--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Thu Jan 23 14:13:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/ruvC/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.15 -768.81
2 -766.14 -770.03
--------------------------------------
TOTAL -766.15 -769.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894340 0.091300 0.367878 1.498241 0.862858 1311.42 1337.80 1.000
r(A<->C){all} 0.155006 0.018303 0.000099 0.423802 0.116959 286.00 322.25 1.002
r(A<->G){all} 0.164240 0.019597 0.000178 0.448944 0.126785 158.45 245.50 1.000
r(A<->T){all} 0.171656 0.020972 0.000024 0.460678 0.133311 204.89 229.94 1.001
r(C<->G){all} 0.169406 0.021815 0.000015 0.474100 0.127922 212.42 245.36 1.002
r(C<->T){all} 0.165478 0.019470 0.000038 0.441700 0.129875 118.62 187.72 1.000
r(G<->T){all} 0.174214 0.021433 0.000159 0.469350 0.136679 153.17 228.24 1.000
pi(A){all} 0.193276 0.000268 0.160269 0.223355 0.193090 1166.98 1333.99 1.000
pi(C){all} 0.276518 0.000365 0.241365 0.315864 0.276109 1150.46 1228.06 1.000
pi(G){all} 0.340136 0.000399 0.298217 0.376861 0.339543 1044.88 1137.35 1.000
pi(T){all} 0.190070 0.000275 0.158746 0.222439 0.190179 1089.13 1197.05 1.000
alpha{1,2} 0.414877 0.216945 0.000154 1.356806 0.245208 936.08 1103.77 1.001
alpha{3} 0.469684 0.254609 0.000368 1.529902 0.298465 1186.34 1259.47 1.001
pinvar{all} 0.997311 0.000010 0.991430 0.999998 0.998358 1216.58 1304.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -738.022657
Model 2: PositiveSelection -738.022646
Model 0: one-ratio -738.022662
Model 7: beta -738.022688
Model 8: beta&w>1 -738.022646
Model 0 vs 1 9.999999974752427E-6
Model 2 vs 1 2.199999994445534E-5
Model 8 vs 7 8.400000001529406E-5
>C1
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C2
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C3
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C4
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C5
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C6
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188
C1 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C2 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C3 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C4 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C5 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C6 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
**************************************************
C1 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C2 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C3 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C4 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C5 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C6 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
**************************************************
C1 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C2 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C3 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C4 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C5 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C6 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
**************************************************
C1 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C2 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C3 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C4 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C5 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C6 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
**************************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES [PROTEIN]
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length 188 type PROTEIN Struct Unchecked
Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length 188 type PROTEIN Struct Unchecked
Multi Core Mode: 96 processors:
--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [5640]
Library Relaxation: Multi_proc [96]
Relaxation Summary: [5640]--->[5640]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.prot.fasta.muscle_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.467 Mb, Max= 30.719 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment
C1 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C2 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C3 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C4 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C5 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C6 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
**************************************************
C1 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C2 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C3 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C4 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C5 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C6 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
**************************************************
C1 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C2 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C3 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C4 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C5 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C6 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
**************************************************
C1 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C2 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C3 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C4 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C5 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C6 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
