [-387.850] * (-390.334) [-386.581] (-385.117) (-388.830) -- 0:00:23
672000 -- (-386.620) (-387.329) [-385.319] (-388.538) * (-389.113) [-388.293] (-385.971) (-387.687) -- 0:00:23
672500 -- (-386.510) (-385.632) (-389.897) [-386.931] * (-386.704) (-387.224) [-387.570] (-388.126) -- 0:00:23
673000 -- (-388.972) [-386.279] (-392.896) (-387.055) * (-391.275) (-386.741) (-385.863) [-384.974] -- 0:00:23
673500 -- (-387.238) [-386.524] (-389.267) (-387.232) * (-389.916) [-387.261] (-385.502) (-387.089) -- 0:00:23
674000 -- (-386.272) [-387.182] (-388.477) (-389.414) * (-387.568) [-386.876] (-388.327) (-387.840) -- 0:00:23
674500 -- (-389.596) (-385.914) (-385.899) [-388.700] * (-390.712) (-390.186) (-386.640) [-386.718] -- 0:00:23
675000 -- (-391.052) (-388.167) (-389.946) [-386.306] * [-387.069] (-386.889) (-386.310) (-391.487) -- 0:00:23
Average standard deviation of split frequencies: 0.010111
675500 -- (-390.727) [-387.121] (-388.276) (-387.294) * (-390.809) [-386.439] (-387.358) (-385.095) -- 0:00:23
676000 -- (-390.905) [-387.268] (-388.315) (-388.027) * [-386.526] (-396.847) (-388.998) (-387.662) -- 0:00:23
676500 -- (-387.468) (-387.328) (-387.707) [-386.906] * (-390.548) [-387.863] (-386.197) (-387.378) -- 0:00:23
677000 -- (-384.962) (-389.763) (-388.096) [-385.828] * (-386.028) [-385.588] (-385.781) (-389.480) -- 0:00:23
677500 -- [-389.586] (-390.509) (-386.437) (-386.756) * (-387.150) (-389.769) [-386.008] (-387.405) -- 0:00:23
678000 -- (-387.983) (-386.634) [-385.861] (-387.491) * (-388.588) (-391.703) [-387.783] (-385.701) -- 0:00:23
678500 -- (-385.035) [-387.966] (-387.256) (-387.350) * [-385.690] (-388.633) (-387.463) (-385.844) -- 0:00:23
679000 -- (-391.824) (-386.293) [-385.938] (-390.268) * (-385.251) (-385.884) [-384.864] (-385.518) -- 0:00:23
679500 -- [-389.034] (-387.537) (-388.398) (-390.232) * [-386.858] (-389.179) (-386.590) (-389.164) -- 0:00:23
680000 -- (-387.740) (-386.782) (-386.815) [-391.925] * (-386.225) (-386.356) (-388.750) [-388.964] -- 0:00:23
Average standard deviation of split frequencies: 0.009869
680500 -- (-390.060) [-387.399] (-387.876) (-386.010) * (-388.206) (-386.397) (-389.983) [-389.062] -- 0:00:23
681000 -- [-386.106] (-388.239) (-387.348) (-386.156) * (-388.126) (-387.713) [-386.543] (-388.515) -- 0:00:22
681500 -- (-385.461) (-387.082) [-386.458] (-390.546) * (-387.699) (-388.708) (-385.543) [-386.390] -- 0:00:22
682000 -- (-386.089) (-388.948) [-386.837] (-389.224) * (-388.644) (-388.018) (-388.035) [-390.471] -- 0:00:22
682500 -- [-386.562] (-387.515) (-388.023) (-385.583) * (-387.593) [-389.978] (-386.556) (-386.707) -- 0:00:23
683000 -- (-389.239) [-386.487] (-390.635) (-386.089) * (-388.026) (-388.088) [-384.999] (-387.289) -- 0:00:23
683500 -- (-388.026) [-388.769] (-388.216) (-386.602) * (-391.122) (-388.939) [-385.435] (-385.269) -- 0:00:23
684000 -- (-386.414) (-386.306) (-386.773) [-385.940] * (-386.454) [-387.594] (-387.330) (-385.436) -- 0:00:23
684500 -- (-385.768) [-386.757] (-386.144) (-389.487) * (-386.886) (-388.383) (-386.273) [-384.950] -- 0:00:23
685000 -- (-390.612) (-389.113) [-385.022] (-387.271) * (-386.003) (-388.022) [-390.223] (-396.291) -- 0:00:22
Average standard deviation of split frequencies: 0.009578
685500 -- (-390.677) [-385.113] (-386.995) (-386.168) * [-384.795] (-385.315) (-386.083) (-389.018) -- 0:00:22
686000 -- (-388.416) (-385.956) [-387.883] (-386.316) * (-385.142) (-389.722) [-385.843] (-391.545) -- 0:00:22
686500 -- [-387.568] (-387.548) (-389.160) (-386.345) * (-387.575) [-385.737] (-387.576) (-389.104) -- 0:00:22
687000 -- (-386.240) [-388.122] (-390.781) (-386.880) * (-386.270) (-389.982) [-387.979] (-387.745) -- 0:00:22
687500 -- (-390.622) (-386.375) [-388.354] (-388.521) * [-384.982] (-392.408) (-385.987) (-386.631) -- 0:00:22
688000 -- (-388.953) (-385.698) [-386.543] (-385.797) * [-386.372] (-387.002) (-386.863) (-387.273) -- 0:00:22
688500 -- (-387.683) (-389.357) [-385.700] (-386.932) * (-387.521) (-387.220) (-386.170) [-391.885] -- 0:00:22
689000 -- (-386.049) (-388.283) (-385.235) [-386.163] * (-386.386) (-386.089) (-384.995) [-386.732] -- 0:00:22
689500 -- (-386.718) (-386.285) (-387.063) [-385.656] * (-388.918) (-386.719) [-388.980] (-385.264) -- 0:00:22
690000 -- (-387.621) (-385.906) [-385.897] (-389.528) * [-386.656] (-387.981) (-388.474) (-386.828) -- 0:00:22
Average standard deviation of split frequencies: 0.009129
690500 -- (-388.808) [-388.261] (-386.808) (-386.070) * (-385.146) [-386.057] (-387.710) (-390.252) -- 0:00:22
691000 -- (-387.154) (-389.603) (-387.717) [-387.040] * [-387.286] (-386.561) (-385.920) (-389.275) -- 0:00:22
691500 -- (-388.099) (-386.789) [-386.271] (-391.285) * (-388.570) [-391.074] (-389.209) (-388.154) -- 0:00:22
692000 -- (-387.812) (-386.487) (-387.267) [-385.217] * (-386.075) (-387.351) [-385.260] (-386.601) -- 0:00:22
692500 -- (-386.762) (-385.864) [-387.533] (-386.586) * [-387.509] (-387.401) (-385.604) (-386.873) -- 0:00:22
693000 -- (-388.171) (-385.605) [-392.225] (-386.207) * (-385.051) [-386.175] (-385.483) (-386.502) -- 0:00:22
693500 -- [-387.564] (-385.086) (-386.221) (-387.356) * (-386.741) (-385.720) [-385.371] (-387.516) -- 0:00:22
694000 -- [-384.860] (-390.328) (-388.643) (-386.014) * [-389.543] (-385.888) (-386.845) (-387.465) -- 0:00:22
694500 -- (-389.677) [-388.015] (-390.434) (-388.122) * (-389.926) (-387.318) [-385.393] (-388.386) -- 0:00:21
695000 -- [-387.730] (-385.055) (-392.085) (-387.285) * (-390.430) [-387.712] (-388.421) (-386.745) -- 0:00:21
Average standard deviation of split frequencies: 0.009440
695500 -- (-388.044) [-387.812] (-388.400) (-389.494) * (-387.129) (-386.741) [-387.726] (-385.646) -- 0:00:21
696000 -- [-386.747] (-390.488) (-391.570) (-390.350) * (-385.534) [-386.305] (-386.345) (-388.644) -- 0:00:21
696500 -- (-387.186) (-386.722) (-388.024) [-387.048] * (-385.403) (-386.446) (-386.779) [-389.554] -- 0:00:22
697000 -- [-387.384] (-385.543) (-388.733) (-387.151) * [-387.261] (-385.966) (-385.300) (-387.228) -- 0:00:22
697500 -- (-386.470) (-389.687) (-386.977) [-387.430] * (-386.896) [-385.972] (-385.416) (-387.704) -- 0:00:22
698000 -- (-388.704) [-392.841] (-386.536) (-392.582) * (-388.689) (-388.447) (-387.351) [-386.154] -- 0:00:22
698500 -- [-388.131] (-385.755) (-389.644) (-387.021) * [-385.914] (-389.060) (-386.135) (-386.614) -- 0:00:22
699000 -- [-386.362] (-388.481) (-385.025) (-389.686) * (-388.132) (-387.377) (-386.845) [-387.414] -- 0:00:21
699500 -- [-385.466] (-385.316) (-387.653) (-388.063) * [-386.356] (-386.380) (-387.034) (-389.126) -- 0:00:21
700000 -- [-387.145] (-385.934) (-388.524) (-387.792) * [-388.418] (-387.141) (-386.668) (-387.847) -- 0:00:21
Average standard deviation of split frequencies: 0.009167
700500 -- (-387.125) [-386.689] (-388.007) (-387.170) * (-389.473) (-391.303) (-387.289) [-387.728] -- 0:00:21
701000 -- (-386.322) (-385.722) [-386.567] (-385.945) * (-388.138) [-389.013] (-388.645) (-386.044) -- 0:00:21
701500 -- [-386.284] (-386.519) (-390.403) (-385.778) * (-389.151) (-388.700) (-389.299) [-384.758] -- 0:00:21
702000 -- (-386.200) (-386.030) [-385.345] (-388.421) * (-390.274) (-387.239) (-385.285) [-385.129] -- 0:00:21
702500 -- [-386.966] (-390.570) (-385.605) (-385.932) * (-392.986) (-385.336) [-386.648] (-386.612) -- 0:00:21
703000 -- (-387.339) (-386.957) [-387.441] (-390.777) * (-388.830) [-386.841] (-386.810) (-387.175) -- 0:00:21
703500 -- (-386.378) (-388.915) (-386.861) [-385.857] * [-386.103] (-388.403) (-386.667) (-388.605) -- 0:00:21
704000 -- (-389.246) (-386.650) (-386.710) [-387.911] * (-385.591) [-387.719] (-388.133) (-387.290) -- 0:00:21
704500 -- (-387.356) [-386.011] (-389.327) (-386.822) * [-386.831] (-386.825) (-386.124) (-387.468) -- 0:00:21
705000 -- (-389.508) (-385.593) (-386.537) [-389.363] * (-386.014) (-389.487) [-386.785] (-384.859) -- 0:00:21
Average standard deviation of split frequencies: 0.008805
705500 -- (-386.966) (-389.412) (-386.157) [-385.855] * (-387.269) (-388.956) [-386.491] (-388.343) -- 0:00:21
706000 -- (-386.277) [-386.351] (-386.498) (-391.838) * [-388.150] (-388.182) (-389.961) (-385.738) -- 0:00:21
706500 -- (-388.075) (-388.347) [-386.183] (-390.841) * (-388.872) [-389.109] (-385.446) (-388.818) -- 0:00:21
707000 -- (-387.369) [-386.263] (-388.698) (-387.099) * (-387.523) (-385.640) (-386.373) [-390.873] -- 0:00:21
707500 -- (-386.787) (-394.912) (-386.644) [-386.285] * [-387.448] (-386.491) (-387.231) (-385.842) -- 0:00:21
708000 -- (-387.430) (-392.528) [-385.263] (-387.528) * [-391.984] (-385.748) (-386.015) (-385.631) -- 0:00:21
708500 -- (-386.059) [-388.096] (-385.937) (-385.980) * (-386.205) (-386.094) [-387.863] (-387.625) -- 0:00:20
709000 -- (-386.548) [-386.956] (-386.650) (-387.384) * (-387.112) (-388.924) [-386.653] (-386.101) -- 0:00:20
709500 -- [-385.584] (-386.349) (-386.058) (-387.347) * (-391.050) [-385.574] (-387.469) (-385.865) -- 0:00:20
710000 -- [-387.156] (-385.700) (-388.434) (-388.191) * (-388.653) (-385.744) [-387.334] (-385.863) -- 0:00:20
Average standard deviation of split frequencies: 0.009121
710500 -- (-385.822) (-384.842) [-386.193] (-391.202) * (-386.359) (-387.429) [-390.930] (-385.778) -- 0:00:20
711000 -- (-389.556) (-389.027) [-385.892] (-385.396) * (-386.401) [-387.525] (-390.428) (-389.017) -- 0:00:21
711500 -- (-389.012) (-389.603) [-385.714] (-393.054) * (-386.572) [-388.475] (-385.262) (-388.676) -- 0:00:21
712000 -- (-384.852) (-387.407) [-386.727] (-391.589) * (-386.881) [-386.339] (-385.015) (-385.829) -- 0:00:21
712500 -- (-386.086) (-387.254) [-388.002] (-390.124) * (-387.845) (-389.444) (-386.681) [-386.170] -- 0:00:20
713000 -- (-385.174) [-386.382] (-386.850) (-386.464) * [-388.593] (-385.290) (-388.636) (-386.801) -- 0:00:20
713500 -- (-386.296) (-386.536) (-387.373) [-387.027] * (-388.557) (-386.997) (-388.279) [-385.517] -- 0:00:20
714000 -- [-386.834] (-387.496) (-387.981) (-386.521) * (-386.907) (-385.699) [-386.602] (-385.898) -- 0:00:20
714500 -- (-388.382) (-388.216) [-387.163] (-386.094) * [-385.036] (-385.914) (-391.295) (-387.312) -- 0:00:20
715000 -- (-387.795) [-387.335] (-389.927) (-386.494) * [-386.223] (-389.030) (-386.662) (-387.800) -- 0:00:20
Average standard deviation of split frequencies: 0.008682
715500 -- (-387.049) (-386.116) (-386.388) [-385.597] * (-385.399) (-387.651) [-385.076] (-388.664) -- 0:00:20
716000 -- [-386.432] (-388.251) (-385.911) (-385.470) * [-385.604] (-388.553) (-387.410) (-386.174) -- 0:00:20
716500 -- [-385.561] (-388.374) (-385.949) (-385.052) * (-385.580) [-385.134] (-385.022) (-386.011) -- 0:00:20
717000 -- (-386.475) (-385.175) [-386.679] (-387.376) * (-393.087) (-385.225) [-386.252] (-387.183) -- 0:00:20
717500 -- (-392.680) [-386.095] (-387.522) (-387.992) * (-392.131) (-386.155) (-388.438) [-385.086] -- 0:00:20
718000 -- [-387.328] (-387.734) (-385.902) (-387.517) * (-389.490) (-386.991) (-389.372) [-386.625] -- 0:00:20
718500 -- (-388.536) [-385.889] (-386.079) (-388.630) * (-387.193) [-387.420] (-386.245) (-388.144) -- 0:00:20
719000 -- (-386.662) (-386.940) [-387.163] (-388.625) * (-387.142) [-388.179] (-391.351) (-390.426) -- 0:00:20
719500 -- [-387.356] (-385.134) (-386.055) (-389.198) * (-388.085) (-387.535) [-388.105] (-389.218) -- 0:00:20
720000 -- [-385.744] (-385.757) (-386.263) (-388.122) * (-392.116) (-392.848) [-387.772] (-387.318) -- 0:00:20
Average standard deviation of split frequencies: 0.009158
720500 -- (-385.751) (-389.033) [-385.646] (-385.748) * [-385.433] (-390.324) (-386.671) (-386.329) -- 0:00:20
721000 -- (-386.403) [-391.494] (-392.711) (-388.468) * (-385.434) (-389.894) [-386.970] (-386.616) -- 0:00:20
721500 -- [-385.553] (-389.919) (-388.341) (-387.658) * [-385.718] (-389.251) (-391.969) (-386.184) -- 0:00:20
722000 -- (-388.308) (-389.541) [-385.350] (-385.631) * (-387.736) (-385.757) (-386.693) [-385.461] -- 0:00:20
722500 -- (-387.906) (-390.365) [-388.932] (-385.313) * [-387.667] (-385.816) (-386.595) (-389.927) -- 0:00:19
723000 -- (-389.866) [-388.440] (-387.288) (-389.744) * (-387.397) (-385.851) [-385.327] (-388.178) -- 0:00:19
723500 -- (-387.294) (-388.332) (-386.618) [-389.344] * (-387.671) [-388.031] (-385.016) (-388.214) -- 0:00:19
724000 -- (-387.181) (-387.390) [-385.952] (-390.004) * (-391.263) (-385.197) (-385.810) [-389.984] -- 0:00:19
724500 -- (-386.567) (-387.476) [-386.985] (-386.752) * (-390.132) (-387.944) (-386.769) [-386.980] -- 0:00:19
725000 -- (-393.045) (-386.638) [-385.935] (-388.521) * (-391.847) (-386.353) [-392.740] (-389.925) -- 0:00:20
Average standard deviation of split frequencies: 0.009172
725500 -- (-389.173) (-386.003) [-388.043] (-389.590) * [-385.683] (-390.946) (-388.085) (-386.714) -- 0:00:20
726000 -- [-386.871] (-387.315) (-396.247) (-385.863) * [-385.974] (-389.084) (-385.811) (-389.283) -- 0:00:20
726500 -- [-385.749] (-389.053) (-390.088) (-387.977) * (-392.377) [-387.235] (-387.473) (-388.309) -- 0:00:19
727000 -- (-391.184) [-387.305] (-386.784) (-390.571) * (-386.992) (-388.244) [-388.654] (-388.364) -- 0:00:19
727500 -- (-386.076) (-393.051) (-390.457) [-385.810] * (-386.012) [-387.747] (-389.742) (-393.398) -- 0:00:19
728000 -- (-385.386) [-386.015] (-387.998) (-389.647) * (-386.242) (-387.865) (-387.898) [-393.036] -- 0:00:19
728500 -- (-385.344) (-387.614) (-385.910) [-387.068] * (-387.813) (-385.207) [-386.285] (-388.560) -- 0:00:19