**************************************
FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C2 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C3 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C4 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C5 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C6 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
**************************************************
C1 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C2 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C3 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C4 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C5 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C6 CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
**************************************************
C1 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C2 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C3 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C4 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C5 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C6 TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
**************************************************
C1 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C2 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C3 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C4 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C5 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C6 GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
**************************************************
C1 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C2 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C3 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C4 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C5 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C6 CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
**************************************************
C1 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C2 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C3 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C4 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C5 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C6 AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
**************************************************
C1 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C2 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C3 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C4 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C5 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C6 CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
**************************************************
C1 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C2 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C3 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C4 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C5 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C6 CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
**************************************************
C1 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C2 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C3 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C4 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C5 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C6 AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
**************************************************
C1 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C2 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C3 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C4 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C5 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C6 TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
**************************************************
C1 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C2 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C3 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C4 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C5 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C6 GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
**************************************************
C1 TTAAGGCCACCCGG
C2 TTAAGGCCACCCGG
C3 TTAAGGCCACCCGG
C4 TTAAGGCCACCCGG
C5 TTAAGGCCACCCGG
C6 TTAAGGCCACCCGG
**************
>C1
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C2
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C3
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C4
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C5
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C6
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C1
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C2
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C3
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C4
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C5
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C6
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 6 taxa and 564 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1579788725
Setting output file names to "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1502241124
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0651772583
Seed = 472135240
Swapseed = 1579788725
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 4 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 4 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1262.258964 -- -24.965149
Chain 2 -- -1262.259037 -- -24.965149
Chain 3 -- -1262.259037 -- -24.965149
Chain 4 -- -1262.258964 -- -24.965149
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1262.259037 -- -24.965149
Chain 2 -- -1262.258964 -- -24.965149
Chain 3 -- -1262.259037 -- -24.965149
Chain 4 -- -1262.259037 -- -24.965149
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1262.259] (-1262.259) (-1262.259) (-1262.259) * [-1262.259] (-1262.259) (-1262.259) (-1262.259)
500 -- (-776.983) (-779.181) [-783.343] (-778.366) * (-794.569) [-784.052] (-787.173) (-789.818) -- 0:00:00
1000 -- [-777.378] (-784.803) (-772.631) (-780.659) * [-779.076] (-786.055) (-776.075) (-777.752) -- 0:00:00
1500 -- (-779.397) (-787.506) [-771.799] (-779.541) * (-779.857) (-772.064) [-775.843] (-776.140) -- 0:00:00
2000 -- (-773.901) [-777.558] (-778.861) (-778.320) * (-774.254) (-773.673) (-776.762) [-777.731] -- 0:00:00
2500 -- (-770.132) (-775.084) [-779.664] (-778.344) * (-773.645) (-774.223) (-777.192) [-774.711] -- 0:00:00
3000 -- [-773.141] (-780.238) (-774.179) (-778.294) * (-769.956) [-782.642] (-778.327) (-774.431) -- 0:00:00
3500 -- [-770.430] (-774.026) (-774.590) (-775.260) * [-777.255] (-774.794) (-777.257) (-777.042) -- 0:00:00
4000 -- (-772.070) (-785.911) (-772.128) [-773.534] * (-785.618) (-780.459) (-776.788) [-784.366] -- 0:00:00
4500 -- (-775.360) [-776.993] (-779.014) (-773.083) * (-780.513) (-779.709) (-776.520) [-782.511] -- 0:00:00
5000 -- [-776.822] (-783.148) (-778.180) (-787.208) * (-775.017) (-777.338) [-775.911] (-773.923) -- 0:00:00
Average standard deviation of split frequencies: 0.067344
5500 -- [-774.886] (-782.675) (-771.577) (-780.582) * (-777.117) (-776.013) [-777.839] (-780.154) -- 0:00:00
6000 -- [-778.522] (-778.604) (-787.147) (-773.474) * [-770.387] (-770.976) (-777.691) (-778.734) -- 0:00:00
6500 -- (-787.832) [-772.387] (-773.043) (-776.008) * [-776.371] (-774.996) (-783.746) (-775.552) -- 0:00:00
7000 -- (-775.838) (-773.583) [-770.601] (-776.566) * (-784.165) (-777.317) [-771.454] (-773.403) -- 0:00:00
7500 -- (-779.969) (-772.142) [-779.496] (-774.687) * [-774.485] (-774.566) (-777.461) (-778.755) -- 0:00:00
8000 -- (-774.945) (-772.652) [-770.423] (-777.978) * (-774.387) (-774.880) [-779.034] (-768.032) -- 0:00:00
8500 -- (-769.735) [-776.851] (-774.907) (-779.748) * [-770.326] (-776.736) (-784.654) (-780.568) -- 0:00:00
9000 -- (-766.515) (-778.011) [-778.762] (-768.739) * (-785.816) [-772.841] (-777.165) (-776.907) -- 0:00:00
9500 -- (-767.651) [-776.161] (-776.672) (-780.520) * (-776.513) (-780.752) (-772.750) [-780.775] -- 0:00:00
10000 -- [-766.589] (-784.377) (-774.878) (-774.853) * (-772.398) (-776.320) [-773.581] (-778.881) -- 0:00:00
Average standard deviation of split frequencies: 0.055243
10500 -- (-767.647) (-771.216) (-778.405) [-771.390] * (-775.412) (-774.299) (-774.654) [-772.933] -- 0:00:00
11000 -- (-766.343) (-787.009) (-773.640) [-777.698] * [-773.898] (-777.598) (-779.730) (-772.704) -- 0:00:00
11500 -- (-769.964) [-772.913] (-782.209) (-776.356) * (-771.776) [-779.510] (-782.208) (-773.444) -- 0:00:00
12000 -- (-768.648) (-774.612) [-779.690] (-774.553) * (-775.420) (-773.945) [-775.405] (-780.212) -- 0:00:00
12500 -- (-766.824) (-780.528) (-781.036) [-776.863] * (-778.426) (-775.000) [-776.719] (-775.010) -- 0:00:00
13000 -- [-766.540] (-780.884) (-782.919) (-782.568) * (-773.661) [-770.860] (-776.986) (-777.131) -- 0:00:00
13500 -- (-767.096) (-775.322) (-773.550) [-773.327] * (-786.854) [-774.495] (-779.005) (-780.623) -- 0:00:00
14000 -- (-767.449) (-777.454) (-769.662) [-775.560] * [-780.397] (-779.745) (-777.902) (-774.825) -- 0:00:00
14500 -- (-765.520) (-772.517) [-771.554] (-785.886) * (-780.003) (-773.551) (-779.339) [-773.421] -- 0:01:07
15000 -- [-765.954] (-772.254) (-782.607) (-773.905) * (-784.531) [-770.092] (-774.207) (-773.827) -- 0:01:05
Average standard deviation of split frequencies: 0.038302
15500 -- (-768.017) [-779.537] (-774.324) (-781.216) * [-771.345] (-782.263) (-775.732) (-775.058) -- 0:01:03
16000 -- (-766.520) (-779.965) (-780.113) [-773.737] * (-778.172) [-774.380] (-773.755) (-777.431) -- 0:01:01
16500 -- [-766.518] (-775.006) (-787.099) (-775.243) * (-781.009) (-776.050) (-782.396) [-773.235] -- 0:00:59
17000 -- [-766.239] (-777.038) (-776.698) (-785.017) * (-778.984) (-771.694) (-778.515) [-768.273] -- 0:00:57
17500 -- [-766.999] (-779.967) (-781.334) (-772.634) * (-784.978) (-771.266) (-773.608) [-771.524] -- 0:00:56
18000 -- (-765.914) (-779.185) (-773.783) [-773.586] * [-772.019] (-774.942) (-775.856) (-772.017) -- 0:00:54
18500 -- (-765.868) (-792.040) [-772.685] (-783.556) * [-766.540] (-771.133) (-778.381) (-783.783) -- 0:00:53
19000 -- (-767.989) (-777.920) [-772.815] (-790.938) * (-768.393) [-778.902] (-776.256) (-782.695) -- 0:00:51
19500 -- (-765.887) [-785.352] (-774.591) (-765.301) * (-765.041) [-774.764] (-782.488) (-772.244) -- 0:00:50
20000 -- [-765.734] (-783.233) (-775.008) (-767.055) * [-769.317] (-774.075) (-780.846) (-772.373) -- 0:00:49
Average standard deviation of split frequencies: 0.051322
20500 -- (-765.777) [-773.500] (-773.203) (-771.657) * (-769.329) (-777.850) [-776.476] (-778.497) -- 0:00:47
21000 -- (-767.802) (-766.815) (-772.963) [-768.447] * (-765.308) [-779.981] (-776.848) (-777.354) -- 0:00:46