729000 -- (-386.285) (-388.906) (-385.893) [-385.977] * [-387.756] (-386.458) (-393.477) (-391.500) -- 0:00:19
729500 -- (-385.437) (-385.897) (-386.497) [-387.244] * [-389.278] (-389.099) (-393.956) (-386.419) -- 0:00:19
730000 -- (-385.568) [-390.819] (-388.610) (-385.836) * [-385.622] (-387.635) (-388.205) (-384.962) -- 0:00:19
Average standard deviation of split frequencies: 0.009355
730500 -- [-387.090] (-386.177) (-387.553) (-386.400) * [-387.183] (-386.323) (-388.427) (-385.749) -- 0:00:19
731000 -- (-385.688) (-385.306) (-392.282) [-389.509] * (-385.680) (-386.915) (-387.771) [-385.931] -- 0:00:19
731500 -- [-385.872] (-389.263) (-385.129) (-385.448) * (-390.661) (-386.246) [-394.139] (-387.396) -- 0:00:19
732000 -- (-392.375) (-386.500) (-384.807) [-387.393] * (-393.122) (-385.639) (-389.392) [-387.888] -- 0:00:19
732500 -- (-386.638) (-386.898) [-385.853] (-388.802) * (-395.633) (-386.970) (-386.002) [-388.415] -- 0:00:19
733000 -- (-386.779) (-387.926) (-386.424) [-386.014] * (-393.756) [-386.225] (-390.779) (-385.793) -- 0:00:19
733500 -- [-387.742] (-387.498) (-385.861) (-390.914) * [-385.468] (-385.907) (-386.826) (-388.184) -- 0:00:19
734000 -- (-388.324) [-386.707] (-385.624) (-388.336) * (-386.943) (-386.059) [-387.470] (-387.510) -- 0:00:19
734500 -- (-387.213) (-386.438) (-386.369) [-386.826] * (-389.295) (-385.061) (-387.402) [-387.050] -- 0:00:19
735000 -- [-388.100] (-387.994) (-387.967) (-385.623) * (-388.715) [-385.869] (-384.813) (-388.756) -- 0:00:19
Average standard deviation of split frequencies: 0.008741
735500 -- [-386.730] (-388.018) (-389.148) (-387.522) * (-385.683) [-386.565] (-387.675) (-385.524) -- 0:00:19
736000 -- (-385.590) (-387.246) (-388.037) [-388.260] * (-385.439) (-385.137) [-386.830] (-385.283) -- 0:00:19
736500 -- (-388.871) (-389.299) [-389.407] (-386.879) * (-390.850) [-386.006] (-386.195) (-386.792) -- 0:00:18
737000 -- (-385.324) [-385.796] (-387.090) (-387.362) * (-386.498) (-385.721) (-386.641) [-385.619] -- 0:00:18
737500 -- (-385.466) (-389.347) (-387.382) [-389.302] * [-392.215] (-391.482) (-385.880) (-386.783) -- 0:00:18
738000 -- (-385.276) (-387.895) (-389.654) [-387.593] * (-387.369) (-389.101) [-388.605] (-386.131) -- 0:00:18
738500 -- (-391.627) (-387.735) [-387.316] (-393.109) * [-389.707] (-387.405) (-385.485) (-387.069) -- 0:00:18
739000 -- (-389.891) (-385.894) [-389.997] (-387.203) * [-387.474] (-385.026) (-390.288) (-388.289) -- 0:00:19
739500 -- (-389.975) (-386.080) (-387.040) [-388.151] * (-387.357) (-389.251) [-391.149] (-387.632) -- 0:00:19
740000 -- [-388.416] (-385.336) (-384.805) (-385.885) * [-387.273] (-386.676) (-392.188) (-386.554) -- 0:00:18
Average standard deviation of split frequencies: 0.008424
740500 -- (-384.991) (-386.617) [-386.366] (-391.349) * (-386.547) (-387.655) (-386.843) [-390.317] -- 0:00:18
741000 -- [-385.509] (-388.239) (-387.469) (-386.966) * [-386.082] (-386.178) (-388.631) (-385.671) -- 0:00:18
741500 -- (-385.391) (-387.215) [-388.355] (-387.456) * (-387.231) [-391.679] (-385.538) (-389.453) -- 0:00:18
742000 -- (-385.170) (-386.141) (-385.202) [-385.936] * (-385.785) (-386.298) (-386.715) [-385.672] -- 0:00:18
742500 -- (-388.118) (-385.614) [-390.864] (-387.717) * [-388.906] (-386.996) (-386.526) (-386.130) -- 0:00:18
743000 -- (-386.165) (-386.433) [-389.969] (-386.603) * (-385.383) [-389.623] (-391.409) (-388.975) -- 0:00:18
743500 -- (-388.608) [-388.363] (-387.709) (-386.791) * (-386.465) [-387.567] (-388.907) (-385.539) -- 0:00:18
744000 -- (-388.059) [-389.847] (-390.487) (-387.114) * (-385.799) [-385.456] (-386.362) (-387.327) -- 0:00:18
744500 -- (-387.437) [-389.065] (-393.215) (-386.263) * (-385.819) [-388.508] (-389.516) (-385.782) -- 0:00:18
745000 -- (-389.320) [-387.181] (-392.242) (-386.832) * [-386.791] (-385.607) (-389.244) (-387.152) -- 0:00:18
Average standard deviation of split frequencies: 0.008475
745500 -- (-387.459) (-388.162) (-392.180) [-387.489] * (-386.055) [-385.844] (-389.038) (-386.278) -- 0:00:18
746000 -- [-386.966] (-388.066) (-392.335) (-386.760) * [-385.637] (-385.210) (-388.133) (-389.435) -- 0:00:18
746500 -- [-387.037] (-386.411) (-388.596) (-388.116) * (-385.560) (-386.105) [-386.730] (-386.562) -- 0:00:18
747000 -- (-386.912) (-387.399) [-386.884] (-386.700) * (-388.135) (-387.380) [-389.270] (-388.639) -- 0:00:18
747500 -- [-385.122] (-385.091) (-386.744) (-386.477) * [-386.631] (-385.607) (-386.970) (-390.704) -- 0:00:18
748000 -- (-386.519) (-388.635) [-386.472] (-389.326) * (-384.862) (-386.945) [-387.865] (-387.524) -- 0:00:18
748500 -- (-385.547) (-387.822) (-389.960) [-387.354] * (-388.051) [-386.766] (-387.378) (-388.492) -- 0:00:18
749000 -- [-387.040] (-391.098) (-386.018) (-386.748) * [-386.459] (-389.077) (-385.538) (-388.177) -- 0:00:18
749500 -- (-391.312) [-388.304] (-385.708) (-387.178) * [-385.924] (-390.230) (-386.864) (-385.907) -- 0:00:18
750000 -- (-388.203) (-384.845) (-388.209) [-388.560] * [-385.885] (-388.673) (-385.633) (-386.325) -- 0:00:18
Average standard deviation of split frequencies: 0.009027
750500 -- (-387.599) [-386.802] (-386.806) (-386.118) * (-386.215) (-385.566) [-389.250] (-386.876) -- 0:00:17
751000 -- (-386.457) (-386.356) (-388.224) [-385.587] * (-386.216) (-386.173) (-385.950) [-385.844] -- 0:00:17
751500 -- (-385.694) (-385.366) (-386.882) [-386.456] * (-388.639) (-388.785) [-385.892] (-384.761) -- 0:00:17
752000 -- (-387.927) (-388.530) (-387.850) [-386.360] * (-390.335) (-387.826) (-386.839) [-385.417] -- 0:00:17
752500 -- [-386.511] (-389.447) (-386.616) (-388.197) * (-392.711) (-390.673) [-387.075] (-386.631) -- 0:00:17
753000 -- (-390.020) (-387.120) (-389.363) [-384.933] * [-387.076] (-388.313) (-387.749) (-389.232) -- 0:00:17
753500 -- (-385.066) (-388.750) [-388.082] (-385.600) * (-386.791) (-391.610) (-386.458) [-384.959] -- 0:00:17
754000 -- [-385.788] (-385.703) (-387.650) (-387.381) * (-385.236) (-389.505) [-386.242] (-386.451) -- 0:00:17
754500 -- (-385.522) (-388.158) (-387.863) [-388.083] * (-386.942) (-391.443) [-387.983] (-385.363) -- 0:00:17
755000 -- (-388.840) (-386.983) (-386.570) [-386.103] * (-389.647) [-390.440] (-386.413) (-387.737) -- 0:00:17
Average standard deviation of split frequencies: 0.008326
755500 -- (-386.128) (-391.124) [-386.402] (-392.330) * (-387.364) (-387.878) [-386.233] (-385.989) -- 0:00:17
756000 -- (-390.474) (-391.991) [-385.881] (-386.172) * (-386.274) [-386.332] (-386.093) (-385.681) -- 0:00:17
756500 -- [-385.113] (-388.501) (-386.105) (-386.218) * (-387.281) (-386.933) (-389.582) [-386.262] -- 0:00:17
757000 -- (-386.068) (-386.457) [-390.162] (-389.579) * (-386.749) (-386.298) [-385.735] (-386.094) -- 0:00:17
757500 -- [-386.173] (-388.168) (-386.279) (-387.355) * (-386.656) [-389.810] (-391.641) (-388.975) -- 0:00:17
758000 -- (-386.025) [-386.955] (-390.719) (-386.916) * (-385.855) (-387.436) (-385.802) [-386.805] -- 0:00:17
758500 -- (-387.546) (-385.991) (-389.206) [-387.485] * (-385.619) (-387.397) (-388.018) [-387.678] -- 0:00:17
759000 -- (-386.389) (-385.701) [-386.013] (-395.160) * (-387.627) (-386.836) [-389.280] (-386.847) -- 0:00:17
759500 -- (-385.027) (-387.109) [-387.096] (-389.952) * (-387.078) (-389.959) (-386.748) [-385.268] -- 0:00:17
760000 -- (-392.420) (-386.475) [-385.582] (-389.199) * [-386.467] (-388.479) (-387.185) (-386.951) -- 0:00:17
Average standard deviation of split frequencies: 0.007874
760500 -- (-392.465) (-389.384) [-386.694] (-385.316) * (-387.450) (-385.531) (-386.533) [-387.158] -- 0:00:17
761000 -- (-387.500) (-386.548) [-388.599] (-387.312) * (-388.520) (-390.504) [-388.347] (-387.337) -- 0:00:17
761500 -- [-386.200] (-385.379) (-387.827) (-385.619) * (-387.471) (-386.082) (-386.410) [-388.088] -- 0:00:17
762000 -- (-387.241) (-385.537) (-385.838) [-388.501] * (-386.738) (-386.554) [-388.920] (-390.217) -- 0:00:17
762500 -- (-387.497) (-387.093) [-385.991] (-390.945) * (-388.917) (-386.176) [-384.884] (-386.070) -- 0:00:17
763000 -- (-389.563) [-386.616] (-386.477) (-387.137) * [-387.522] (-385.372) (-386.410) (-388.258) -- 0:00:17
763500 -- (-385.474) [-387.108] (-388.353) (-387.586) * (-386.777) (-386.334) (-388.088) [-386.886] -- 0:00:17
764000 -- (-387.861) (-387.077) (-385.012) [-387.012] * (-387.455) (-385.364) [-385.861] (-386.731) -- 0:00:16
764500 -- (-386.292) (-386.053) [-385.903] (-387.000) * [-385.380] (-385.879) (-384.912) (-386.346) -- 0:00:16
765000 -- (-386.365) (-387.782) [-386.687] (-388.889) * [-386.643] (-387.693) (-385.998) (-391.865) -- 0:00:16
Average standard deviation of split frequencies: 0.007892
765500 -- [-384.990] (-389.898) (-387.603) (-387.691) * (-386.210) [-386.374] (-387.524) (-386.760) -- 0:00:16
766000 -- [-385.498] (-386.173) (-389.298) (-385.362) * [-390.679] (-389.604) (-388.193) (-385.563) -- 0:00:16
766500 -- (-385.516) [-387.570] (-389.378) (-385.639) * [-387.282] (-387.636) (-386.108) (-390.240) -- 0:00:16
767000 -- (-388.712) [-384.798] (-388.069) (-389.798) * [-388.271] (-395.506) (-387.003) (-386.350) -- 0:00:17
767500 -- (-388.845) (-385.950) (-387.359) [-386.053] * [-385.858] (-385.106) (-386.645) (-384.995) -- 0:00:16
768000 -- (-388.422) (-386.372) (-388.693) [-385.597] * [-388.577] (-389.160) (-389.677) (-388.638) -- 0:00:16
768500 -- [-387.213] (-388.435) (-385.721) (-389.698) * [-387.751] (-388.085) (-391.467) (-389.633) -- 0:00:16
769000 -- [-387.253] (-386.092) (-388.590) (-387.523) * [-393.032] (-391.976) (-386.536) (-388.800) -- 0:00:16
769500 -- (-388.126) (-389.041) (-387.867) [-386.697] * (-385.944) (-387.599) [-386.952] (-385.559) -- 0:00:16
770000 -- (-385.993) [-386.946] (-387.302) (-387.403) * (-385.992) (-390.329) (-385.085) [-386.223] -- 0:00:16
Average standard deviation of split frequencies: 0.007952
770500 -- (-387.604) [-387.982] (-388.573) (-388.348) * [-386.761] (-394.855) (-385.890) (-387.547) -- 0:00:16
771000 -- (-391.068) (-390.147) (-386.783) [-388.229] * (-388.579) (-388.240) [-385.568] (-386.234) -- 0:00:16
771500 -- (-392.367) (-388.963) (-386.734) [-387.379] * (-390.579) (-386.698) [-386.624] (-388.141) -- 0:00:16
772000 -- (-390.729) (-387.314) [-387.393] (-391.818) * (-386.692) (-388.528) (-385.418) [-387.909] -- 0:00:16
772500 -- [-386.386] (-386.393) (-387.326) (-385.634) * (-388.460) (-394.183) [-392.774] (-390.049) -- 0:00:16
773000 -- (-386.744) (-386.445) [-387.317] (-390.590) * (-386.951) (-386.024) (-389.400) [-386.834] -- 0:00:16
773500 -- [-386.771] (-385.460) (-389.960) (-386.124) * (-387.546) (-388.918) (-386.531) [-386.119] -- 0:00:16
774000 -- (-385.536) [-386.166] (-388.531) (-390.141) * [-385.665] (-390.539) (-391.178) (-385.843) -- 0:00:16
774500 -- (-389.450) (-387.483) [-387.390] (-386.947) * (-386.118) (-385.731) (-388.179) [-385.053] -- 0:00:16
775000 -- [-389.019] (-388.696) (-386.126) (-386.215) * (-384.929) (-386.486) [-387.565] (-386.066) -- 0:00:16
Average standard deviation of split frequencies: 0.007361
775500 -- (-386.402) (-387.393) [-384.709] (-386.383) * (-386.277) (-386.418) [-389.849] (-389.705) -- 0:00:16
776000 -- [-386.214] (-387.195) (-384.926) (-387.006) * (-387.698) (-388.559) [-385.293] (-387.526) -- 0:00:16
776500 -- (-386.517) [-387.156] (-387.435) (-385.656) * (-387.974) (-385.257) [-387.930] (-390.748) -- 0:00:16
777000 -- [-385.996] (-385.615) (-385.671) (-385.601) * (-387.381) [-387.143] (-386.208) (-388.615) -- 0:00:16
777500 -- (-386.821) (-389.525) [-387.402] (-386.526) * (-387.869) (-386.573) [-386.846] (-391.764) -- 0:00:16
778000 -- [-385.897] (-388.251) (-387.160) (-388.784) * (-387.377) [-390.111] (-390.921) (-387.102) -- 0:00:15
778500 -- (-389.998) [-387.539] (-392.198) (-386.880) * (-388.522) (-388.884) (-391.065) [-386.409] -- 0:00:15
779000 -- (-388.963) (-385.765) [-390.158] (-390.062) * (-386.025) (-387.469) (-387.556) [-386.171] -- 0:00:15
779500 -- (-385.235) [-389.113] (-389.906) (-387.996) * [-384.954] (-388.944) (-386.265) (-386.772) -- 0:00:15
780000 -- [-386.927] (-387.849) (-387.716) (-388.045) * (-388.790) (-386.116) (-386.254) [-386.696] -- 0:00:15
Average standard deviation of split frequencies: 0.007495
780500 -- (-387.897) (-388.516) [-386.808] (-389.329) * (-386.381) (-386.200) [-386.237] (-387.785) -- 0:00:15
781000 -- (-386.119) (-386.718) [-388.480] (-387.009) * (-386.168) (-387.010) (-386.424) [-385.376] -- 0:00:15
781500 -- (-386.611) [-387.706] (-387.581) (-387.063) * (-387.489) (-386.494) (-385.255) [-386.767] -- 0:00:15
782000 -- [-385.522] (-387.563) (-385.719) (-385.989) * (-385.376) (-387.066) [-387.372] (-388.370) -- 0:00:15
782500 -- (-386.220) [-385.986] (-386.600) (-385.760) * (-386.498) (-387.553) [-390.555] (-385.471) -- 0:00:15
783000 -- (-386.984) (-386.512) (-389.698) [-385.277] * (-389.559) [-389.894] (-391.442) (-386.668) -- 0:00:15
783500 -- (-385.435) (-386.748) [-387.382] (-386.620) * (-387.328) [-388.237] (-390.106) (-389.033) -- 0:00:15
784000 -- (-387.671) (-388.536) (-390.248) [-385.987] * [-387.610] (-387.970) (-388.181) (-386.135) -- 0:00:15
784500 -- [-386.421] (-388.560) (-386.755) (-384.933) * (-389.439) (-389.554) (-388.571) [-385.824] -- 0:00:15
785000 -- (-386.819) (-385.081) (-385.350) [-385.095] * (-391.902) [-387.084] (-385.861) (-386.623) -- 0:00:15
Average standard deviation of split frequencies: 0.007903
785500 -- [-389.549] (-387.826) (-387.471) (-386.042) * (-392.793) [-386.534] (-388.656) (-386.767) -- 0:00:15