21500 -- [-765.353] (-766.229) (-777.306) (-770.179) * [-766.830] (-785.301) (-776.541) (-773.646) -- 0:00:45
22000 -- (-766.858) (-768.402) (-772.287) [-765.853] * [-767.624] (-777.093) (-766.037) (-781.068) -- 0:00:44
22500 -- (-765.869) (-767.199) (-770.746) [-769.745] * (-769.593) [-779.576] (-767.677) (-781.044) -- 0:00:43
23000 -- [-765.157] (-766.444) (-779.634) (-765.819) * [-764.786] (-782.491) (-767.472) (-775.625) -- 0:00:42
23500 -- (-765.275) [-768.615] (-791.685) (-765.419) * (-767.237) (-778.012) [-767.953] (-778.999) -- 0:00:41
24000 -- [-767.062] (-765.277) (-766.056) (-766.201) * (-765.961) (-773.805) [-764.974] (-772.662) -- 0:00:40
24500 -- (-768.013) [-765.151] (-768.195) (-768.498) * (-766.273) [-775.306] (-767.692) (-781.983) -- 0:00:39
25000 -- [-767.197] (-766.812) (-768.463) (-768.236) * (-765.473) (-773.799) (-768.935) [-771.435] -- 0:00:39
Average standard deviation of split frequencies: 0.035438
25500 -- (-768.073) (-767.828) (-770.083) [-766.428] * (-765.570) [-774.327] (-767.729) (-780.549) -- 0:00:38
26000 -- (-766.459) [-765.582] (-770.250) (-768.556) * [-767.177] (-789.155) (-767.395) (-772.702) -- 0:00:37
26500 -- (-766.516) (-768.623) (-766.923) [-766.536] * (-766.580) [-780.709] (-766.680) (-771.741) -- 0:00:36
27000 -- (-769.213) (-769.514) [-765.484] (-768.950) * [-765.501] (-777.230) (-765.825) (-775.964) -- 0:00:36
27500 -- (-769.706) (-768.750) (-766.415) [-768.094] * (-769.280) (-783.405) [-767.698] (-772.125) -- 0:00:35
28000 -- (-765.950) (-768.778) (-770.508) [-767.611] * (-767.397) (-776.859) [-765.350] (-778.033) -- 0:00:34
28500 -- (-764.927) [-766.876] (-766.256) (-768.962) * [-767.215] (-778.495) (-766.489) (-775.166) -- 0:01:08
29000 -- (-765.488) [-768.934] (-765.547) (-767.957) * (-768.624) (-770.826) [-765.999] (-778.812) -- 0:01:06
29500 -- (-764.676) (-766.914) [-766.753] (-766.355) * (-768.460) [-778.190] (-765.562) (-779.706) -- 0:01:05
30000 -- [-765.619] (-768.351) (-767.017) (-768.208) * (-770.173) (-777.480) (-765.313) [-774.010] -- 0:01:04
Average standard deviation of split frequencies: 0.029975
30500 -- [-769.576] (-766.579) (-764.928) (-770.896) * (-765.306) [-770.654] (-766.661) (-771.848) -- 0:01:03
31000 -- (-766.917) (-768.400) [-765.870] (-767.294) * [-764.788] (-779.512) (-766.398) (-777.805) -- 0:01:02
31500 -- [-765.698] (-765.640) (-766.097) (-768.429) * (-764.818) (-764.601) [-765.641] (-775.783) -- 0:01:01
32000 -- (-765.618) (-766.403) [-765.990] (-767.857) * (-765.036) (-765.723) (-766.391) [-771.785] -- 0:01:00
32500 -- [-766.250] (-768.300) (-767.288) (-770.511) * [-764.832] (-765.320) (-765.115) (-771.241) -- 0:00:59
33000 -- (-765.252) (-766.820) (-765.382) [-767.788] * (-764.815) (-767.141) [-766.693] (-781.289) -- 0:00:58
33500 -- [-765.582] (-767.876) (-765.378) (-766.209) * [-765.840] (-769.987) (-767.386) (-776.626) -- 0:00:57
34000 -- (-767.492) (-768.757) (-765.965) [-765.605] * [-767.393] (-764.765) (-770.410) (-778.106) -- 0:00:56
34500 -- (-766.043) (-769.031) [-765.442] (-764.971) * (-769.080) (-766.361) [-765.828] (-780.898) -- 0:00:55
35000 -- (-766.894) (-764.934) (-765.917) [-767.230] * (-766.214) (-765.509) (-765.485) [-775.882] -- 0:00:55
Average standard deviation of split frequencies: 0.033391
35500 -- [-766.948] (-765.709) (-765.293) (-769.647) * (-766.844) [-765.159] (-766.523) (-776.334) -- 0:00:54
36000 -- (-767.052) (-766.253) [-765.592] (-767.532) * (-767.608) [-764.902] (-767.611) (-780.718) -- 0:00:53
36500 -- (-767.399) [-765.859] (-764.725) (-769.907) * (-769.210) (-767.838) (-767.214) [-773.067] -- 0:00:52
37000 -- [-767.061] (-767.503) (-770.942) (-773.974) * (-769.267) (-769.528) [-770.800] (-778.046) -- 0:00:52
37500 -- [-766.990] (-766.960) (-766.856) (-765.194) * (-767.293) (-766.020) (-767.614) [-772.816] -- 0:00:51
38000 -- (-764.930) (-766.823) [-766.019] (-769.344) * (-768.026) (-766.763) [-765.731] (-781.135) -- 0:00:50
38500 -- (-765.301) [-765.876] (-766.369) (-778.677) * (-766.406) [-768.557] (-764.834) (-778.543) -- 0:00:49
39000 -- (-765.112) [-764.562] (-769.951) (-770.567) * (-771.929) (-765.448) [-765.505] (-782.797) -- 0:00:49
39500 -- (-766.089) (-767.575) (-765.672) [-767.599] * (-769.892) (-767.450) [-766.018] (-779.474) -- 0:00:48
40000 -- (-769.669) (-769.460) [-766.449] (-768.085) * (-768.500) [-768.519] (-767.371) (-766.987) -- 0:00:48
Average standard deviation of split frequencies: 0.037826
40500 -- (-765.248) [-767.945] (-767.085) (-767.266) * (-768.576) (-766.947) [-768.236] (-766.241) -- 0:00:47
41000 -- (-768.074) (-767.807) [-769.098] (-767.119) * (-771.472) [-765.799] (-769.443) (-767.437) -- 0:00:46
41500 -- (-768.716) (-772.840) (-765.648) [-767.627] * (-766.746) (-767.586) (-768.340) [-766.265] -- 0:00:46
42000 -- (-765.817) [-770.847] (-765.944) (-766.844) * (-767.582) (-767.591) [-766.384] (-764.894) -- 0:00:45
42500 -- [-767.976] (-768.183) (-765.728) (-769.263) * (-766.162) (-766.626) (-766.927) [-765.232] -- 0:00:45
43000 -- (-767.190) (-765.048) [-765.106] (-771.011) * [-769.700] (-766.794) (-767.014) (-768.498) -- 0:00:44
43500 -- [-766.467] (-767.878) (-767.500) (-766.692) * (-765.599) (-765.903) [-767.888] (-767.161) -- 0:00:43
44000 -- [-766.913] (-765.756) (-770.654) (-766.709) * (-766.037) [-765.219] (-766.162) (-766.529) -- 0:00:43
44500 -- (-767.149) (-765.836) [-764.643] (-768.787) * (-765.385) [-765.481] (-766.638) (-765.637) -- 0:01:04
45000 -- (-767.739) (-768.118) [-767.457] (-771.512) * (-766.829) [-765.402] (-767.050) (-768.156) -- 0:01:03
Average standard deviation of split frequencies: 0.033818
45500 -- (-766.608) (-767.870) (-769.225) [-766.625] * [-765.229] (-764.799) (-764.805) (-768.317) -- 0:01:02
46000 -- (-768.760) (-768.304) [-765.760] (-765.888) * (-764.838) [-764.751] (-767.811) (-765.908) -- 0:01:02
46500 -- (-768.919) (-766.402) [-766.773] (-765.286) * (-764.646) [-767.017] (-771.640) (-765.973) -- 0:01:01
47000 -- (-768.423) [-765.218] (-770.616) (-766.689) * [-764.633] (-768.895) (-768.837) (-769.304) -- 0:01:00
47500 -- (-766.739) (-767.227) [-766.840] (-764.802) * (-764.855) (-769.049) [-765.627] (-769.890) -- 0:01:00
48000 -- (-771.716) (-767.485) [-766.467] (-766.375) * (-764.611) (-768.845) [-767.624] (-767.990) -- 0:00:59
48500 -- (-769.709) [-768.527] (-767.093) (-765.847) * [-765.825] (-766.790) (-769.407) (-766.494) -- 0:00:58
49000 -- (-766.036) (-765.959) [-767.021] (-765.299) * (-768.705) [-766.550] (-765.606) (-766.426) -- 0:00:58
49500 -- (-765.818) (-766.686) [-771.865] (-768.748) * (-767.280) (-768.203) (-765.845) [-764.801] -- 0:00:57
50000 -- (-766.784) (-769.278) [-765.311] (-765.635) * (-766.081) (-771.011) [-765.828] (-765.326) -- 0:00:57
Average standard deviation of split frequencies: 0.035887
50500 -- (-766.285) (-770.226) (-765.914) [-768.683] * (-767.785) (-770.060) [-766.255] (-768.307) -- 0:00:56
51000 -- (-768.466) (-769.441) (-768.359) [-766.523] * (-770.403) (-774.759) (-767.158) [-768.549] -- 0:00:55
51500 -- (-766.135) (-772.347) (-767.221) [-766.946] * (-766.050) (-767.057) (-768.278) [-765.327] -- 0:00:55
52000 -- (-766.866) (-768.350) (-766.553) [-766.021] * (-767.019) (-766.803) (-767.980) [-765.327] -- 0:00:54
52500 -- (-768.111) (-769.485) [-769.305] (-767.122) * (-766.314) (-766.148) [-767.464] (-766.134) -- 0:00:54
53000 -- (-768.567) (-764.820) (-769.098) [-764.946] * (-765.769) (-765.886) (-767.483) [-765.945] -- 0:00:53
53500 -- (-767.131) (-766.811) [-767.591] (-768.063) * (-767.220) (-766.835) [-767.552] (-767.060) -- 0:00:53
54000 -- (-767.087) (-770.710) (-766.982) [-766.832] * [-764.902] (-765.394) (-769.547) (-766.734) -- 0:00:52
54500 -- [-768.507] (-771.957) (-765.945) (-765.344) * (-767.356) (-766.003) (-769.581) [-765.847] -- 0:00:52
55000 -- (-766.687) (-770.544) [-765.968] (-765.396) * [-767.159] (-765.628) (-774.452) (-767.969) -- 0:00:51
Average standard deviation of split frequencies: 0.030866
55500 -- (-765.372) (-771.453) [-765.817] (-764.436) * [-764.732] (-768.000) (-766.900) (-767.133) -- 0:00:51
56000 -- (-766.986) [-769.171] (-768.444) (-767.340) * (-766.196) (-766.836) (-768.475) [-767.553] -- 0:00:50
56500 -- (-766.732) [-769.171] (-765.739) (-767.159) * (-767.205) [-767.013] (-770.348) (-769.679) -- 0:00:50
57000 -- (-768.563) [-766.491] (-766.526) (-769.663) * (-769.651) (-769.855) [-767.980] (-766.328) -- 0:00:49
57500 -- (-769.185) [-767.790] (-768.317) (-772.472) * (-769.596) [-765.225] (-767.273) (-765.777) -- 0:00:49
58000 -- (-768.778) (-769.220) (-771.487) [-767.803] * [-771.937] (-765.882) (-767.655) (-765.599) -- 0:00:48
58500 -- (-771.066) [-765.179] (-766.496) (-767.411) * (-772.296) [-765.347] (-767.369) (-765.205) -- 0:00:48
59000 -- (-769.278) [-767.202] (-766.563) (-766.359) * (-766.703) (-767.038) (-766.565) [-765.128] -- 0:00:47
59500 -- [-767.997] (-771.264) (-766.217) (-765.718) * [-765.874] (-767.685) (-765.990) (-767.227) -- 0:00:47
60000 -- (-770.380) [-767.517] (-769.561) (-765.984) * (-767.866) (-768.731) (-766.720) [-771.044] -- 0:01:02
Average standard deviation of split frequencies: 0.028256
60500 -- (-770.040) [-766.616] (-765.921) (-765.004) * (-765.085) (-766.975) [-767.494] (-770.911) -- 0:01:02
61000 -- (-770.312) (-765.680) [-765.864] (-767.618) * (-765.597) (-767.662) (-768.213) [-765.008] -- 0:01:01
61500 -- (-765.219) (-766.053) [-765.519] (-765.841) * (-767.103) (-770.366) [-766.699] (-766.408) -- 0:01:01
62000 -- (-766.877) [-765.775] (-766.551) (-765.952) * (-767.435) (-767.879) (-768.503) [-765.069] -- 0:01:00
62500 -- [-765.260] (-767.530) (-768.775) (-767.251) * [-766.422] (-766.899) (-766.639) (-765.592) -- 0:01:00
63000 -- [-768.166] (-765.406) (-767.309) (-766.473) * (-766.067) [-767.032] (-767.924) (-766.348) -- 0:00:59
63500 -- (-767.205) (-768.560) [-775.639] (-765.450) * [-765.981] (-773.843) (-769.141) (-767.725) -- 0:00:58
64000 -- (-765.223) [-766.926] (-768.450) (-766.373) * [-770.249] (-764.620) (-766.600) (-770.543) -- 0:00:58
64500 -- (-767.067) [-768.291] (-768.571) (-770.200) * (-766.320) [-765.009] (-768.476) (-767.292) -- 0:00:58
65000 -- (-767.371) [-766.731] (-767.456) (-766.119) * (-764.651) (-768.467) (-765.763) [-767.579] -- 0:00:57
Average standard deviation of split frequencies: 0.025154
65500 -- [-766.870] (-767.233) (-766.044) (-765.619) * (-764.651) (-766.681) [-766.530] (-767.223) -- 0:00:57
66000 -- (-767.789) (-765.731) [-766.747] (-766.903) * (-768.095) (-768.515) (-767.068) [-766.908] -- 0:00:56
66500 -- (-770.475) (-766.559) [-765.516] (-770.615) * [-764.663] (-769.580) (-765.861) (-768.079) -- 0:00:56
67000 -- (-770.380) (-769.039) [-768.451] (-766.237) * (-765.024) (-767.843) [-769.728] (-766.867) -- 0:00:55
67500 -- [-770.376] (-770.339) (-766.476) (-766.575) * (-765.569) (-765.735) [-766.464] (-767.920) -- 0:00:55
68000 -- (-768.333) (-769.722) [-766.501] (-766.483) * (-765.263) (-765.066) (-769.057) [-766.929] -- 0:00:54
68500 -- (-766.546) (-768.788) (-766.705) [-767.391] * [-767.065] (-768.260) (-766.962) (-767.929) -- 0:00:54
69000 -- (-765.745) (-768.491) [-765.408] (-768.907) * [-765.875] (-770.191) (-767.387) (-769.270) -- 0:00:53