786000 -- (-387.976) [-386.235] (-386.482) (-385.121) * (-387.119) [-385.961] (-388.057) (-386.711) -- 0:00:15
786500 -- (-387.999) (-385.431) (-389.099) [-386.456] * [-385.976] (-386.512) (-385.375) (-385.200) -- 0:00:15
787000 -- (-388.288) (-389.047) [-386.424] (-388.978) * (-387.264) (-386.952) [-392.033] (-385.836) -- 0:00:15
787500 -- (-386.681) [-387.814] (-385.962) (-391.584) * (-389.115) [-385.115] (-385.027) (-386.242) -- 0:00:15
788000 -- (-390.369) (-391.467) [-384.991] (-390.227) * (-386.500) (-387.010) (-388.128) [-387.831] -- 0:00:15
788500 -- (-390.204) (-387.981) [-385.029] (-385.211) * [-386.475] (-391.197) (-391.354) (-386.786) -- 0:00:15
789000 -- [-386.611] (-387.215) (-385.449) (-387.790) * (-389.033) (-390.157) [-385.781] (-386.539) -- 0:00:15
789500 -- [-386.537] (-385.667) (-385.531) (-387.534) * [-388.547] (-387.530) (-385.232) (-387.555) -- 0:00:15
790000 -- (-388.643) (-390.662) (-385.199) [-386.058] * (-389.939) (-394.698) [-386.029] (-386.535) -- 0:00:15
Average standard deviation of split frequencies: 0.007891
790500 -- [-387.634] (-389.783) (-389.380) (-386.713) * (-386.637) (-389.830) (-392.131) [-385.672] -- 0:00:15
791000 -- [-396.461] (-394.628) (-386.833) (-389.394) * [-385.227] (-386.328) (-386.290) (-388.787) -- 0:00:15
791500 -- (-392.415) [-385.780] (-388.040) (-386.959) * [-388.816] (-393.435) (-385.520) (-386.175) -- 0:00:15
792000 -- (-390.984) (-388.399) [-386.286] (-388.326) * (-389.320) (-390.783) (-388.748) [-386.518] -- 0:00:14
792500 -- (-387.185) (-386.146) (-388.508) [-387.468] * [-388.708] (-388.469) (-386.857) (-390.055) -- 0:00:14
793000 -- (-388.791) (-386.177) (-387.151) [-386.721] * (-388.325) [-387.973] (-386.093) (-391.123) -- 0:00:14
793500 -- (-385.800) (-390.744) (-389.164) [-387.488] * [-387.671] (-386.006) (-385.899) (-389.961) -- 0:00:14
794000 -- [-385.832] (-387.570) (-385.411) (-386.531) * [-388.111] (-387.756) (-387.761) (-387.470) -- 0:00:14
794500 -- [-387.667] (-386.679) (-387.010) (-387.143) * (-386.915) (-384.714) [-386.174] (-386.240) -- 0:00:14
795000 -- (-385.761) (-385.521) (-388.481) [-385.711] * (-387.270) (-384.867) [-385.992] (-387.054) -- 0:00:14
Average standard deviation of split frequencies: 0.007699
795500 -- (-387.974) (-391.282) (-389.161) [-386.747] * [-385.940] (-389.069) (-389.502) (-386.394) -- 0:00:14
796000 -- (-390.827) [-387.737] (-387.003) (-388.572) * (-387.477) [-385.803] (-385.040) (-386.375) -- 0:00:14
796500 -- (-386.056) [-386.590] (-386.265) (-388.752) * (-385.267) (-385.819) (-388.955) [-387.429] -- 0:00:14
797000 -- (-391.604) (-389.342) [-385.922] (-390.129) * (-387.485) (-389.478) (-385.255) [-387.005] -- 0:00:14
797500 -- [-385.315] (-387.717) (-386.110) (-389.021) * (-388.615) [-386.721] (-385.071) (-390.231) -- 0:00:14
798000 -- (-389.665) (-386.949) [-385.201] (-386.726) * [-387.861] (-388.643) (-385.471) (-393.037) -- 0:00:14
798500 -- (-391.884) (-385.874) [-385.388] (-387.865) * (-388.747) (-386.913) (-385.812) [-391.159] -- 0:00:14
799000 -- [-386.322] (-387.940) (-388.432) (-390.859) * (-385.546) (-387.105) (-388.079) [-386.292] -- 0:00:14
799500 -- (-387.125) (-385.679) (-390.296) [-385.455] * (-388.299) (-387.583) [-385.748] (-388.051) -- 0:00:14
800000 -- (-392.209) (-386.794) (-389.498) [-389.292] * (-386.997) (-388.586) (-385.441) [-388.124] -- 0:00:14
Average standard deviation of split frequencies: 0.007912
800500 -- (-388.148) (-385.262) (-390.468) [-393.935] * [-389.967] (-388.675) (-387.908) (-389.100) -- 0:00:14
801000 -- (-387.511) [-386.247] (-386.010) (-389.898) * (-390.885) [-386.905] (-386.065) (-389.936) -- 0:00:14
801500 -- (-389.601) (-386.178) [-389.740] (-388.405) * (-387.993) (-386.949) [-388.150] (-387.136) -- 0:00:14
802000 -- (-385.710) (-386.077) [-386.743] (-386.755) * (-386.517) [-387.462] (-384.867) (-386.849) -- 0:00:14
802500 -- (-387.615) [-386.911] (-386.225) (-388.406) * (-385.882) (-387.695) (-385.186) [-389.088] -- 0:00:14
803000 -- (-387.193) (-387.404) (-388.052) [-387.737] * (-386.496) (-385.248) (-389.196) [-387.471] -- 0:00:14
803500 -- [-386.641] (-387.316) (-385.858) (-388.577) * (-387.002) [-386.452] (-387.983) (-388.044) -- 0:00:14
804000 -- (-387.388) [-386.400] (-387.831) (-390.856) * [-385.521] (-386.244) (-386.594) (-389.406) -- 0:00:14
804500 -- (-386.629) (-386.981) [-387.868] (-386.597) * (-386.740) (-385.545) (-387.080) [-387.274] -- 0:00:14
805000 -- [-385.970] (-385.843) (-385.749) (-387.752) * (-388.029) (-388.441) (-386.829) [-385.198] -- 0:00:14
Average standard deviation of split frequencies: 0.007750
805500 -- (-385.143) (-389.731) (-390.267) [-386.039] * (-388.880) [-386.252] (-387.506) (-384.622) -- 0:00:14
806000 -- [-385.634] (-386.266) (-385.391) (-385.862) * (-387.218) (-384.825) [-385.691] (-389.797) -- 0:00:13
806500 -- (-388.178) (-386.415) [-387.269] (-388.844) * (-385.273) (-385.360) (-390.637) [-386.199] -- 0:00:13
807000 -- (-389.436) (-389.669) [-386.279] (-385.385) * (-391.539) (-386.412) [-387.510] (-386.938) -- 0:00:13
807500 -- (-390.713) [-389.295] (-390.401) (-385.962) * (-390.833) (-385.998) [-387.264] (-388.406) -- 0:00:13
808000 -- [-390.617] (-388.072) (-385.885) (-388.056) * (-393.465) [-385.949] (-386.722) (-388.312) -- 0:00:13
808500 -- [-387.654] (-385.741) (-387.333) (-385.058) * (-385.323) (-387.533) [-388.031] (-387.361) -- 0:00:13
809000 -- (-388.585) (-386.315) [-386.270] (-385.220) * (-386.326) (-386.191) [-388.584] (-386.861) -- 0:00:13
809500 -- (-386.298) (-388.109) [-386.263] (-387.230) * (-386.689) (-385.763) [-387.540] (-386.947) -- 0:00:13
810000 -- (-387.775) (-386.660) [-386.386] (-388.694) * (-386.079) (-390.529) [-386.329] (-385.446) -- 0:00:13
Average standard deviation of split frequencies: 0.007523
810500 -- (-389.780) (-387.870) [-388.162] (-386.463) * (-385.903) [-386.402] (-387.903) (-386.215) -- 0:00:13
811000 -- (-386.438) [-385.788] (-385.699) (-386.043) * (-393.680) [-385.621] (-390.050) (-389.323) -- 0:00:13
811500 -- (-388.233) [-385.327] (-385.025) (-385.646) * (-387.319) [-387.205] (-386.202) (-389.115) -- 0:00:13
812000 -- (-384.637) (-385.657) [-386.031] (-385.699) * (-385.743) [-386.872] (-387.466) (-388.215) -- 0:00:13
812500 -- (-387.623) (-386.510) [-387.503] (-389.329) * (-385.865) (-385.914) [-385.172] (-389.381) -- 0:00:13
813000 -- (-385.361) (-386.142) (-388.308) [-386.157] * [-387.140] (-385.272) (-392.220) (-386.813) -- 0:00:13
813500 -- (-385.187) [-386.200] (-388.947) (-386.307) * [-389.564] (-386.683) (-389.297) (-386.052) -- 0:00:13
814000 -- [-385.805] (-394.898) (-384.869) (-392.334) * (-387.116) (-387.172) (-387.743) [-389.606] -- 0:00:13
814500 -- (-388.177) [-385.498] (-385.371) (-389.490) * (-385.566) (-387.945) (-387.483) [-386.782] -- 0:00:13
815000 -- (-386.165) [-386.858] (-387.511) (-388.872) * (-388.732) (-385.768) (-393.214) [-387.820] -- 0:00:13
Average standard deviation of split frequencies: 0.007438
815500 -- (-385.712) [-386.417] (-391.317) (-388.817) * [-387.331] (-387.133) (-387.574) (-390.459) -- 0:00:13
816000 -- (-386.681) (-388.997) [-387.786] (-394.134) * [-386.775] (-387.443) (-386.091) (-385.719) -- 0:00:13
816500 -- (-387.160) (-389.937) (-385.576) [-388.116] * (-388.204) (-386.278) (-390.542) [-386.925] -- 0:00:13
817000 -- (-385.651) [-386.619] (-385.563) (-389.089) * [-385.812] (-385.901) (-388.468) (-386.124) -- 0:00:13
817500 -- (-385.305) (-386.564) [-385.176] (-390.071) * [-386.600] (-386.140) (-386.213) (-388.998) -- 0:00:13
818000 -- (-387.484) (-385.174) [-386.224] (-385.711) * (-387.033) [-386.167] (-385.464) (-386.699) -- 0:00:13
818500 -- [-386.702] (-386.843) (-385.564) (-386.508) * [-388.684] (-385.947) (-387.500) (-392.010) -- 0:00:13
819000 -- (-385.614) (-390.122) (-388.812) [-391.419] * (-387.186) [-391.754] (-386.975) (-385.854) -- 0:00:13
819500 -- (-385.982) (-391.915) [-387.684] (-390.779) * (-389.230) (-388.225) (-385.962) [-386.629] -- 0:00:12
820000 -- (-388.760) [-384.984] (-388.328) (-391.031) * [-390.527] (-386.080) (-386.094) (-389.452) -- 0:00:12
Average standard deviation of split frequencies: 0.007647
820500 -- (-391.439) (-384.893) (-384.716) [-387.973] * (-386.721) (-386.222) (-392.907) [-391.590] -- 0:00:12
821000 -- (-395.487) (-386.704) [-384.864] (-387.660) * [-386.560] (-391.037) (-386.843) (-387.809) -- 0:00:12
821500 -- (-387.268) (-389.826) (-388.028) [-385.580] * [-386.230] (-391.606) (-387.113) (-389.316) -- 0:00:12
822000 -- [-388.273] (-390.082) (-388.900) (-386.819) * (-387.837) [-385.978] (-387.497) (-387.722) -- 0:00:12
822500 -- (-386.194) (-392.403) (-388.605) [-387.085] * (-387.599) (-386.546) [-389.290] (-390.867) -- 0:00:12
823000 -- (-387.916) (-389.241) [-385.345] (-385.783) * [-386.829] (-386.921) (-388.256) (-387.481) -- 0:00:12
823500 -- (-386.524) [-386.732] (-391.058) (-390.146) * (-385.525) (-390.967) (-389.950) [-389.243] -- 0:00:12
824000 -- (-385.103) [-386.450] (-386.778) (-387.626) * (-386.137) (-387.228) (-386.341) [-388.078] -- 0:00:12
824500 -- [-390.358] (-386.448) (-386.817) (-387.606) * (-386.893) [-386.893] (-387.954) (-387.085) -- 0:00:12
825000 -- (-386.810) (-386.676) [-385.588] (-386.644) * [-388.877] (-388.141) (-387.794) (-386.783) -- 0:00:12
Average standard deviation of split frequencies: 0.007218
825500 -- [-387.578] (-386.744) (-387.166) (-388.055) * (-388.565) (-385.613) [-386.203] (-386.078) -- 0:00:12
826000 -- [-386.899] (-386.443) (-388.568) (-388.119) * (-388.008) (-385.503) (-394.414) [-388.953] -- 0:00:12
826500 -- (-386.441) (-386.085) (-391.872) [-386.355] * (-386.543) [-387.444] (-386.691) (-385.539) -- 0:00:12
827000 -- (-387.908) [-389.037] (-388.991) (-387.003) * (-388.689) (-386.387) (-386.020) [-386.066] -- 0:00:12
827500 -- (-385.531) [-388.030] (-387.131) (-386.315) * (-388.348) [-387.944] (-384.767) (-389.993) -- 0:00:12
828000 -- [-385.701] (-386.829) (-388.886) (-385.813) * (-385.777) [-387.780] (-387.279) (-386.340) -- 0:00:12
828500 -- (-389.054) [-385.178] (-386.007) (-385.629) * [-385.767] (-388.163) (-390.041) (-389.550) -- 0:00:12
829000 -- [-385.870] (-389.141) (-389.132) (-387.679) * (-388.618) [-387.378] (-385.878) (-386.917) -- 0:00:12
829500 -- (-388.475) (-386.142) [-387.614] (-386.368) * (-386.220) [-387.232] (-385.744) (-388.335) -- 0:00:12
830000 -- (-386.080) (-386.428) [-386.382] (-386.712) * (-386.308) (-385.663) [-388.664] (-387.174) -- 0:00:12
Average standard deviation of split frequencies: 0.007590
830500 -- [-385.622] (-390.245) (-386.529) (-385.087) * (-388.445) (-386.430) [-386.892] (-387.730) -- 0:00:12
831000 -- [-390.374] (-388.308) (-387.598) (-387.556) * (-384.788) (-385.256) (-385.175) [-389.718] -- 0:00:12
831500 -- (-390.843) (-385.583) (-390.739) [-386.919] * [-387.555] (-387.220) (-385.379) (-385.542) -- 0:00:12
832000 -- (-387.425) (-386.888) (-387.978) [-387.555] * (-385.304) (-385.232) (-387.873) [-384.978] -- 0:00:12
832500 -- (-385.860) [-387.774] (-386.848) (-386.185) * (-386.016) (-392.832) (-387.210) [-384.955] -- 0:00:12
833000 -- (-390.300) (-387.703) [-387.671] (-386.433) * [-385.627] (-389.998) (-388.629) (-387.786) -- 0:00:12
833500 -- (-390.599) (-390.725) (-386.388) [-387.027] * (-386.243) (-389.645) [-388.577] (-388.286) -- 0:00:11
834000 -- (-385.863) (-388.050) [-386.754] (-385.800) * [-392.072] (-389.386) (-387.168) (-385.678) -- 0:00:11
834500 -- (-386.162) (-387.969) [-386.106] (-386.242) * [-386.328] (-395.060) (-385.499) (-387.505) -- 0:00:11
835000 -- (-387.756) [-387.550] (-387.323) (-387.966) * (-385.333) (-385.760) (-386.003) [-385.263] -- 0:00:11
Average standard deviation of split frequencies: 0.007824
835500 -- (-385.935) (-386.988) [-390.784] (-386.044) * (-388.181) [-386.384] (-389.864) (-385.275) -- 0:00:11
836000 -- (-390.490) [-391.045] (-385.524) (-386.699) * (-386.202) (-391.068) (-385.801) [-385.001] -- 0:00:11
836500 -- (-387.158) [-387.945] (-388.304) (-385.146) * (-385.854) (-393.220) (-386.043) [-387.913] -- 0:00:11
837000 -- (-386.335) (-389.893) (-387.949) [-388.806] * (-388.630) [-387.120] (-389.576) (-387.273) -- 0:00:11
837500 -- (-386.463) [-385.705] (-386.883) (-388.781) * [-386.492] (-386.686) (-385.731) (-386.634) -- 0:00:11
838000 -- (-386.299) [-385.902] (-384.994) (-387.783) * (-388.844) (-385.899) (-391.449) [-385.641] -- 0:00:11
838500 -- (-385.798) [-386.615] (-385.895) (-385.248) * [-386.725] (-388.650) (-386.616) (-386.283) -- 0:00:11
839000 -- (-388.499) [-387.510] (-389.237) (-389.193) * (-387.549) (-386.205) (-387.438) [-386.740] -- 0:00:11
839500 -- (-386.609) (-390.485) [-387.776] (-391.074) * (-392.171) [-387.722] (-386.332) (-386.584) -- 0:00:11
840000 -- (-384.745) [-391.183] (-386.829) (-386.230) * [-388.301] (-387.046) (-386.624) (-385.864) -- 0:00:11
Average standard deviation of split frequencies: 0.007745
840500 -- (-387.434) (-388.482) [-387.538] (-385.600) * (-391.328) (-386.408) (-391.232) [-385.845] -- 0:00:11
841000 -- (-386.147) (-393.791) [-389.664] (-388.737) * (-387.851) [-387.249] (-386.427) (-388.909) -- 0:00:11
841500 -- (-388.551) (-387.875) (-387.985) [-388.951] * (-385.101) [-387.073] (-385.417) (-390.023) -- 0:00:11
842000 -- (-388.343) [-386.745] (-385.489) (-387.222) * (-389.453) (-386.000) (-385.644) [-388.478] -- 0:00:11
842500 -- [-388.197] (-387.492) (-385.243) (-387.498) * (-387.399) (-385.175) (-386.577) [-386.676] -- 0:00:11