69500 -- (-768.034) (-769.350) (-765.911) [-766.623] * (-767.584) [-767.395] (-768.889) (-768.519) -- 0:00:53
70000 -- (-767.724) (-768.549) [-766.297] (-767.505) * (-768.408) [-766.985] (-766.446) (-766.037) -- 0:00:53
Average standard deviation of split frequencies: 0.027954
70500 -- (-767.025) (-768.695) [-764.860] (-765.294) * (-768.436) [-765.674] (-765.976) (-765.841) -- 0:00:52
71000 -- (-765.891) (-766.353) [-766.572] (-768.415) * (-775.874) (-767.817) [-765.300] (-767.920) -- 0:00:52
71500 -- (-765.337) [-766.962] (-768.372) (-766.436) * (-773.357) (-773.451) [-766.473] (-766.873) -- 0:00:51
72000 -- (-767.136) (-765.031) [-766.471] (-766.882) * (-771.198) (-768.446) [-769.457] (-768.548) -- 0:00:51
72500 -- (-767.960) [-765.701] (-766.855) (-765.461) * [-773.500] (-767.397) (-766.081) (-766.539) -- 0:00:51
73000 -- [-766.635] (-768.165) (-768.398) (-767.118) * (-767.864) [-768.818] (-768.610) (-766.298) -- 0:00:50
73500 -- (-768.033) (-770.236) [-766.643] (-766.739) * (-765.273) (-770.266) (-767.720) [-767.364] -- 0:00:50
74000 -- (-767.147) [-765.849] (-768.242) (-766.312) * [-768.620] (-767.350) (-765.598) (-771.802) -- 0:00:50
74500 -- [-766.898] (-770.895) (-766.388) (-768.352) * [-769.583] (-766.015) (-768.462) (-767.773) -- 0:00:49
75000 -- [-766.757] (-767.534) (-765.337) (-765.930) * (-770.343) (-766.652) (-767.501) [-769.138] -- 0:00:49
Average standard deviation of split frequencies: 0.027912
75500 -- [-765.777] (-766.115) (-767.791) (-767.483) * [-768.524] (-768.065) (-767.201) (-768.199) -- 0:00:48
76000 -- (-768.509) [-768.079] (-765.512) (-768.728) * [-768.953] (-766.393) (-768.720) (-766.799) -- 0:00:48
76500 -- (-768.492) (-765.844) [-764.691] (-766.950) * (-764.901) [-765.927] (-768.242) (-766.206) -- 0:01:00
77000 -- (-764.762) (-769.534) [-765.296] (-771.679) * (-765.060) (-765.249) (-768.709) [-766.564] -- 0:00:59
77500 -- (-766.068) (-773.476) (-766.472) [-768.200] * (-765.386) [-766.612] (-767.352) (-765.764) -- 0:00:59
78000 -- [-765.327] (-768.525) (-766.650) (-767.345) * (-766.337) (-766.650) (-766.332) [-765.668] -- 0:00:59
78500 -- (-765.252) (-766.488) [-764.882] (-768.745) * (-766.744) (-765.620) (-768.401) [-767.183] -- 0:00:58
79000 -- (-768.218) (-766.083) (-766.076) [-768.637] * (-765.125) [-768.646] (-766.236) (-770.842) -- 0:00:58
79500 -- (-769.502) [-766.918] (-764.545) (-768.576) * (-767.582) [-766.074] (-765.600) (-767.763) -- 0:00:57
80000 -- (-766.804) (-767.303) [-764.857] (-764.973) * (-765.490) (-768.636) [-767.540] (-767.476) -- 0:00:57
Average standard deviation of split frequencies: 0.025973
80500 -- (-766.264) [-769.023] (-766.122) (-768.679) * [-767.661] (-768.863) (-766.556) (-768.000) -- 0:00:57
81000 -- (-765.845) (-771.697) (-767.003) [-771.366] * (-771.591) [-767.839] (-767.106) (-765.480) -- 0:00:56
81500 -- (-766.328) (-775.017) [-764.699] (-765.902) * (-768.099) (-765.727) (-768.626) [-765.698] -- 0:00:56
82000 -- (-766.324) (-770.431) (-767.220) [-766.167] * (-767.169) [-764.914] (-767.953) (-769.233) -- 0:00:55
82500 -- [-765.081] (-767.844) (-768.237) (-766.269) * [-766.810] (-767.842) (-770.128) (-765.391) -- 0:00:55
83000 -- (-766.807) [-767.454] (-765.272) (-766.119) * (-765.084) (-770.288) (-770.644) [-768.589] -- 0:00:55
83500 -- [-768.740] (-770.407) (-765.164) (-768.245) * (-766.496) (-768.063) [-766.677] (-767.090) -- 0:00:54
84000 -- (-765.673) (-767.339) [-767.440] (-766.638) * (-765.327) (-765.980) [-765.589] (-768.028) -- 0:00:54
84500 -- [-765.033] (-771.091) (-766.909) (-766.081) * [-767.323] (-766.488) (-772.723) (-766.548) -- 0:00:54
85000 -- [-766.385] (-768.358) (-766.485) (-767.545) * (-769.257) [-768.253] (-768.164) (-767.397) -- 0:00:53
Average standard deviation of split frequencies: 0.020830
85500 -- [-766.894] (-769.178) (-767.787) (-768.212) * [-768.742] (-771.309) (-765.811) (-765.920) -- 0:00:53
86000 -- (-769.822) (-765.405) [-768.735] (-767.192) * (-767.108) (-768.667) (-765.576) [-766.579] -- 0:00:53
86500 -- (-766.028) [-765.483] (-767.346) (-767.056) * (-767.084) (-771.323) (-768.383) [-766.425] -- 0:00:52
87000 -- [-765.986] (-765.840) (-768.092) (-766.277) * (-768.383) (-768.002) (-768.959) [-767.663] -- 0:00:52
87500 -- (-770.488) (-766.199) [-766.331] (-765.436) * [-766.069] (-772.979) (-766.755) (-768.263) -- 0:00:52
88000 -- (-770.264) (-765.931) (-768.821) [-765.260] * (-766.017) (-772.555) (-766.544) [-766.321] -- 0:00:51
88500 -- (-769.186) (-766.719) (-769.860) [-765.139] * (-767.398) (-774.219) [-764.976] (-765.918) -- 0:00:51
89000 -- (-765.290) (-768.664) [-766.925] (-765.357) * (-768.951) (-769.202) (-765.778) [-765.618] -- 0:00:51
89500 -- (-766.062) (-767.828) [-765.154] (-767.409) * (-768.256) (-771.925) [-769.897] (-767.938) -- 0:00:50
90000 -- [-765.503] (-767.024) (-764.515) (-766.093) * (-768.206) (-769.947) [-766.338] (-766.186) -- 0:00:50
Average standard deviation of split frequencies: 0.022097
90500 -- [-765.127] (-766.439) (-766.638) (-766.482) * (-765.253) (-766.855) (-768.021) [-767.631] -- 0:00:50
91000 -- (-765.357) (-765.745) (-767.283) [-765.480] * (-764.968) (-769.321) (-765.877) [-766.173] -- 0:00:59
91500 -- [-766.111] (-765.992) (-768.454) (-768.815) * (-766.705) (-769.522) (-765.914) [-768.188] -- 0:00:59
92000 -- (-766.736) (-764.765) (-766.074) [-764.944] * (-766.850) (-771.712) (-766.895) [-766.281] -- 0:00:59
92500 -- (-767.736) [-766.424] (-768.944) (-765.806) * [-765.160] (-769.095) (-766.503) (-768.877) -- 0:00:58
93000 -- (-766.758) [-769.648] (-767.500) (-764.865) * (-766.796) (-765.576) [-766.136] (-769.271) -- 0:00:58
93500 -- [-768.807] (-766.343) (-767.179) (-766.671) * (-766.606) (-764.953) [-765.856] (-769.429) -- 0:00:58
94000 -- (-769.232) (-765.139) (-770.711) [-767.303] * [-767.763] (-771.076) (-768.545) (-765.693) -- 0:00:57
94500 -- (-770.423) (-766.082) (-767.847) [-765.507] * (-769.602) (-765.563) [-766.634] (-769.020) -- 0:00:57
95000 -- (-767.618) (-764.974) (-768.191) [-765.712] * (-766.071) (-766.473) [-765.894] (-769.386) -- 0:00:57
Average standard deviation of split frequencies: 0.023149
95500 -- (-766.184) (-767.711) (-767.600) [-766.389] * [-769.850] (-765.539) (-765.589) (-775.157) -- 0:00:56
96000 -- (-765.847) (-765.558) (-766.409) [-767.460] * (-765.186) (-767.755) (-768.052) [-767.244] -- 0:00:56
96500 -- [-766.413] (-765.730) (-768.704) (-771.051) * (-766.444) (-765.268) [-765.990] (-766.050) -- 0:00:56
97000 -- (-766.714) [-766.831] (-766.171) (-769.333) * [-765.016] (-765.700) (-767.507) (-765.378) -- 0:00:55
97500 -- (-766.886) [-766.764] (-771.620) (-768.233) * (-764.870) [-767.748] (-766.684) (-768.973) -- 0:00:55
98000 -- (-769.124) [-765.630] (-765.602) (-765.568) * [-764.804] (-766.532) (-768.952) (-766.947) -- 0:00:55
98500 -- (-767.577) (-769.666) [-765.653] (-765.484) * [-767.178] (-769.987) (-767.130) (-767.931) -- 0:00:54
99000 -- (-765.922) (-767.806) [-766.709] (-767.470) * [-766.681] (-767.159) (-771.988) (-767.043) -- 0:00:54
99500 -- (-765.819) (-769.413) (-772.232) [-767.877] * (-766.697) [-768.678] (-769.735) (-769.415) -- 0:00:54
100000 -- (-765.967) (-770.030) [-765.716] (-767.376) * [-765.041] (-767.741) (-764.808) (-766.450) -- 0:00:54
Average standard deviation of split frequencies: 0.024752
100500 -- [-767.829] (-767.971) (-767.994) (-765.461) * (-768.391) (-766.571) [-765.753] (-770.774) -- 0:00:53
101000 -- [-768.565] (-766.100) (-769.354) (-769.924) * (-767.113) [-766.714] (-774.155) (-766.934) -- 0:00:53
101500 -- (-766.102) (-771.368) [-769.479] (-769.411) * (-765.707) [-767.316] (-770.246) (-768.459) -- 0:00:53
102000 -- (-765.051) (-766.292) [-766.357] (-766.160) * (-769.109) [-766.224] (-768.285) (-768.260) -- 0:00:52
102500 -- (-765.235) (-766.938) [-764.979] (-765.997) * (-765.771) (-766.713) [-765.611] (-765.895) -- 0:00:52
103000 -- [-764.748] (-767.602) (-765.152) (-768.511) * [-765.711] (-766.759) (-768.007) (-765.925) -- 0:00:52
103500 -- [-766.044] (-766.781) (-767.430) (-767.220) * (-764.971) (-766.553) [-768.582] (-765.890) -- 0:00:51
104000 -- (-769.831) [-766.486] (-767.329) (-771.289) * [-765.757] (-765.888) (-765.176) (-766.137) -- 0:00:51
104500 -- (-767.190) (-768.147) [-767.634] (-766.078) * (-766.782) (-768.692) (-765.735) [-765.312] -- 0:00:51
105000 -- (-766.742) (-766.949) (-766.270) [-767.463] * (-764.988) [-765.138] (-767.751) (-767.652) -- 0:00:51
Average standard deviation of split frequencies: 0.022236
105500 -- [-768.096] (-768.188) (-767.649) (-767.853) * (-765.789) (-766.104) [-767.059] (-768.341) -- 0:00:50
106000 -- (-766.647) (-768.220) (-768.162) [-765.609] * (-769.385) (-767.000) [-766.550] (-768.427) -- 0:00:59
106500 -- (-768.333) (-771.250) [-768.148] (-767.375) * (-765.695) (-767.088) [-765.214] (-766.297) -- 0:00:58
107000 -- (-767.250) [-766.433] (-775.607) (-770.035) * (-767.702) (-772.262) (-765.213) [-769.234] -- 0:00:58
107500 -- (-765.845) [-765.555] (-766.508) (-772.636) * [-766.915] (-767.255) (-767.057) (-771.358) -- 0:00:58
108000 -- (-766.467) (-765.140) (-766.255) [-769.645] * (-765.115) (-768.853) [-767.168] (-766.467) -- 0:00:57
108500 -- (-766.960) (-766.357) [-769.596] (-766.052) * (-769.367) (-768.144) (-765.310) [-767.783] -- 0:00:57
109000 -- (-767.673) (-766.469) (-770.510) [-769.052] * [-768.993] (-768.550) (-766.018) (-765.683) -- 0:00:57
109500 -- (-767.413) (-765.827) [-764.634] (-764.659) * (-768.733) (-767.718) (-766.212) [-765.893] -- 0:00:56
110000 -- [-767.347] (-766.298) (-765.997) (-766.957) * (-767.879) (-769.148) (-768.790) [-765.050] -- 0:00:56
Average standard deviation of split frequencies: 0.022576
110500 -- [-766.633] (-767.412) (-766.022) (-766.240) * [-764.998] (-771.183) (-769.963) (-767.177) -- 0:00:56
111000 -- (-766.846) (-768.980) (-767.137) [-767.047] * (-764.933) (-768.672) [-767.181] (-766.942) -- 0:00:56
111500 -- (-769.474) [-765.644] (-769.118) (-768.422) * (-768.093) [-766.107] (-766.819) (-768.954) -- 0:00:55
112000 -- (-766.919) [-767.446] (-770.734) (-767.976) * [-768.635] (-765.561) (-765.772) (-769.213) -- 0:00:55
112500 -- (-768.972) (-769.143) [-770.757] (-766.385) * [-765.965] (-767.380) (-766.475) (-769.374) -- 0:00:55
113000 -- (-766.022) (-767.542) [-768.297] (-767.324) * (-767.769) (-766.341) [-766.781] (-769.035) -- 0:00:54
113500 -- (-766.120) [-766.633] (-766.731) (-767.059) * (-766.483) (-769.405) (-766.657) [-766.642] -- 0:00:54
114000 -- [-770.394] (-766.826) (-768.619) (-765.984) * [-765.650] (-766.630) (-770.788) (-766.598) -- 0:00:54
114500 -- [-767.453] (-765.693) (-766.018) (-766.329) * (-764.924) [-766.900] (-768.830) (-771.144) -- 0:00:54
115000 -- [-766.099] (-765.403) (-767.392) (-766.063) * (-769.793) (-766.059) (-769.067) [-766.823] -- 0:00:53
Average standard deviation of split frequencies: 0.023164
115500 -- (-767.329) (-765.572) (-765.542) [-769.037] * (-766.313) (-767.108) [-771.411] (-765.654) -- 0:00:53
116000 -- (-767.833) (-766.151) [-769.145] (-771.809) * (-768.374) (-766.205) [-764.984] (-766.108) -- 0:00:53