843000 -- (-387.487) [-387.307] (-387.642) (-386.146) * (-391.183) (-396.028) [-387.829] (-386.147) -- 0:00:11
843500 -- (-385.685) (-385.232) (-388.377) [-388.532] * (-386.578) (-387.904) (-388.042) [-386.219] -- 0:00:11
844000 -- (-385.617) (-388.390) (-385.700) [-390.243] * [-387.153] (-387.034) (-388.909) (-386.755) -- 0:00:11
844500 -- (-392.709) [-386.293] (-389.004) (-388.767) * [-386.621] (-386.348) (-387.525) (-385.454) -- 0:00:11
845000 -- [-386.001] (-386.753) (-387.564) (-385.823) * (-387.860) [-384.777] (-389.382) (-385.128) -- 0:00:11
Average standard deviation of split frequencies: 0.007557
845500 -- (-387.030) (-388.897) [-386.270] (-385.243) * (-385.897) (-385.835) [-387.359] (-386.229) -- 0:00:11
846000 -- (-389.545) [-390.273] (-386.652) (-386.579) * [-390.503] (-390.795) (-385.808) (-388.310) -- 0:00:11
846500 -- [-387.326] (-387.896) (-386.438) (-387.155) * (-386.694) (-393.507) (-387.003) [-389.934] -- 0:00:11
847000 -- (-386.882) (-385.728) (-385.603) [-390.198] * (-386.685) (-387.511) [-389.841] (-387.494) -- 0:00:11
847500 -- (-386.546) (-386.438) (-388.993) [-386.650] * [-386.249] (-388.200) (-385.871) (-386.930) -- 0:00:10
848000 -- (-385.392) (-385.083) [-386.817] (-385.667) * [-388.901] (-389.647) (-387.015) (-388.161) -- 0:00:10
848500 -- [-385.934] (-385.045) (-388.018) (-386.957) * [-386.580] (-387.569) (-386.118) (-387.363) -- 0:00:10
849000 -- (-390.413) [-388.813] (-387.003) (-385.716) * (-389.286) (-389.177) (-388.171) [-390.220] -- 0:00:10
849500 -- (-386.449) [-390.216] (-386.292) (-385.939) * [-387.338] (-386.813) (-386.281) (-388.634) -- 0:00:10
850000 -- (-389.026) [-386.283] (-386.327) (-388.684) * (-385.211) (-388.211) [-386.387] (-390.369) -- 0:00:10
Average standard deviation of split frequencies: 0.007654
850500 -- (-393.298) (-386.915) (-387.425) [-389.264] * [-386.754] (-389.659) (-385.917) (-389.806) -- 0:00:10
851000 -- (-391.243) [-386.882] (-385.646) (-386.251) * (-387.349) [-386.430] (-392.794) (-386.632) -- 0:00:10
851500 -- (-387.422) (-391.525) (-386.243) [-387.047] * [-385.259] (-388.762) (-389.685) (-386.315) -- 0:00:10
852000 -- (-385.254) (-388.011) [-388.113] (-392.134) * (-385.221) (-391.785) [-388.361] (-389.450) -- 0:00:10
852500 -- (-387.481) (-387.589) [-386.323] (-391.323) * [-386.661] (-387.872) (-390.338) (-387.180) -- 0:00:10
853000 -- [-385.795] (-385.509) (-387.301) (-385.817) * (-385.416) (-385.788) (-387.710) [-387.258] -- 0:00:10
853500 -- (-387.505) (-390.807) (-390.410) [-388.013] * (-387.531) [-388.066] (-385.358) (-387.582) -- 0:00:10
854000 -- [-388.679] (-389.545) (-389.014) (-385.314) * (-385.394) (-390.249) (-387.024) [-386.638] -- 0:00:10
854500 -- (-388.537) (-387.933) [-386.147] (-388.135) * [-386.563] (-386.594) (-385.605) (-388.835) -- 0:00:10
855000 -- (-386.633) (-390.164) (-387.772) [-388.115] * [-385.252] (-390.582) (-388.179) (-394.173) -- 0:00:10
Average standard deviation of split frequencies: 0.007366
855500 -- [-387.730] (-386.904) (-394.857) (-386.293) * [-385.495] (-387.056) (-385.913) (-392.544) -- 0:00:10
856000 -- [-389.275] (-386.966) (-390.178) (-386.202) * [-387.232] (-384.932) (-389.880) (-390.363) -- 0:00:10
856500 -- (-388.144) (-387.715) (-386.841) [-385.996] * (-386.219) (-384.926) [-387.597] (-389.078) -- 0:00:10
857000 -- (-387.491) [-385.014] (-386.179) (-386.898) * (-385.417) (-384.707) [-389.234] (-389.825) -- 0:00:10
857500 -- (-385.154) [-385.404] (-387.332) (-386.862) * [-388.087] (-385.310) (-388.086) (-386.557) -- 0:00:10
858000 -- (-385.450) (-386.882) (-386.724) [-386.712] * (-388.150) (-387.008) (-385.668) [-385.383] -- 0:00:10
858500 -- (-385.179) (-386.738) [-386.285] (-389.557) * [-388.996] (-386.594) (-388.505) (-385.729) -- 0:00:10
859000 -- (-386.633) [-385.964] (-391.969) (-389.881) * (-388.619) [-385.698] (-391.243) (-387.185) -- 0:00:10
859500 -- (-386.370) (-387.293) [-387.191] (-387.307) * [-385.662] (-386.192) (-389.298) (-397.435) -- 0:00:10
860000 -- (-386.753) (-385.048) [-386.727] (-387.831) * (-386.116) (-385.890) [-386.688] (-391.538) -- 0:00:10
Average standard deviation of split frequencies: 0.007600
860500 -- (-386.644) (-392.288) [-385.725] (-388.006) * (-388.111) (-387.113) (-385.754) [-385.215] -- 0:00:10
861000 -- (-389.483) (-387.594) [-389.071] (-385.195) * (-385.688) (-391.020) (-392.216) [-389.153] -- 0:00:10
861500 -- (-387.863) [-389.527] (-387.187) (-385.035) * [-387.341] (-386.597) (-386.858) (-386.503) -- 0:00:09
862000 -- (-386.555) (-387.291) (-387.343) [-386.154] * (-387.296) [-386.553] (-389.377) (-392.662) -- 0:00:09
862500 -- (-387.392) [-388.189] (-387.307) (-385.220) * [-386.578] (-387.853) (-385.844) (-391.172) -- 0:00:09
863000 -- (-385.416) [-389.405] (-387.056) (-387.450) * [-385.683] (-387.256) (-386.861) (-386.317) -- 0:00:09
863500 -- [-385.502] (-387.342) (-387.629) (-385.871) * (-386.861) (-388.485) [-386.536] (-388.791) -- 0:00:09
864000 -- (-386.436) (-386.900) [-385.319] (-387.646) * (-385.137) [-387.090] (-386.956) (-392.601) -- 0:00:09
864500 -- (-386.686) [-386.953] (-385.320) (-386.631) * (-385.973) (-389.838) (-386.525) [-387.906] -- 0:00:09
865000 -- [-386.663] (-392.332) (-386.639) (-391.401) * (-388.152) (-389.084) [-389.870] (-387.938) -- 0:00:09
Average standard deviation of split frequencies: 0.007349
865500 -- [-387.070] (-386.800) (-384.751) (-386.162) * [-387.838] (-387.416) (-388.218) (-386.322) -- 0:00:09
866000 -- (-385.995) (-385.572) [-386.383] (-385.894) * (-387.526) (-385.360) [-390.358] (-386.296) -- 0:00:09
866500 -- (-387.709) (-385.275) [-385.206] (-385.526) * (-387.769) [-387.237] (-388.440) (-387.164) -- 0:00:09
867000 -- (-388.736) (-386.600) (-384.746) [-386.248] * (-389.081) (-386.568) [-390.563] (-387.579) -- 0:00:09
867500 -- (-392.717) [-385.188] (-386.022) (-385.222) * (-386.183) [-390.023] (-390.734) (-387.372) -- 0:00:09
868000 -- (-395.020) [-386.048] (-386.566) (-385.319) * (-385.695) [-386.742] (-393.781) (-386.667) -- 0:00:09
868500 -- (-390.968) (-386.554) (-388.412) [-385.012] * [-385.670] (-385.415) (-386.943) (-385.623) -- 0:00:09
869000 -- (-387.390) [-390.677] (-390.687) (-385.569) * (-389.078) [-389.437] (-388.565) (-388.295) -- 0:00:09
869500 -- (-388.333) (-389.360) [-392.256] (-385.019) * [-388.658] (-389.543) (-386.244) (-386.513) -- 0:00:09
870000 -- (-386.085) (-386.286) (-384.988) [-385.680] * (-387.711) (-385.312) (-388.458) [-387.588] -- 0:00:09
Average standard deviation of split frequencies: 0.007512
870500 -- [-386.611] (-387.140) (-387.796) (-387.514) * [-391.437] (-388.334) (-386.142) (-387.219) -- 0:00:09
871000 -- (-386.672) [-386.696] (-387.195) (-385.710) * (-388.575) [-389.933] (-385.706) (-385.572) -- 0:00:09
871500 -- (-386.836) (-386.880) [-387.524] (-386.662) * [-387.429] (-386.573) (-387.619) (-386.955) -- 0:00:09
872000 -- (-386.289) [-387.113] (-386.083) (-387.427) * (-390.333) (-386.860) (-386.452) [-386.560] -- 0:00:09
872500 -- (-386.760) (-388.409) (-385.089) [-386.652] * (-386.280) (-385.225) (-388.160) [-387.321] -- 0:00:09
873000 -- (-385.829) (-387.940) [-385.466] (-389.073) * (-386.099) [-386.811] (-389.038) (-388.388) -- 0:00:09
873500 -- (-385.615) (-388.770) [-386.473] (-387.990) * [-385.388] (-386.533) (-387.084) (-390.682) -- 0:00:09
874000 -- (-387.203) [-389.963] (-384.884) (-387.944) * [-385.615] (-387.034) (-385.740) (-391.867) -- 0:00:09
874500 -- (-386.062) (-385.790) [-385.047] (-387.342) * (-387.812) [-385.873] (-385.399) (-386.674) -- 0:00:09
875000 -- (-386.476) (-389.142) [-387.481] (-385.406) * (-387.068) (-389.637) (-388.601) [-385.925] -- 0:00:09
Average standard deviation of split frequencies: 0.007164
875500 -- (-387.078) (-393.097) (-385.542) [-388.639] * (-386.938) (-389.634) (-388.152) [-385.896] -- 0:00:08
876000 -- (-388.297) (-390.018) (-386.238) [-390.515] * (-386.303) (-390.021) (-387.259) [-388.289] -- 0:00:08
876500 -- [-386.745] (-389.999) (-393.097) (-390.987) * (-385.536) (-387.170) [-390.035] (-385.291) -- 0:00:08
877000 -- [-385.820] (-387.728) (-388.400) (-389.828) * (-391.661) (-390.578) (-389.866) [-391.905] -- 0:00:08
877500 -- [-391.706] (-388.951) (-385.408) (-386.351) * (-390.102) (-387.082) (-390.962) [-389.346] -- 0:00:08
878000 -- (-390.198) (-387.149) (-385.698) [-388.274] * (-387.582) (-387.103) [-385.575] (-388.446) -- 0:00:08
878500 -- [-387.806] (-387.758) (-385.565) (-390.394) * [-389.233] (-387.505) (-385.632) (-386.807) -- 0:00:08
879000 -- (-387.517) (-385.558) (-386.644) [-385.499] * (-388.923) (-390.608) (-388.844) [-385.832] -- 0:00:08
879500 -- (-387.728) (-388.500) (-387.861) [-386.686] * (-387.148) (-389.546) (-390.091) [-387.188] -- 0:00:08
880000 -- (-387.562) (-389.618) [-389.199] (-392.722) * (-389.289) (-388.326) [-387.190] (-385.715) -- 0:00:08
Average standard deviation of split frequencies: 0.006992
880500 -- (-386.898) (-388.571) [-389.796] (-390.999) * (-385.558) (-386.743) (-387.635) [-385.667] -- 0:00:08
881000 -- [-385.613] (-386.082) (-389.472) (-390.326) * (-388.123) [-387.924] (-389.823) (-391.623) -- 0:00:08
881500 -- (-385.242) (-389.252) [-391.649] (-389.121) * (-388.447) (-388.550) (-389.281) [-387.809] -- 0:00:08
882000 -- (-386.124) (-386.038) [-386.563] (-386.079) * [-390.446] (-387.740) (-386.724) (-386.127) -- 0:00:08
882500 -- (-391.672) [-386.256] (-387.928) (-385.784) * (-387.164) [-386.433] (-386.213) (-389.166) -- 0:00:08
883000 -- (-385.984) (-385.382) [-386.010] (-387.550) * (-386.194) (-387.438) [-387.329] (-388.474) -- 0:00:08
883500 -- (-387.878) (-391.996) [-385.660] (-390.410) * (-385.644) (-387.629) (-390.138) [-389.303] -- 0:00:08
884000 -- (-386.073) (-386.842) (-385.260) [-389.131] * (-386.152) (-388.821) (-386.995) [-385.450] -- 0:00:08
884500 -- (-385.376) (-386.248) [-385.464] (-387.208) * (-386.138) (-388.821) [-388.892] (-388.115) -- 0:00:08
885000 -- (-389.827) (-385.738) (-386.533) [-386.544] * (-387.981) (-388.169) (-387.728) [-387.480] -- 0:00:08
Average standard deviation of split frequencies: 0.007050
885500 -- (-393.384) [-389.078] (-388.395) (-385.107) * (-386.863) [-385.585] (-387.063) (-385.837) -- 0:00:08
886000 -- (-388.892) (-392.758) (-386.085) [-385.415] * (-387.765) [-387.692] (-385.944) (-389.101) -- 0:00:08
886500 -- [-389.290] (-386.650) (-386.981) (-385.433) * (-387.610) (-389.455) [-385.419] (-391.345) -- 0:00:08
887000 -- [-385.567] (-387.967) (-387.354) (-385.326) * (-388.751) (-385.201) (-386.878) [-389.630] -- 0:00:08
887500 -- [-386.808] (-385.896) (-391.443) (-388.351) * (-387.158) (-388.730) (-387.288) [-389.210] -- 0:00:08
888000 -- (-385.940) (-387.647) [-386.507] (-388.629) * (-388.532) (-385.133) [-388.789] (-386.059) -- 0:00:08
888500 -- (-388.843) [-387.077] (-386.832) (-386.732) * (-388.105) (-385.098) (-385.248) [-387.779] -- 0:00:08
889000 -- (-386.941) [-386.965] (-388.106) (-386.839) * [-387.474] (-385.152) (-385.433) (-389.238) -- 0:00:07
889500 -- [-390.549] (-385.152) (-388.299) (-387.280) * (-389.570) (-385.854) [-384.879] (-387.034) -- 0:00:07
890000 -- (-391.129) (-385.591) [-387.806] (-387.571) * [-386.349] (-385.471) (-393.376) (-393.914) -- 0:00:07
Average standard deviation of split frequencies: 0.006748
890500 -- (-391.691) (-386.002) (-388.855) [-386.265] * (-386.913) (-386.865) (-385.793) [-385.790] -- 0:00:07
891000 -- (-391.962) (-385.982) (-388.822) [-386.373] * (-386.945) (-387.436) [-385.501] (-385.837) -- 0:00:07
891500 -- (-391.632) [-387.370] (-385.930) (-388.357) * (-388.846) (-386.371) (-387.221) [-387.251] -- 0:00:07
892000 -- (-392.589) [-387.419] (-386.775) (-386.678) * (-388.902) (-387.502) (-386.681) [-385.369] -- 0:00:07
892500 -- [-386.975] (-385.896) (-390.017) (-385.105) * (-387.761) (-388.731) (-392.182) [-387.822] -- 0:00:07
893000 -- (-393.916) [-386.209] (-390.104) (-388.836) * (-386.803) (-390.041) (-387.837) [-387.909] -- 0:00:07
893500 -- [-389.166] (-387.711) (-386.502) (-389.514) * [-388.340] (-388.237) (-386.642) (-387.762) -- 0:00:07
894000 -- (-387.647) (-391.378) (-387.063) [-389.524] * (-389.013) (-388.218) (-388.110) [-388.098] -- 0:00:07
894500 -- (-386.989) [-388.481] (-387.478) (-386.043) * (-389.006) (-386.635) (-390.816) [-388.333] -- 0:00:07
895000 -- (-386.418) (-388.481) (-385.487) [-387.542] * (-390.850) (-387.351) [-393.725] (-389.380) -- 0:00:07
Average standard deviation of split frequencies: 0.007103
895500 -- (-385.919) (-387.716) (-385.625) [-387.955] * (-386.266) (-387.733) [-387.055] (-387.752) -- 0:00:07
896000 -- (-392.893) (-385.984) [-384.870] (-386.698) * (-391.909) (-385.619) [-387.710] (-386.144) -- 0:00:07
896500 -- (-385.652) (-387.341) [-385.813] (-387.555) * [-385.408] (-387.831) (-386.122) (-385.962) -- 0:00:07
897000 -- (-385.140) (-387.040) [-386.148] (-386.409) * (-388.055) (-393.136) (-385.845) [-385.464] -- 0:00:07
897500 -- (-389.508) [-390.719] (-386.217) (-385.332) * (-389.067) [-386.978] (-388.030) (-385.608) -- 0:00:07
898000 -- (-388.724) (-388.191) (-385.213) [-387.095] * (-391.954) (-389.892) [-390.397] (-387.734) -- 0:00:07
898500 -- [-388.128] (-389.188) (-385.266) (-387.154) * (-388.602) (-385.517) [-384.974] (-386.701) -- 0:00:07
899000 -- (-393.954) [-387.442] (-385.266) (-387.632) * (-386.257) (-386.620) (-385.635) [-387.911] -- 0:00:07
899500 -- (-391.147) (-386.868) (-385.379) [-386.443] * (-386.109) (-387.363) (-388.824) [-387.367] -- 0:00:07
900000 -- [-387.378] (-387.956) (-388.004) (-385.807) * [-387.935] (-386.007) (-387.705) (-386.352) -- 0:00:07
Average standard deviation of split frequencies: 0.007000
900500 -- (-388.593) (-389.140) (-385.928) [-385.106] * [-386.141] (-393.184) (-388.945) (-386.079) -- 0:00:07
901000 -- (-385.510) (-390.513) [-387.850] (-390.558) * [-388.546] (-385.312) (-388.007) (-386.475) -- 0:00:07
901500 -- (-392.257) (-389.203) [-386.611] (-387.801) * (-387.402) (-385.976) [-386.150] (-387.835) -- 0:00:07
902000 -- (-387.774) (-387.098) [-387.233] (-388.203) * (-389.136) [-389.588] (-386.990) (-392.714) -- 0:00:07
902500 -- [-386.793] (-386.473) (-387.806) (-386.236) * [-386.836] (-386.370) (-387.517) (-389.521) -- 0:00:07
903000 -- [-386.797] (-387.471) (-386.251) (-386.556) * (-388.383) [-387.184] (-387.796) (-385.026) -- 0:00:06
903500 -- [-385.969] (-388.886) (-385.135) (-386.795) * [-388.944] (-389.046) (-386.078) (-386.451) -- 0:00:06
904000 -- [-385.709] (-385.489) (-387.577) (-386.474) * (-385.641) (-385.953) [-386.430] (-388.042) -- 0:00:06
904500 -- [-386.815] (-387.214) (-385.553) (-388.680) * [-385.938] (-387.428) (-386.302) (-389.580) -- 0:00:06
905000 -- (-386.177) (-389.915) (-388.397) [-385.506] * (-386.687) (-386.825) [-385.373] (-388.899) -- 0:00:06
Average standard deviation of split frequencies: 0.007414
905500 -- (-391.379) (-387.033) (-387.785) [-386.946] * (-386.090) (-386.880) (-390.369) [-386.914] -- 0:00:06
906000 -- (-386.708) [-388.194] (-391.531) (-385.235) * (-389.283) (-391.359) (-389.823) [-387.072] -- 0:00:06
906500 -- (-386.545) (-386.732) [-388.374] (-386.098) * (-394.993) (-392.642) [-387.893] (-389.720) -- 0:00:06
907000 -- (-387.600) [-387.387] (-390.929) (-388.363) * (-395.273) (-387.820) (-386.614) [-387.413] -- 0:00:06
907500 -- (-391.568) [-386.660] (-387.261) (-386.268) * (-388.278) (-385.807) (-388.514) [-390.104] -- 0:00:06
908000 -- (-387.526) (-388.779) (-391.732) [-385.183] * [-385.789] (-390.204) (-389.487) (-387.685) -- 0:00:06
908500 -- (-387.487) [-389.238] (-385.046) (-388.131) * [-385.629] (-388.037) (-391.092) (-385.745) -- 0:00:06
909000 -- (-389.563) (-387.024) (-388.329) [-386.947] * (-389.299) (-388.707) (-387.578) [-385.565] -- 0:00:06
909500 -- (-390.096) (-386.666) (-386.490) [-389.359] * (-386.317) (-387.312) [-385.754] (-388.500) -- 0:00:06
910000 -- (-386.770) (-388.514) [-386.443] (-386.345) * (-390.477) (-386.379) [-386.280] (-387.315) -- 0:00:06
Average standard deviation of split frequencies: 0.007538
910500 -- (-387.826) (-387.418) [-390.660] (-386.514) * (-388.594) (-387.166) [-387.031] (-387.014) -- 0:00:06
911000 -- [-386.048] (-388.455) (-390.217) (-387.449) * (-387.181) (-388.599) (-387.749) [-387.970] -- 0:00:06
911500 -- (-386.649) (-388.127) (-388.105) [-389.045] * [-385.567] (-387.477) (-386.929) (-386.399) -- 0:00:06
912000 -- (-389.979) (-389.357) [-386.233] (-390.838) * (-388.050) [-386.677] (-386.971) (-387.135) -- 0:00:06
912500 -- [-386.251] (-387.157) (-386.048) (-387.357) * (-387.215) (-386.667) (-387.646) [-384.820] -- 0:00:06
913000 -- (-385.972) (-386.966) [-387.437] (-388.373) * [-387.068] (-386.085) (-387.153) (-385.042) -- 0:00:06
913500 -- (-387.443) (-392.385) (-387.100) [-385.462] * (-388.511) (-386.585) (-386.325) [-386.000] -- 0:00:06
914000 -- (-385.285) (-385.392) (-387.865) [-386.817] * [-385.354] (-388.293) (-387.483) (-388.884) -- 0:00:06
914500 -- (-387.442) [-386.962] (-387.887) (-386.858) * (-386.121) [-390.862] (-386.725) (-385.904) -- 0:00:06
915000 -- (-387.400) (-386.150) [-388.689] (-385.483) * (-387.169) (-388.942) [-386.908] (-385.464) -- 0:00:06
Average standard deviation of split frequencies: 0.007387
915500 -- [-386.129] (-386.107) (-386.533) (-388.201) * (-386.863) (-387.560) (-387.843) [-385.580] -- 0:00:06
916000 -- (-386.332) [-387.129] (-388.471) (-389.644) * (-387.547) [-386.005] (-386.251) (-392.675) -- 0:00:06
916500 -- (-388.121) [-385.445] (-385.682) (-386.401) * (-387.767) (-387.851) (-384.778) [-387.590] -- 0:00:06
917000 -- (-388.321) (-386.937) [-385.408] (-388.272) * (-387.151) (-385.439) [-386.201] (-385.177) -- 0:00:05
917500 -- (-385.293) (-385.386) [-386.684] (-387.049) * (-386.127) (-386.196) (-386.239) [-385.963] -- 0:00:05
918000 -- (-385.979) (-385.530) [-385.482] (-386.836) * [-387.880] (-385.755) (-389.048) (-384.708) -- 0:00:05
918500 -- (-387.580) (-386.888) [-386.092] (-387.824) * (-388.670) (-387.436) [-395.145] (-385.362) -- 0:00:05
919000 -- (-387.629) (-387.198) (-385.759) [-386.112] * [-386.838] (-387.090) (-390.709) (-387.991) -- 0:00:05
919500 -- (-386.129) (-387.324) [-385.407] (-390.261) * (-388.903) [-385.692] (-390.977) (-389.142) -- 0:00:05
920000 -- (-386.717) (-392.265) [-386.601] (-386.264) * (-386.251) [-388.457] (-386.171) (-387.784) -- 0:00:05
Average standard deviation of split frequencies: 0.007584
920500 -- (-387.079) (-391.943) (-384.735) [-385.893] * (-385.517) (-386.462) (-388.785) [-386.344] -- 0:00:05
921000 -- (-386.813) [-385.690] (-385.061) (-386.247) * (-387.863) [-385.125] (-387.406) (-389.030) -- 0:00:05
921500 -- (-388.179) [-386.582] (-385.600) (-389.994) * (-389.981) (-385.109) (-386.463) [-387.929] -- 0:00:05
922000 -- (-386.287) [-385.989] (-385.377) (-386.017) * (-394.387) [-387.682] (-386.588) (-387.821) -- 0:00:05
922500 -- (-385.819) (-386.182) [-385.504] (-390.094) * (-387.517) (-387.452) [-385.343] (-385.880) -- 0:00:05
923000 -- (-387.812) (-389.385) (-385.955) [-390.220] * [-387.080] (-388.264) (-385.610) (-385.633) -- 0:00:05
923500 -- (-387.993) (-393.600) (-386.449) [-386.104] * [-388.124] (-388.354) (-389.365) (-384.999) -- 0:00:05
924000 -- [-386.658] (-385.599) (-386.019) (-390.595) * (-386.042) (-392.552) [-387.884] (-386.849) -- 0:00:05
924500 -- (-389.973) (-390.048) (-386.571) [-386.959] * [-388.608] (-387.210) (-391.570) (-387.089) -- 0:00:05
925000 -- (-385.404) (-388.298) [-386.456] (-386.451) * [-392.014] (-388.223) (-385.707) (-387.045) -- 0:00:05
Average standard deviation of split frequencies: 0.007456
925500 -- (-387.645) (-387.589) [-385.851] (-387.304) * (-389.574) [-387.123] (-386.643) (-389.423) -- 0:00:05
926000 -- [-385.980] (-389.757) (-384.781) (-387.905) * (-391.621) (-388.028) (-384.839) [-387.224] -- 0:00:05
926500 -- (-387.303) (-386.662) (-385.925) [-386.955] * [-386.494] (-386.679) (-385.821) (-386.542) -- 0:00:05
927000 -- [-385.768] (-385.304) (-386.237) (-387.127) * [-386.511] (-387.622) (-386.292) (-388.961) -- 0:00:05
927500 -- (-389.460) (-387.092) [-385.725] (-386.069) * (-387.387) (-385.717) (-384.958) [-388.400] -- 0:00:05
928000 -- (-388.774) (-385.779) [-386.238] (-385.720) * (-386.676) (-387.108) [-390.221] (-384.854) -- 0:00:05
928500 -- (-386.893) [-386.043] (-389.917) (-386.444) * (-389.319) (-385.661) [-389.131] (-385.303) -- 0:00:05
929000 -- (-388.349) (-387.560) (-385.184) [-387.125] * [-387.553] (-386.228) (-387.526) (-387.046) -- 0:00:05
929500 -- (-386.440) (-388.829) (-393.110) [-388.708] * (-386.395) [-386.600] (-391.865) (-386.997) -- 0:00:05
930000 -- (-386.397) (-386.202) [-390.501] (-386.486) * [-386.158] (-385.860) (-390.222) (-387.294) -- 0:00:05
Average standard deviation of split frequencies: 0.007819
930500 -- (-389.938) (-387.644) [-385.838] (-387.654) * [-385.521] (-388.273) (-388.762) (-386.653) -- 0:00:05
931000 -- (-386.110) (-387.880) (-392.269) [-390.283] * [-387.120] (-387.041) (-386.088) (-385.261) -- 0:00:04
931500 -- [-386.109] (-385.966) (-392.795) (-386.067) * (-389.725) (-386.724) (-386.715) [-386.513] -- 0:00:04
932000 -- (-387.360) (-387.037) [-388.369] (-386.238) * [-387.455] (-387.587) (-385.173) (-387.755) -- 0:00:04
932500 -- [-386.268] (-390.327) (-389.289) (-386.404) * (-386.569) (-387.272) (-387.526) [-386.687] -- 0:00:04
933000 -- (-386.202) (-386.363) [-388.245] (-385.756) * (-386.131) [-386.589] (-388.085) (-386.825) -- 0:00:04
933500 -- [-387.049] (-386.793) (-387.462) (-386.840) * [-388.754] (-387.939) (-387.802) (-385.205) -- 0:00:04
934000 -- (-386.738) (-387.302) [-388.091] (-388.630) * (-391.654) (-387.357) (-394.338) [-385.706] -- 0:00:04
934500 -- [-385.357] (-389.820) (-388.411) (-384.884) * (-392.549) (-388.541) (-389.383) [-385.964] -- 0:00:04
935000 -- (-385.645) [-385.140] (-386.366) (-386.138) * (-385.319) (-387.430) [-387.923] (-390.806) -- 0:00:04
Average standard deviation of split frequencies: 0.007806
935500 -- (-387.443) (-385.413) [-386.075] (-386.053) * [-385.831] (-386.465) (-388.960) (-388.375) -- 0:00:04
936000 -- (-385.149) (-387.265) [-385.551] (-385.725) * (-387.248) (-386.886) [-390.976] (-387.780) -- 0:00:04
936500 -- (-386.442) (-384.788) (-386.702) [-385.375] * (-386.237) [-386.051] (-386.841) (-387.313) -- 0:00:04
937000 -- (-388.762) (-385.477) (-385.342) [-384.772] * (-387.025) (-387.236) (-387.500) [-387.297] -- 0:00:04
937500 -- (-389.364) [-388.790] (-385.341) (-387.673) * (-388.543) (-388.497) (-388.315) [-387.497] -- 0:00:04
938000 -- (-390.176) (-387.143) (-384.952) [-387.217] * (-387.908) (-387.920) (-389.017) [-385.515] -- 0:00:04
938500 -- [-385.182] (-387.529) (-387.836) (-385.977) * [-387.502] (-387.379) (-387.098) (-386.822) -- 0:00:04
939000 -- (-389.641) (-389.203) (-391.718) [-387.884] * (-391.377) (-386.037) (-387.605) [-385.192] -- 0:00:04
939500 -- [-387.782] (-389.291) (-386.376) (-386.608) * [-387.409] (-386.017) (-388.293) (-385.193) -- 0:00:04
940000 -- (-385.870) (-389.123) (-386.501) [-388.672] * (-388.343) (-386.321) [-386.885] (-387.080) -- 0:00:04
Average standard deviation of split frequencies: 0.007987
940500 -- (-387.549) (-390.769) [-386.079] (-388.346) * [-387.088] (-388.567) (-389.014) (-388.599) -- 0:00:04
941000 -- (-390.934) (-390.958) [-387.002] (-389.889) * (-390.030) (-388.615) (-394.155) [-386.536] -- 0:00:04
941500 -- (-388.866) (-393.072) [-387.264] (-390.093) * [-385.786] (-386.532) (-388.362) (-385.566) -- 0:00:04
942000 -- [-385.970] (-386.465) (-386.610) (-390.628) * [-386.737] (-386.128) (-391.142) (-390.010) -- 0:00:04
942500 -- (-392.408) (-387.004) (-387.961) [-387.578] * [-386.869] (-386.247) (-387.911) (-390.373) -- 0:00:04
943000 -- (-389.893) (-391.390) [-386.115] (-387.555) * (-390.277) (-385.099) (-386.363) [-390.748] -- 0:00:04
943500 -- (-384.821) (-395.478) [-390.215] (-388.200) * (-387.626) [-387.643] (-388.740) (-388.648) -- 0:00:04
944000 -- [-387.307] (-393.832) (-388.114) (-392.988) * (-386.262) (-387.932) (-387.591) [-385.267] -- 0:00:04
944500 -- (-387.578) [-386.261] (-387.087) (-392.722) * (-385.953) (-385.112) [-386.446] (-387.788) -- 0:00:03
945000 -- [-390.166] (-387.857) (-385.239) (-392.530) * [-386.764] (-385.538) (-385.149) (-392.917) -- 0:00:03
Average standard deviation of split frequencies: 0.007942
945500 -- (-390.710) (-387.163) [-385.861] (-391.567) * (-388.914) [-386.517] (-385.647) (-385.657) -- 0:00:03
946000 -- (-386.175) [-386.582] (-386.399) (-389.676) * (-387.103) (-390.058) [-387.132] (-390.762) -- 0:00:03
946500 -- (-387.704) (-389.580) (-388.394) [-386.948] * (-387.417) [-387.516] (-386.389) (-389.849) -- 0:00:03
947000 -- (-388.856) (-392.007) (-387.115) [-390.437] * (-386.526) [-385.676] (-388.116) (-390.589) -- 0:00:03
947500 -- [-386.477] (-392.538) (-386.495) (-386.615) * [-385.214] (-385.326) (-385.721) (-391.041) -- 0:00:03
948000 -- (-389.677) (-389.381) (-390.884) [-388.178] * (-385.822) (-387.256) (-391.558) [-386.877] -- 0:00:03
948500 -- (-386.916) [-390.286] (-385.889) (-386.418) * (-387.725) [-387.536] (-385.303) (-386.856) -- 0:00:03
949000 -- (-388.760) (-386.259) (-386.695) [-385.078] * [-385.420] (-388.316) (-387.024) (-385.577) -- 0:00:03
949500 -- (-386.173) (-386.562) [-385.208] (-387.807) * (-385.198) [-387.821] (-388.005) (-388.557) -- 0:00:03
950000 -- (-393.434) (-385.572) [-387.260] (-385.490) * (-387.302) [-386.891] (-388.239) (-386.297) -- 0:00:03
Average standard deviation of split frequencies: 0.007748
950500 -- (-386.181) (-386.952) (-389.296) [-387.314] * [-386.673] (-387.184) (-387.123) (-385.441) -- 0:00:03
951000 -- (-386.700) (-386.421) [-385.682] (-389.148) * [-385.094] (-388.584) (-389.065) (-388.259) -- 0:00:03
951500 -- (-389.413) (-386.526) (-386.092) [-387.744] * (-385.766) (-390.872) (-388.347) [-386.295] -- 0:00:03
952000 -- (-387.593) [-386.310] (-386.830) (-388.386) * (-385.488) (-386.560) (-388.304) [-386.224] -- 0:00:03
952500 -- (-390.045) [-387.377] (-387.263) (-387.376) * (-387.822) (-385.521) [-387.362] (-390.181) -- 0:00:03
953000 -- (-388.610) (-387.501) (-387.928) [-386.942] * (-387.035) (-386.153) (-389.168) [-387.127] -- 0:00:03
953500 -- [-385.669] (-388.578) (-386.292) (-388.258) * (-385.425) [-386.759] (-390.980) (-385.825) -- 0:00:03
954000 -- [-385.373] (-389.879) (-388.261) (-392.042) * [-385.053] (-386.783) (-392.747) (-386.681) -- 0:00:03
954500 -- (-388.067) (-386.463) (-386.430) [-389.067] * (-385.607) (-386.638) [-391.343] (-386.206) -- 0:00:03
955000 -- [-389.057] (-385.687) (-390.075) (-388.254) * (-385.991) (-385.914) (-386.390) [-385.761] -- 0:00:03
Average standard deviation of split frequencies: 0.007581
955500 -- (-387.669) (-388.430) (-390.082) [-386.946] * (-384.958) (-387.408) [-386.889] (-387.949) -- 0:00:03
956000 -- (-387.898) [-386.372] (-388.609) (-385.337) * [-386.293] (-389.984) (-385.999) (-387.957) -- 0:00:03
956500 -- (-390.177) (-385.799) [-387.771] (-387.054) * (-387.230) [-389.234] (-384.765) (-387.269) -- 0:00:03
957000 -- [-387.428] (-385.919) (-387.224) (-385.763) * (-387.288) (-390.567) [-386.848] (-389.164) -- 0:00:03
957500 -- [-386.353] (-389.405) (-388.847) (-385.515) * (-386.357) [-388.569] (-388.546) (-386.114) -- 0:00:03
958000 -- (-387.056) (-388.198) [-386.107] (-386.997) * [-386.134] (-388.861) (-386.355) (-391.343) -- 0:00:03
958500 -- (-386.579) (-385.301) [-387.822] (-385.692) * (-386.998) (-387.935) [-385.402] (-386.628) -- 0:00:02
959000 -- (-391.262) (-387.081) [-385.391] (-386.850) * (-390.444) (-387.908) [-386.251] (-388.471) -- 0:00:02
959500 -- [-387.277] (-387.218) (-385.305) (-389.621) * (-387.152) (-385.763) (-385.804) [-387.870] -- 0:00:02
960000 -- [-388.921] (-386.473) (-388.297) (-386.019) * (-385.716) [-385.501] (-386.270) (-387.823) -- 0:00:02
Average standard deviation of split frequencies: 0.007453
960500 -- (-390.026) (-386.339) [-388.284] (-386.268) * (-385.353) (-385.021) (-385.733) [-385.476] -- 0:00:02
961000 -- (-386.115) (-387.487) [-387.900] (-386.867) * (-384.906) [-384.876] (-391.090) (-386.807) -- 0:00:02
961500 -- [-387.861] (-385.702) (-392.266) (-388.450) * (-384.973) [-387.014] (-386.519) (-388.257) -- 0:00:02
962000 -- (-387.031) (-385.853) [-391.045] (-386.332) * [-386.469] (-387.986) (-385.145) (-388.771) -- 0:00:02
962500 -- (-388.240) (-388.249) (-386.634) [-386.041] * (-385.280) [-387.155] (-386.096) (-388.019) -- 0:00:02
963000 -- [-385.805] (-387.045) (-387.069) (-386.006) * (-389.129) (-387.845) [-385.387] (-387.992) -- 0:00:02
963500 -- [-386.227] (-387.020) (-386.698) (-386.815) * (-388.233) (-388.593) (-387.132) [-385.455] -- 0:00:02
964000 -- (-386.116) [-386.966] (-388.171) (-391.824) * (-386.362) (-388.422) [-387.057] (-387.592) -- 0:00:02
964500 -- (-384.643) (-392.328) [-388.919] (-389.355) * (-390.891) [-390.009] (-388.029) (-385.539) -- 0:00:02
965000 -- (-387.548) (-387.723) (-390.208) [-391.377] * [-388.406] (-388.813) (-389.168) (-388.175) -- 0:00:02
Average standard deviation of split frequencies: 0.007777
965500 -- [-386.528] (-394.172) (-391.458) (-393.790) * (-389.836) [-390.109] (-388.765) (-386.688) -- 0:00:02
966000 -- (-385.990) (-386.486) (-386.281) [-386.877] * (-387.049) (-389.694) (-390.186) [-385.172] -- 0:00:02
966500 -- (-387.621) [-388.071] (-393.200) (-386.306) * (-385.192) [-388.066] (-389.059) (-385.801) -- 0:00:02
967000 -- (-385.311) (-385.234) (-388.381) [-386.374] * (-388.159) (-387.091) [-389.564] (-390.050) -- 0:00:02
967500 -- (-386.843) (-385.886) [-389.296] (-389.032) * (-388.350) [-386.481] (-387.294) (-389.626) -- 0:00:02
968000 -- (-389.119) [-389.836] (-386.527) (-386.761) * (-387.487) (-386.010) [-385.452] (-388.021) -- 0:00:02
968500 -- (-390.147) (-388.172) (-385.506) [-387.387] * [-388.970] (-389.427) (-390.956) (-386.741) -- 0:00:02
969000 -- (-387.810) (-387.863) (-385.981) [-386.311] * (-388.644) (-387.141) (-388.916) [-385.295] -- 0:00:02
969500 -- (-385.701) [-387.665] (-393.221) (-385.974) * [-388.334] (-388.415) (-386.403) (-386.845) -- 0:00:02
970000 -- (-386.999) [-386.378] (-388.587) (-387.202) * (-388.920) (-388.437) (-388.694) [-385.739] -- 0:00:02
Average standard deviation of split frequencies: 0.007922
970500 -- (-385.664) [-386.923] (-387.735) (-387.694) * [-387.735] (-388.811) (-386.332) (-389.153) -- 0:00:02
971000 -- (-386.732) [-388.860] (-389.333) (-388.387) * (-385.375) (-386.930) [-386.676] (-387.872) -- 0:00:02
971500 -- (-387.671) (-389.713) [-390.648] (-386.931) * (-387.590) (-388.082) [-389.254] (-385.709) -- 0:00:02
972000 -- (-388.182) [-385.703] (-388.912) (-389.468) * (-386.338) [-387.342] (-386.992) (-388.746) -- 0:00:02
972500 -- [-385.876] (-387.731) (-386.982) (-386.875) * [-388.017] (-386.981) (-386.350) (-386.892) -- 0:00:01
973000 -- (-386.732) (-386.788) [-385.219] (-388.897) * [-388.495] (-385.215) (-385.736) (-388.501) -- 0:00:01
973500 -- [-385.702] (-389.642) (-386.120) (-386.747) * (-389.306) [-388.695] (-386.058) (-386.232) -- 0:00:01
974000 -- (-388.057) (-390.854) (-385.616) [-386.440] * (-385.905) (-388.436) (-386.834) [-386.212] -- 0:00:01
974500 -- (-389.817) (-389.895) [-385.859] (-389.357) * [-385.580] (-387.004) (-390.743) (-385.807) -- 0:00:01
975000 -- (-388.195) [-386.550] (-386.294) (-387.170) * (-386.088) (-385.915) (-386.737) [-387.144] -- 0:00:01
Average standard deviation of split frequencies: 0.007698
975500 -- (-385.950) (-386.521) (-389.603) [-384.972] * (-385.194) (-388.235) [-390.124] (-387.693) -- 0:00:01
976000 -- [-388.535] (-387.825) (-389.423) (-388.693) * (-385.291) [-386.173] (-390.215) (-390.786) -- 0:00:01
976500 -- (-386.769) (-387.287) [-389.209] (-386.763) * (-387.589) (-385.719) (-386.128) [-387.529] -- 0:00:01
977000 -- (-389.786) [-386.243] (-388.124) (-386.164) * (-387.637) (-390.471) (-387.098) [-389.115] -- 0:00:01
977500 -- (-385.725) [-388.517] (-387.043) (-385.520) * [-390.170] (-389.612) (-391.645) (-385.446) -- 0:00:01
978000 -- (-385.603) (-387.199) (-386.038) [-388.077] * [-385.656] (-387.811) (-387.945) (-385.127) -- 0:00:01
978500 -- (-385.092) (-387.489) [-386.859] (-388.044) * (-392.595) (-385.839) (-387.296) [-385.145] -- 0:00:01
979000 -- (-387.269) [-387.275] (-385.953) (-388.688) * (-394.114) (-388.017) [-388.078] (-385.946) -- 0:00:01
979500 -- (-386.424) (-390.571) (-385.629) [-385.725] * (-386.842) (-387.003) (-388.168) [-385.424] -- 0:00:01
980000 -- (-387.088) [-386.420] (-385.991) (-386.653) * [-386.142] (-389.313) (-385.779) (-387.122) -- 0:00:01
Average standard deviation of split frequencies: 0.007691
980500 -- (-388.421) (-388.954) [-385.376] (-387.671) * (-387.881) (-385.957) [-387.467] (-387.404) -- 0:00:01
981000 -- (-387.866) [-385.938] (-388.936) (-386.281) * (-386.053) [-386.003] (-386.657) (-388.899) -- 0:00:01
981500 -- (-385.992) (-386.373) [-389.357] (-385.793) * (-390.617) (-386.673) [-385.069] (-387.648) -- 0:00:01
982000 -- (-386.515) (-386.628) [-387.613] (-392.458) * (-391.025) (-386.846) [-388.363] (-387.402) -- 0:00:01
982500 -- (-387.242) (-385.457) [-388.123] (-390.982) * (-387.333) (-390.168) (-394.261) [-388.469] -- 0:00:01
983000 -- [-386.820] (-386.498) (-388.753) (-385.538) * (-387.832) [-386.427] (-386.689) (-386.314) -- 0:00:01
983500 -- (-391.184) (-388.428) (-387.836) [-385.091] * (-387.737) (-386.342) [-385.250] (-388.729) -- 0:00:01
984000 -- (-387.424) (-386.025) (-385.510) [-387.551] * (-385.539) [-387.332] (-385.376) (-387.363) -- 0:00:01
984500 -- [-387.213] (-386.031) (-387.524) (-385.607) * (-388.021) (-386.677) [-386.227] (-386.037) -- 0:00:01
985000 -- (-387.679) [-385.213] (-387.529) (-385.459) * (-387.965) [-385.026] (-386.613) (-387.349) -- 0:00:01
Average standard deviation of split frequencies: 0.007650
985500 -- [-385.724] (-388.437) (-385.092) (-389.604) * (-387.759) (-387.157) (-389.863) [-389.543] -- 0:00:01
986000 -- [-385.755] (-387.193) (-386.505) (-389.318) * (-386.645) [-385.447] (-385.455) (-387.106) -- 0:00:01
986500 -- (-386.034) (-388.289) (-391.793) [-386.569] * (-386.206) [-385.281] (-386.750) (-390.544) -- 0:00:00
987000 -- [-387.889] (-387.892) (-388.215) (-387.540) * (-385.323) (-386.459) (-390.522) [-387.119] -- 0:00:00
987500 -- (-387.518) [-389.028] (-388.666) (-389.447) * (-393.616) (-386.204) (-390.647) [-387.082] -- 0:00:00
988000 -- (-390.658) (-386.724) [-388.143] (-387.203) * [-385.378] (-389.478) (-385.761) (-387.170) -- 0:00:00
988500 -- [-385.700] (-386.538) (-386.852) (-387.326) * (-388.848) (-389.744) (-386.723) [-390.273] -- 0:00:00
989000 -- (-389.225) (-386.402) [-389.402] (-388.395) * (-387.835) (-387.767) [-385.153] (-389.107) -- 0:00:00
989500 -- (-385.973) [-388.316] (-389.810) (-386.088) * (-387.791) [-385.496] (-386.229) (-388.651) -- 0:00:00
990000 -- [-385.718] (-388.437) (-390.933) (-387.523) * (-391.986) (-387.891) [-387.248] (-385.094) -- 0:00:00
Average standard deviation of split frequencies: 0.007732
990500 -- (-386.427) (-386.610) (-393.358) [-387.024] * (-391.423) [-385.435] (-386.682) (-387.832) -- 0:00:00
991000 -- (-386.460) (-388.348) [-386.936] (-386.115) * (-387.883) [-386.342] (-385.667) (-386.615) -- 0:00:00
991500 -- [-384.809] (-388.516) (-386.635) (-386.723) * (-386.606) (-390.257) [-390.720] (-387.691) -- 0:00:00
992000 -- (-385.875) (-388.200) (-387.082) [-386.150] * (-387.927) (-388.673) [-387.593] (-389.864) -- 0:00:00
992500 -- (-386.130) [-388.642] (-386.551) (-386.401) * (-389.654) (-388.998) (-386.091) [-386.452] -- 0:00:00
993000 -- (-387.297) [-386.699] (-385.884) (-385.234) * (-387.790) (-387.920) [-389.499] (-387.124) -- 0:00:00
993500 -- [-388.373] (-388.419) (-386.426) (-385.826) * [-387.907] (-389.627) (-389.353) (-389.562) -- 0:00:00
994000 -- [-387.259] (-388.197) (-386.398) (-385.450) * (-391.848) (-386.445) (-392.372) [-389.882] -- 0:00:00
994500 -- (-387.232) (-386.659) (-385.838) [-389.646] * (-386.739) [-387.018] (-389.931) (-389.135) -- 0:00:00
995000 -- (-385.970) (-386.895) [-385.981] (-386.105) * (-388.212) [-386.069] (-387.130) (-385.649) -- 0:00:00
Average standard deviation of split frequencies: 0.007543
995500 -- (-385.837) (-387.382) (-385.569) [-385.432] * (-388.630) (-387.666) (-388.052) [-389.040] -- 0:00:00
996000 -- (-386.102) (-388.221) (-386.280) [-384.899] * [-387.375] (-387.364) (-392.249) (-387.526) -- 0:00:00
996500 -- (-387.453) [-387.502] (-389.040) (-386.231) * (-384.875) (-389.309) (-387.658) [-386.509] -- 0:00:00
997000 -- (-388.532) (-387.610) (-389.029) [-386.143] * (-387.178) [-387.831] (-390.065) (-385.953) -- 0:00:00
997500 -- (-389.324) [-385.324] (-388.148) (-388.961) * (-389.291) [-387.288] (-386.982) (-389.610) -- 0:00:00
998000 -- (-387.667) [-385.764] (-384.984) (-389.820) * (-391.147) (-386.719) [-385.195] (-386.898) -- 0:00:00
998500 -- (-386.686) [-387.228] (-385.684) (-390.154) * (-390.730) (-386.493) (-389.462) [-387.607] -- 0:00:00
999000 -- (-386.746) (-387.139) [-385.573] (-389.156) * (-388.755) [-386.976] (-387.040) (-387.564) -- 0:00:00
999500 -- (-392.908) (-386.945) [-386.035] (-386.631) * [-388.679] (-389.334) (-390.794) (-386.261) -- 0:00:00
1000000 -- (-389.877) [-385.850] (-388.371) (-386.903) * (-390.828) (-387.838) (-385.656) [-386.449] -- 0:00:00
Average standard deviation of split frequencies: 0.007832
Analysis completed in 1 mins 12 seconds
Analysis used 71.20 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -384.60
Likelihood of best state for "cold" chain of run 2 was -384.60
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
76.3 % ( 71 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
41.3 % ( 34 %) Dirichlet(Pi{all})
40.0 % ( 32 %) Slider(Pi{all})
79.3 % ( 52 %) Multiplier(Alpha{1,2})
77.5 % ( 46 %) Multiplier(Alpha{3})
26.3 % ( 24 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.0 % ( 67 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.5 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 18 %) Multiplier(V{all})
97.5 % ( 99 %) Nodeslider(V{all})
30.6 % ( 30 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.9 % ( 70 %) Dirichlet(Revmat{all})
99.9 % (100 %) Slider(Revmat{all})
40.3 % ( 30 %) Dirichlet(Pi{all})
40.3 % ( 26 %) Slider(Pi{all})
78.8 % ( 53 %) Multiplier(Alpha{1,2})
77.5 % ( 49 %) Multiplier(Alpha{3})
26.1 % ( 25 %) Slider(Pinvar{all})
98.6 % ( 98 %) ExtSPR(Tau{all},V{all})
70.3 % ( 65 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.7 % ( 91 %) ParsSPR(Tau{all},V{all})
28.1 % ( 32 %) Multiplier(V{all})
97.4 % ( 98 %) Nodeslider(V{all})
30.3 % ( 17 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166877 0.83 0.67
3 | 166020 167270 0.84
4 | 166816 166506 166511
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166468 0.82 0.67
3 | 166492 166490 0.83
4 | 166977 166796 166777
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -386.32
| 2 |
| 1 |
| 1 12 |
| 2 1 1 1 1 1 2 |
| 1 2 1 2 21 1 2 1|
| 1 112 *11 2 1 1 21 * |
| 2 1 2 1 112 1 2 1 2 2 |
|12 1 1 2 1 1 2 1 1 1 2 2 1 1 |
|2 12 2 1 2 1221 2 2 2 2 1 |
| 221 21 2 2 2 1 2 1 112 2|
| 2 11 12 * 2 |
| 2 1 21 2 |
| 2 2 2 2 2 * |
| 12 1 2 2 |
| 2 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -387.93
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -386.35 -389.92
2 -386.38 -389.80
--------------------------------------
TOTAL -386.36 -389.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896501 0.089263 0.335835 1.477724 0.864119 1355.72 1428.36 1.000
r(A<->C){all} 0.162306 0.019085 0.000122 0.442583 0.127266 199.05 208.79 1.000
r(A<->G){all} 0.165454 0.018664 0.000018 0.439914 0.132401 208.76 244.43 1.004
r(A<->T){all} 0.169710 0.020854 0.000078 0.459402 0.133615 214.48 237.54 1.004
r(C<->G){all} 0.165868 0.021280 0.000031 0.464043 0.125060 199.69 203.98 1.000
r(C<->T){all} 0.162087 0.018667 0.000098 0.445064 0.125207 242.03 281.84 1.002
r(G<->T){all} 0.174575 0.021546 0.000074 0.470894 0.136317 230.60 295.58 1.008
pi(A){all} 0.264301 0.000724 0.214151 0.319892 0.263747 1303.68 1315.62 1.000
pi(C){all} 0.271753 0.000708 0.219633 0.323654 0.270841 1264.13 1308.72 1.000
pi(G){all} 0.265008 0.000670 0.216336 0.317913 0.263951 1366.33 1433.66 1.000
pi(T){all} 0.198938 0.000550 0.154774 0.245083 0.198039 1330.04 1399.10 1.000
alpha{1,2} 0.400770 0.202227 0.000204 1.315972 0.246340 1228.53 1279.44 1.000
alpha{3} 0.448184 0.232293 0.000119 1.438954 0.281797 1215.67 1329.77 1.000
pinvar{all} 0.993785 0.000052 0.979491 0.999997 0.996202 1306.95 1391.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- .****.
8 -- .*.*..
9 -- ....**
10 -- .**...
11 -- ...**.
12 -- .*.***
13 -- ..**..
14 -- .**.**
15 -- .***.*
16 -- ..*..*
17 -- .*...*
18 -- ..*.*.
19 -- .*..*.
20 -- ..****
21 -- ...*.*
22 -- .*.**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 474 0.157895 0.009422 0.151233 0.164557 2
8 462 0.153897 0.007537 0.148568 0.159227 2
9 455 0.151566 0.008951 0.145237 0.157895 2
10 443 0.147568 0.004240 0.144570 0.150566 2
11 442 0.147235 0.010364 0.139907 0.154564 2
12 441 0.146902 0.006124 0.142572 0.151233 2
13 431 0.143571 0.008009 0.137908 0.149234 2
14 430 0.143238 0.000942 0.142572 0.143904 2
15 430 0.143238 0.006595 0.138574 0.147901 2
16 420 0.139907 0.000942 0.139241 0.140573 2
17 417 0.138907 0.008009 0.133245 0.144570 2
18 414 0.137908 0.016017 0.126582 0.149234 2
19 411 0.136909 0.012719 0.127915 0.145903 2
20 398 0.132578 0.009422 0.125916 0.139241 2
21 397 0.132245 0.003298 0.129913 0.134577 2
22 275 0.091606 0.012719 0.082612 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096776 0.009418 0.000009 0.290163 0.067234 1.000 2
length{all}[2] 0.099312 0.009863 0.000004 0.297356 0.068333 1.000 2
length{all}[3] 0.099386 0.009388 0.000018 0.294293 0.072888 1.000 2
length{all}[4] 0.101308 0.010612 0.000004 0.308268 0.068699 1.000 2
length{all}[5] 0.103822 0.010846 0.000035 0.304547 0.071339 1.000 2
length{all}[6] 0.097483 0.009452 0.000008 0.295556 0.066648 1.000 2
length{all}[7] 0.100611 0.008704 0.000116 0.286861 0.077174 1.000 2
length{all}[8] 0.100964 0.009069 0.000086 0.291326 0.076170 1.001 2
length{all}[9] 0.099223 0.009237 0.000032 0.293869 0.066830 0.999 2
length{all}[10] 0.100803 0.009414 0.000352 0.282968 0.073194 1.000 2
length{all}[11] 0.094935 0.008817 0.000015 0.286791 0.066237 0.998 2
length{all}[12] 0.102077 0.009331 0.000276 0.300788 0.074654 0.998 2
length{all}[13] 0.100421 0.009628 0.000350 0.319279 0.071984 0.998 2
length{all}[14] 0.094674 0.009056 0.000063 0.273847 0.066563 1.002 2
length{all}[15] 0.091201 0.006788 0.000398 0.247961 0.069628 0.998 2
length{all}[16] 0.099421 0.010424 0.000136 0.295735 0.066136 1.001 2
length{all}[17] 0.100016 0.009575 0.000072 0.275933 0.068905 0.998 2
length{all}[18] 0.107259 0.014234 0.000067 0.348235 0.069625 1.003 2
length{all}[19] 0.085881 0.006715 0.000347 0.247000 0.063949 0.999 2
length{all}[20] 0.104786 0.010432 0.000085 0.310422 0.070542 0.999 2
length{all}[21] 0.099126 0.008666 0.000283 0.278133 0.070847 1.003 2
length{all}[22] 0.106935 0.012212 0.000013 0.342652 0.076317 1.005 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007832
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.005
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/------------------------------------------------------------------ C1 (1)
|
|-------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------ C6 (6)
|--------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 98 trees
99 % credible set contains 104 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 279
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 40 patterns at 93 / 93 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 40 patterns at 93 / 93 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
39040 bytes for conP
3520 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.063668 0.039184 0.109612 0.104743 0.083464 0.017423 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -405.857726
Iterating by ming2
Initial: fx= 405.857726
x= 0.06367 0.03918 0.10961 0.10474 0.08346 0.01742 0.30000 1.30000
1 h-m-p 0.0000 0.0002 223.5672 +++ 396.394084 m 0.0002 14 | 1/8
2 h-m-p 0.0017 0.0170 22.2472 ------------.. | 1/8
3 h-m-p 0.0000 0.0002 204.3423 +++ 386.474587 m 0.0002 47 | 2/8
4 h-m-p 0.0024 0.0239 17.6564 ------------.. | 2/8
5 h-m-p 0.0000 0.0003 183.1505 +++ 377.465739 m 0.0003 80 | 3/8
6 h-m-p 0.0032 0.0401 13.3862 ------------.. | 3/8
7 h-m-p 0.0000 0.0002 159.0635 +++ 371.954128 m 0.0002 113 | 4/8
8 h-m-p 0.0029 0.0833 9.8842 ------------.. | 4/8
9 h-m-p 0.0000 0.0002 130.1570 +++ 367.971110 m 0.0002 146 | 5/8
10 h-m-p 0.0032 0.2753 6.6912 ------------.. | 5/8
11 h-m-p 0.0000 0.0001 92.3534 ++ 367.512471 m 0.0001 178 | 6/8
12 h-m-p 0.2513 8.0000 0.0000 C 367.512471 0 0.2513 189 | 6/8
13 h-m-p 1.6000 8.0000 0.0000 +Y 367.512471 0 6.4000 203 | 6/8
14 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512471 m 8.0000 219 | 6/8
15 h-m-p 0.0036 1.8183 0.1652 ----C 367.512471 0 0.0000 236 | 6/8
16 h-m-p 0.0160 8.0000 0.0001 ---Y 367.512471 0 0.0001 252 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 -------------.. | 6/8
18 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512471 m 8.0000 292 | 6/8
19 h-m-p 0.0016 0.8138 5.0019 ---------C 367.512471 0 0.0000 314 | 6/8
20 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512471 m 8.0000 328 | 6/8
21 h-m-p 0.0014 0.6961 1.0948 --------Y 367.512471 0 0.0000 349 | 6/8
22 h-m-p 0.0249 8.0000 0.0000 ----C 367.512471 0 0.0000 364 | 6/8
23 h-m-p 0.0160 8.0000 0.0000 ----C 367.512471 0 0.0000 381
Out..
lnL = -367.512471
382 lfun, 382 eigenQcodon, 2292 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027029 0.063650 0.044882 0.078132 0.109592 0.062282 0.300704 0.717507 0.360204
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 12.400062
np = 9
lnL0 = -401.550483
Iterating by ming2
Initial: fx= 401.550483
x= 0.02703 0.06365 0.04488 0.07813 0.10959 0.06228 0.30070 0.71751 0.36020
1 h-m-p 0.0000 0.0003 208.7050 +++ 387.628612 m 0.0003 15 | 1/9
2 h-m-p 0.0001 0.0004 166.8250 ++ 379.579604 m 0.0004 27 | 2/9
3 h-m-p 0.0000 0.0000 1523.5840 ++ 373.445649 m 0.0000 39 | 3/9
4 h-m-p 0.0000 0.0000 171.0761 ++ 373.046617 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 2854.2452 ++ 370.336101 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0000 4951.4525 ++ 367.512447 m 0.0000 75 | 6/9
7 h-m-p 1.6000 8.0000 0.0000 ++ 367.512447 m 8.0000 87 | 6/9
8 h-m-p 0.0036 1.7884 0.4264 ----------Y 367.512447 0 0.0000 112 | 6/9
9 h-m-p 0.0160 8.0000 0.0014 +++++ 367.512446 m 8.0000 130 | 6/9
10 h-m-p 0.0425 2.7858 0.2667 -------------C 367.512446 0 0.0000 158 | 6/9
11 h-m-p 0.0160 8.0000 0.0040 +++++ 367.512444 m 8.0000 176 | 6/9
12 h-m-p 0.1179 2.7928 0.2708 -------------C 367.512444 0 0.0000 204 | 6/9
13 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512444 m 8.0000 222 | 6/9
14 h-m-p 0.0088 4.4250 0.1830 ---------Y 367.512444 0 0.0000 246 | 6/9
15 h-m-p 0.0160 8.0000 0.0001 ------------C 367.512444 0 0.0000 273 | 6/9
16 h-m-p 0.0160 8.0000 0.0000 ---------Y 367.512444 0 0.0000 297
Out..
lnL = -367.512444
298 lfun, 894 eigenQcodon, 3576 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.021625 0.041676 0.023978 0.058758 0.083376 0.010285 0.269011 1.314444 0.172432 0.342013 1.302035
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 11.132329
np = 11
lnL0 = -388.761057
Iterating by ming2
Initial: fx= 388.761057
x= 0.02163 0.04168 0.02398 0.05876 0.08338 0.01028 0.26901 1.31444 0.17243 0.34201 1.30203
1 h-m-p 0.0000 0.0001 210.1499 ++ 383.456263 m 0.0001 16 | 1/11
2 h-m-p 0.0002 0.0010 79.0059 ++ 378.226761 m 0.0010 30 | 2/11
3 h-m-p 0.0000 0.0000 219.4718 ++ 377.464263 m 0.0000 44 | 3/11
4 h-m-p 0.0000 0.0004 263.7809 ++ 372.993778 m 0.0004 58 | 4/11
5 h-m-p 0.0000 0.0001 930.3842 ++ 369.966373 m 0.0001 72 | 5/11
6 h-m-p 0.0000 0.0000 3091.2936 ++ 367.826339 m 0.0000 86 | 6/11
7 h-m-p 0.0207 0.3463 1.6670 -------------.. | 6/11
8 h-m-p 0.0000 0.0000 91.1698 ++ 367.512451 m 0.0000 125 | 7/11
9 h-m-p 0.0470 8.0000 0.0000 ++++ 367.512451 m 8.0000 141 | 7/11
10 h-m-p 0.0628 8.0000 0.0004 ++++ 367.512451 m 8.0000 161 | 7/11
11 h-m-p 0.0015 0.5649 2.1840 ---------Y 367.512451 0 0.0000 188 | 7/11
12 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 205 | 7/11
13 h-m-p 0.0160 8.0000 0.3255 --------C 367.512451 0 0.0000 231 | 7/11
14 h-m-p 0.0160 8.0000 0.0001 -------------.. | 7/11
15 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 281 | 7/11
16 h-m-p 0.0160 8.0000 0.7899 ---------C 367.512451 0 0.0000 308 | 7/11
17 h-m-p 0.0160 8.0000 0.0001 -------N 367.512451 0 0.0000 333 | 7/11
18 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 354 | 7/11
19 h-m-p 0.0107 5.3744 1.3452 -----------Y 367.512451 0 0.0000 383 | 7/11
20 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 400 | 7/11
21 h-m-p 0.0160 8.0000 12.1154 -------------.. | 7/11
22 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 446 | 7/11
23 h-m-p 0.0160 8.0000 0.0257 --------C 367.512451 0 0.0000 472 | 7/11
24 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512451 m 8.0000 493 | 7/11
25 h-m-p 0.0160 8.0000 0.9821 ----------C 367.512451 0 0.0000 521 | 7/11
26 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512451 m 8.0000 542 | 7/11
27 h-m-p 0.0160 8.0000 1.1250 ------------Y 367.512451 0 0.0000 572 | 7/11
28 h-m-p 0.0160 8.0000 0.0002 +++++ 367.512451 m 8.0000 589 | 7/11
29 h-m-p 0.0160 8.0000 1.2325 ---------Y 367.512451 0 0.0000 616 | 7/11
30 h-m-p 0.0160 8.0000 0.0002 +++++ 367.512451 m 8.0000 633 | 7/11
31 h-m-p 0.0064 3.2241 1.6799 ------------.. | 7/11
32 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512451 m 8.0000 678 | 7/11
33 h-m-p 0.0160 8.0000 0.0311 +++++ 367.512444 m 8.0000 699 | 7/11
34 h-m-p 0.2741 8.0000 0.9084 -------------Y 367.512444 0 0.0000 730 | 7/11
35 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512444 m 8.0000 751 | 7/11
36 h-m-p 0.0001 0.0588 6.2463 ----------.. | 7/11
37 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512444 m 8.0000 794 | 7/11
38 h-m-p 0.0041 1.7288 0.0643 +++++ 367.512440 m 1.7288 815 | 8/11
39 h-m-p 0.1205 8.0000 0.6782 ------------C 367.512440 0 0.0000 845 | 8/11
40 h-m-p 0.0160 8.0000 0.0002 +++++ 367.512440 m 8.0000 865 | 8/11
41 h-m-p 0.0160 8.0000 1.8599 ------------N 367.512440 0 0.0000 894 | 8/11
42 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512440 m 8.0000 911 | 8/11
43 h-m-p 0.0160 8.0000 1.8150 -------------.. | 8/11
44 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512440 m 8.0000 956 | 8/11
45 h-m-p 0.0075 3.7250 0.1202 +++++ 367.512425 m 3.7250 976 | 9/11
46 h-m-p 0.2043 8.0000 1.8966 ---------------.. | 9/11
47 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512425 m 8.0000 1023 | 9/11
48 h-m-p 0.0160 8.0000 0.1122 ---------Y 367.512425 0 0.0000 1048 | 9/11
49 h-m-p 0.0160 8.0000 0.0280 +++++ 367.512418 m 8.0000 1067 | 9/11
50 h-m-p 0.0559 8.0000 4.0031 -------------N 367.512418 0 0.0000 1096 | 9/11
51 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512418 m 8.0000 1113 | 9/11
52 h-m-p 0.0160 8.0000 0.2817 +++++ 367.512366 m 8.0000 1132 | 9/11
53 h-m-p 0.6395 8.0000 3.5241 ++ 367.512343 m 8.0000 1148 | 9/11
54 h-m-p 1.6000 8.0000 0.0000 N 367.512343 0 1.6000 1162 | 9/11
55 h-m-p 0.0160 8.0000 0.0000 Y 367.512343 0 0.0160 1178
Out..
lnL = -367.512343
1179 lfun, 4716 eigenQcodon, 21222 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -367.546280 S = -367.513027 -0.012796
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:08
did 20 / 40 patterns 0:08
did 30 / 40 patterns 0:08
did 40 / 40 patterns 0:08
Time used: 0:08
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.077118 0.098082 0.048224 0.070474 0.012166 0.026390 0.000100 0.923156 1.679005
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 19.725192
np = 9
lnL0 = -396.216389
Iterating by ming2
Initial: fx= 396.216389
x= 0.07712 0.09808 0.04822 0.07047 0.01217 0.02639 0.00011 0.92316 1.67900
1 h-m-p 0.0000 0.0000 201.1533 ++ 396.062894 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0359 25.8035 +++++ 382.366199 m 0.0359 29 | 2/9
3 h-m-p 0.0001 0.0004 228.1198 ++ 375.312935 m 0.0004 41 | 3/9
4 h-m-p 0.0023 0.0117 13.5825 ++ 368.583496 m 0.0117 53 | 4/9
5 h-m-p 0.0000 0.0000 41.9533 ++ 368.569900 m 0.0000 65 | 5/9
6 h-m-p 0.0000 0.0000 167.6164 ++ 368.469865 m 0.0000 77 | 6/9
7 h-m-p 0.0000 0.0010 302.6992 ++++ 367.974089 m 0.0010 91 | 7/9
8 h-m-p 0.0018 0.5787 168.7246 ------------.. | 7/9
9 h-m-p 0.0000 0.0001 86.5951 ++ 367.512343 m 0.0001 125 | 8/9
10 h-m-p 1.6000 8.0000 0.0000 --Y 367.512343 0 0.0250 139
Out..
lnL = -367.512343
140 lfun, 1540 eigenQcodon, 8400 P(t)
Time used: 0:10
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.027895 0.084797 0.044169 0.018817 0.090827 0.053928 0.000100 0.900000 1.120608 1.502473 1.299278
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 15.051336
np = 11
lnL0 = -395.175974
Iterating by ming2
Initial: fx= 395.175974
x= 0.02789 0.08480 0.04417 0.01882 0.09083 0.05393 0.00011 0.90000 1.12061 1.50247 1.29928
1 h-m-p 0.0000 0.0000 200.1911 ++ 394.975661 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0045 53.0420 ++++ 384.286923 m 0.0045 32 | 2/11
3 h-m-p 0.0000 0.0002 224.6381 ++ 380.482043 m 0.0002 46 | 3/11
4 h-m-p 0.0014 0.0124 34.0991 ++ 374.794420 m 0.0124 60 | 4/11
5 h-m-p 0.0000 0.0001 702.7437 ++ 372.676600 m 0.0001 74 | 5/11
6 h-m-p 0.0003 0.0025 320.9721 ++ 367.931062 m 0.0025 88 | 6/11
7 h-m-p 0.0000 0.0000 14205.4722 ++ 367.665216 m 0.0000 102 | 7/11
8 h-m-p 0.0048 0.0856 17.3430 ------------.. | 7/11
9 h-m-p 0.0000 0.0000 91.8576 ++ 367.512464 m 0.0000 140 | 8/11
10 h-m-p 0.0533 8.0000 0.0000 ++++ 367.512464 m 8.0000 156 | 8/11
11 h-m-p 0.1657 8.0000 0.0001 ---------------.. | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512464 m 8.0000 206 | 8/11
13 h-m-p 0.0056 2.8074 0.2262 ---------C 367.512464 0 0.0000 232 | 8/11
14 h-m-p 0.0160 8.0000 0.0038 +++++ 367.512462 m 8.0000 252 | 8/11
15 h-m-p 0.1303 2.8516 0.2310 ------------N 367.512462 0 0.0000 281 | 8/11
16 h-m-p 0.0160 8.0000 0.0000 +++++ 367.512462 m 8.0000 301 | 8/11
17 h-m-p 0.0029 1.4401 2.5740 ------------.. | 8/11
18 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512462 m 8.0000 345 | 8/11
19 h-m-p 0.0160 8.0000 0.0752 ---------Y 367.512462 0 0.0000 371 | 8/11
20 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512462 m 8.0000 391 | 8/11
21 h-m-p 0.0063 3.1464 0.2288 ---------N 367.512462 0 0.0000 417 | 8/11
22 h-m-p 0.0160 8.0000 0.0001 +++++ 367.512462 m 8.0000 437 | 8/11
23 h-m-p 0.0065 3.2346 0.2136 -----------Y 367.512462 0 0.0000 465 | 8/11
24 h-m-p 0.0160 8.0000 0.0014 +++++ 367.512461 m 8.0000 485 | 8/11
25 h-m-p 0.0518 3.2353 0.2197 -----------C 367.512461 0 0.0000 513 | 8/11
26 h-m-p 0.0160 8.0000 0.0001 -----Y 367.512461 0 0.0000 535 | 8/11
27 h-m-p 0.0003 0.1358 2.5178 +++++ 367.512343 m 0.1358 555 | 9/11
28 h-m-p 1.6000 8.0000 0.0004 -----N 367.512343 0 0.0004 574 | 9/11
29 h-m-p 1.6000 8.0000 0.0000 N 367.512343 0 0.4000 590
Out..
lnL = -367.512343
591 lfun, 7092 eigenQcodon, 39006 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -367.556319 S = -367.513027 -0.019157
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 40 patterns 0:20
did 20 / 40 patterns 0:20
did 30 / 40 patterns 0:20
did 40 / 40 patterns 0:20
Time used: 0:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=93
NC_011896_1_WP_010908582_1_1986_MLBR_RS09425 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
NC_002677_1_NP_302261_1_1133_rpsS MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA
**************************************************
NC_011896_1_WP_010908582_1_1986_MLBR_RS09425 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
NC_002677_1_NP_302261_1_1133_rpsS VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495 VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
*******************************************
>NC_011896_1_WP_010908582_1_1986_MLBR_RS09425 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA >NC_002677_1_NP_302261_1_1133_rpsS ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA >NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA >NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA >NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA >NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495 ATGCCTCGCAGCTTGAAAAAGGGTCCGTTCGTTGACGACCACCTGCTCAA GAAGGTCGACGTTCAGAACGAAAAGAACACCAAGCAGGTCATCAAGACCT GGTCGCGCCGGTCAACGATTATTCCGGACTTCATTGGTCATACCTTTGCG GTCCATGACGGACGCAAGCATGTTCCGGTTTTCGTTACCGAGGCAATGGT GGGTCACAAACTTGGCGAATTCGCGCCGACTCGCACCTTCAAGGGACACA TCAAGGATGACCGGAAGGCCAAACGACGA
>NC_011896_1_WP_010908582_1_1986_MLBR_RS09425 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR >NC_002677_1_NP_302261_1_1133_rpsS MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR >NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR >NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR >NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR >NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495 MPRSLKKGPFVDDHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFIGHTFA VHDGRKHVPVFVTEAMVGHKLGEFAPTRTFKGHIKDDRKAKRR
#NEXUS
[ID: 0454929038]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010908582_1_1986_MLBR_RS09425
NC_002677_1_NP_302261_1_1133_rpsS
NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590
NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210
NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225
NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495
;
end;
begin trees;
translate
1 NC_011896_1_WP_010908582_1_1986_MLBR_RS09425,
2 NC_002677_1_NP_302261_1_1133_rpsS,
3 NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590,
4 NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210,
5 NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225,
6 NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06723358,2:0.06833348,3:0.07288764,4:0.06869863,5:0.07133935,6:0.06664762);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06723358,2:0.06833348,3:0.07288764,4:0.06869863,5:0.07133935,6:0.06664762);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -386.35 -389.92
2 -386.38 -389.80
--------------------------------------
TOTAL -386.36 -389.86
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/rpsS/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.896501 0.089263 0.335835 1.477724 0.864119 1355.72 1428.36 1.000
r(A<->C){all} 0.162306 0.019085 0.000122 0.442583 0.127266 199.05 208.79 1.000
r(A<->G){all} 0.165454 0.018664 0.000018 0.439914 0.132401 208.76 244.43 1.004
r(A<->T){all} 0.169710 0.020854 0.000078 0.459402 0.133615 214.48 237.54 1.004
r(C<->G){all} 0.165868 0.021280 0.000031 0.464043 0.125060 199.69 203.98 1.000
r(C<->T){all} 0.162087 0.018667 0.000098 0.445064 0.125207 242.03 281.84 1.002
r(G<->T){all} 0.174575 0.021546 0.000074 0.470894 0.136317 230.60 295.58 1.008
pi(A){all} 0.264301 0.000724 0.214151 0.319892 0.263747 1303.68 1315.62 1.000
pi(C){all} 0.271753 0.000708 0.219633 0.323654 0.270841 1264.13 1308.72 1.000
pi(G){all} 0.265008 0.000670 0.216336 0.317913 0.263951 1366.33 1433.66 1.000
pi(T){all} 0.198938 0.000550 0.154774 0.245083 0.198039 1330.04 1399.10 1.000
alpha{1,2} 0.400770 0.202227 0.000204 1.315972 0.246340 1228.53 1279.44 1.000
alpha{3} 0.448184 0.232293 0.000119 1.438954 0.281797 1215.67 1329.77 1.000
pinvar{all} 0.993785 0.000052 0.979491 0.999997 0.996202 1306.95 1391.59 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/rpsS/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 93
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 0 0 0 0 0 0 | Tyr TAT 0 0 0 0 0 0 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 0 0 0 0 0 0 | TAC 0 0 0 0 0 0 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 1 1 1 1 1 1 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 1 1 1 1 1 1 | His CAT 3 3 3 3 3 3 | Arg CGT 0 0 0 0 0 0
CTC 1 1 1 1 1 1 | CCC 0 0 0 0 0 0 | CAC 3 3 3 3 3 3 | CGC 4 4 4 4 4 4
CTA 0 0 0 0 0 0 | CCA 0 0 0 0 0 0 | Gln CAA 0 0 0 0 0 0 | CGA 2 2 2 2 2 2
CTG 1 1 1 1 1 1 | CCG 4 4 4 4 4 4 | CAG 2 2 2 2 2 2 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 3 3 3 | Thr ACT 1 1 1 1 1 1 | Asn AAT 0 0 0 0 0 0 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 5 5 5 5 5 5 | AAC 2 2 2 2 2 2 | AGC 1 1 1 1 1 1
ATA 0 0 0 0 0 0 | ACA 0 0 0 0 0 0 | Lys AAA 3 3 3 3 3 3 | Arg AGA 0 0 0 0 0 0
Met ATG 2 2 2 2 2 2 | ACG 1 1 1 1 1 1 | AAG 10 10 10 10 10 10 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 5 5 5 | Ala GCT 0 0 0 0 0 0 | Asp GAT 1 1 1 1 1 1 | Gly GGT 3 3 3 3 3 3
GTC 3 3 3 3 3 3 | GCC 1 1 1 1 1 1 | GAC 6 6 6 6 6 6 | GGC 1 1 1 1 1 1
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 2 2 2 | GGA 2 2 2 2 2 2
GTG 1 1 1 1 1 1 | GCG 2 2 2 2 2 2 | GAG 1 1 1 1 1 1 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010908582_1_1986_MLBR_RS09425
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
#2: NC_002677_1_NP_302261_1_1133_rpsS
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
#3: NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
#4: NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
#5: NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
#6: NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 0 | Tyr Y TAT 0 | Cys C TGT 0
TTC 30 | TCC 0 | TAC 0 | TGC 0
Leu L TTA 0 | TCA 6 | *** * TAA 0 | *** * TGA 0
TTG 6 | TCG 6 | TAG 0 | Trp W TGG 6
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 6 | His H CAT 18 | Arg R CGT 0
CTC 6 | CCC 0 | CAC 18 | CGC 24
CTA 0 | CCA 0 | Gln Q CAA 0 | CGA 12
CTG 6 | CCG 24 | CAG 12 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 6 | Asn N AAT 0 | Ser S AGT 0
ATC 12 | ACC 30 | AAC 12 | AGC 6
ATA 0 | ACA 0 | Lys K AAA 18 | Arg R AGA 0
Met M ATG 12 | ACG 6 | AAG 60 | AGG 0
------------------------------------------------------------------------------
Val V GTT 30 | Ala A GCT 0 | Asp D GAT 6 | Gly G GGT 18
GTC 18 | GCC 6 | GAC 36 | GGC 6
GTA 0 | GCA 6 | Glu E GAA 12 | GGA 12
GTG 6 | GCG 12 | GAG 6 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10753 C:0.25806 A:0.32258 G:0.31183
position 2: T:0.27957 C:0.19355 A:0.35484 G:0.17204
position 3: T:0.20430 C:0.36559 A:0.11828 G:0.31183
Average T:0.19713 C:0.27240 A:0.26523 G:0.26523
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -367.512471 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.300704 1.299278
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908582_1_1986_MLBR_RS09425: 0.000004, NC_002677_1_NP_302261_1_1133_rpsS: 0.000004, NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590: 0.000004, NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210: 0.000004, NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225: 0.000004, NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.30070
omega (dN/dS) = 1.29928
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
7..2 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
7..3 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
7..4 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
7..5 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
7..6 0.000 233.8 45.2 1.2993 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -367.512444 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.269011 0.749758 0.079558
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908582_1_1986_MLBR_RS09425: 0.000004, NC_002677_1_NP_302261_1_1133_rpsS: 0.000004, NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590: 0.000004, NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210: 0.000004, NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225: 0.000004, NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.26901
MLEs of dN/dS (w) for site classes (K=2)
p: 0.74976 0.25024
w: 0.07956 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
7..2 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
7..3 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
7..4 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
7..5 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
7..6 0.000 234.4 44.6 0.3099 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -367.512343 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 1.000000 0.000000 0.000001 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908582_1_1986_MLBR_RS09425: 0.000004, NC_002677_1_NP_302261_1_1133_rpsS: 0.000004, NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590: 0.000004, NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210: 0.000004, NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225: 0.000004, NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908582_1_1986_MLBR_RS09425)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.102 0.102 0.101 0.101 0.100 0.100 0.099 0.099 0.098 0.098
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -367.512343 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 1.361200
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908582_1_1986_MLBR_RS09425: 0.000004, NC_002677_1_NP_302261_1_1133_rpsS: 0.000004, NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590: 0.000004, NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210: 0.000004, NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225: 0.000004, NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 1.36120
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00002
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:10
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -367.512343 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.999990 0.005000 1.978961 2.359787
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010908582_1_1986_MLBR_RS09425: 0.000004, NC_002677_1_NP_302261_1_1133_rpsS: 0.000004, NZ_LVXE01000034_1_WP_010908582_1_1549_A3216_RS09590: 0.000004, NZ_LYPH01000037_1_WP_010908582_1_1505_A8144_RS07210: 0.000004, NZ_CP029543_1_WP_010908582_1_2009_DIJ64_RS10225: 0.000004, NZ_AP014567_1_WP_010908582_1_2063_JK2ML_RS10495: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 1.97896
(p1 = 0.00001) w = 2.35979
MLEs of dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 2.35979
(note that p[10] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 239.8 39.2 0.0000 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010908582_1_1986_MLBR_RS09425)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.097 0.097 0.098 0.099 0.100 0.100 0.101 0.102 0.103 0.103
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.103 0.102 0.102 0.101 0.100 0.100 0.099 0.098 0.098 0.097
Time used: 0:20
Model 1: NearlyNeutral -367.512444 Model 2: PositiveSelection -367.512343 Model 0: one-ratio -367.512471 Model 7: beta -367.512343 Model 8: beta&w>1 -367.512343 Model 0 vs 1 5.3999999977349944E-5 Model 2 vs 1 2.0200000005843322E-4 Model 8 vs 7 0.0
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