116500 -- (-766.632) [-766.091] (-767.134) (-766.609) * [-764.911] (-766.032) (-766.305) (-767.329) -- 0:00:53
117000 -- [-766.526] (-769.538) (-765.571) (-766.310) * (-775.665) (-768.667) [-765.905] (-766.575) -- 0:00:52
117500 -- [-769.617] (-767.658) (-766.760) (-764.720) * (-766.974) (-766.217) (-767.447) [-765.164] -- 0:00:52
118000 -- (-769.083) (-767.274) (-765.437) [-768.293] * (-768.887) (-765.999) [-766.936] (-768.621) -- 0:00:52
118500 -- (-766.567) (-770.864) [-765.475] (-766.194) * [-767.412] (-770.345) (-765.934) (-768.936) -- 0:00:52
119000 -- (-765.759) [-766.960] (-767.550) (-769.460) * [-765.679] (-769.847) (-768.350) (-769.856) -- 0:00:51
119500 -- (-767.656) [-766.583] (-767.866) (-769.062) * (-771.264) [-765.394] (-767.960) (-767.051) -- 0:00:51
120000 -- (-766.087) (-767.339) (-765.303) [-767.047] * (-773.751) [-765.706] (-766.458) (-769.244) -- 0:00:51
Average standard deviation of split frequencies: 0.024026
120500 -- (-766.555) [-766.727] (-767.119) (-765.947) * (-766.393) (-767.235) [-768.247] (-766.628) -- 0:00:51
121000 -- (-766.955) [-765.743] (-768.472) (-769.508) * (-768.769) (-766.916) [-765.623] (-770.942) -- 0:00:58
121500 -- (-767.945) [-766.230] (-768.814) (-770.503) * [-765.264] (-768.152) (-766.853) (-765.248) -- 0:00:57
122000 -- [-764.994] (-765.651) (-765.316) (-772.200) * (-766.689) (-767.278) (-766.377) [-764.969] -- 0:00:57
122500 -- [-764.863] (-764.995) (-766.355) (-765.651) * (-767.155) (-769.098) [-768.255] (-768.127) -- 0:00:57
123000 -- (-764.919) [-767.663] (-768.267) (-770.684) * (-768.989) [-767.083] (-767.820) (-769.856) -- 0:00:57
123500 -- (-765.763) (-766.312) [-767.117] (-767.034) * (-768.914) [-768.174] (-766.120) (-768.165) -- 0:00:56
124000 -- [-764.913] (-765.250) (-765.890) (-766.139) * [-765.254] (-765.769) (-768.695) (-767.458) -- 0:00:56
124500 -- [-766.842] (-766.697) (-765.367) (-765.039) * (-768.503) (-765.613) (-767.904) [-766.673] -- 0:00:56
125000 -- (-766.023) (-768.336) (-767.382) [-765.450] * (-765.151) (-769.357) (-765.387) [-766.333] -- 0:00:56
Average standard deviation of split frequencies: 0.024999
125500 -- (-770.944) [-765.042] (-765.989) (-767.603) * (-765.244) (-767.481) [-766.693] (-768.734) -- 0:00:55
126000 -- [-769.565] (-764.542) (-764.995) (-768.619) * (-765.477) [-766.308] (-770.490) (-765.644) -- 0:00:55
126500 -- (-766.846) (-765.618) [-765.323] (-766.220) * (-765.550) (-767.469) [-767.304] (-765.512) -- 0:00:55
127000 -- [-765.590] (-765.605) (-766.873) (-768.607) * (-764.896) (-769.023) (-765.988) [-769.071] -- 0:00:54
127500 -- [-764.885] (-766.959) (-768.110) (-767.344) * (-765.662) (-767.767) (-767.846) [-766.941] -- 0:00:54
128000 -- [-765.848] (-767.070) (-769.511) (-767.639) * (-765.205) (-767.849) (-765.567) [-765.236] -- 0:00:54
128500 -- (-765.995) [-765.966] (-766.756) (-767.383) * [-764.911] (-769.396) (-764.887) (-765.265) -- 0:00:54
129000 -- (-766.798) [-766.834] (-767.256) (-765.936) * (-766.262) (-768.505) [-765.172] (-766.607) -- 0:00:54
129500 -- (-766.817) (-766.936) [-765.550] (-768.948) * (-769.374) (-765.642) [-766.828] (-765.787) -- 0:00:53
130000 -- [-767.600] (-768.411) (-766.061) (-767.101) * (-766.568) (-766.531) [-766.089] (-766.108) -- 0:00:53
Average standard deviation of split frequencies: 0.023536
130500 -- (-770.212) (-766.687) [-764.820] (-768.867) * (-767.033) [-765.667] (-766.239) (-765.513) -- 0:00:53
131000 -- (-768.334) (-767.409) [-765.722] (-768.294) * (-765.476) (-765.147) [-767.384] (-767.371) -- 0:00:53
131500 -- (-766.323) (-765.972) (-767.397) [-765.231] * (-765.749) (-765.731) (-766.702) [-766.520] -- 0:00:52
132000 -- (-768.865) (-770.671) (-768.971) [-767.086] * (-766.352) (-769.739) (-765.752) [-767.784] -- 0:00:52
132500 -- (-769.286) [-765.978] (-768.671) (-765.225) * [-767.039] (-770.128) (-766.768) (-769.731) -- 0:00:52
133000 -- (-770.403) (-765.073) [-768.522] (-770.642) * [-765.199] (-769.918) (-765.654) (-766.695) -- 0:00:52
133500 -- (-768.209) (-765.553) [-768.138] (-765.369) * (-765.018) (-766.211) (-768.996) [-771.246] -- 0:00:51
134000 -- (-766.068) [-766.650] (-770.695) (-765.923) * (-766.801) (-770.038) (-766.392) [-766.183] -- 0:00:51
134500 -- (-766.982) (-766.054) [-768.674] (-766.306) * (-774.833) [-769.693] (-767.553) (-765.616) -- 0:00:51
135000 -- (-766.892) (-767.696) (-768.017) [-767.238] * (-770.024) [-772.458] (-770.403) (-768.878) -- 0:00:51
Average standard deviation of split frequencies: 0.022943
135500 -- [-769.540] (-766.404) (-764.787) (-766.142) * [-769.457] (-765.322) (-767.257) (-769.123) -- 0:00:57
136000 -- (-774.826) (-765.528) [-765.543] (-765.392) * (-765.662) (-766.539) [-767.190] (-771.578) -- 0:00:57
136500 -- (-771.628) [-767.138] (-766.005) (-764.716) * (-765.679) (-765.029) [-766.582] (-775.635) -- 0:00:56
137000 -- (-771.797) [-766.800] (-765.558) (-766.221) * (-766.688) (-770.188) [-766.621] (-779.017) -- 0:00:56
137500 -- (-767.476) (-768.313) [-766.309] (-766.196) * (-767.694) (-768.224) (-768.055) [-769.924] -- 0:00:56
138000 -- [-766.718] (-770.332) (-765.954) (-765.147) * (-768.282) [-766.224] (-766.930) (-772.881) -- 0:00:56
138500 -- (-768.240) [-765.724] (-769.948) (-769.163) * (-770.442) (-771.165) (-768.005) [-767.902] -- 0:00:55
139000 -- (-768.330) (-766.410) [-769.438] (-766.682) * [-767.780] (-770.774) (-765.651) (-765.824) -- 0:00:55
139500 -- [-765.957] (-770.910) (-766.200) (-767.651) * (-767.100) (-771.996) (-767.194) [-765.027] -- 0:00:55
140000 -- (-770.399) (-770.438) [-764.813] (-766.441) * (-768.625) (-768.352) (-767.239) [-766.175] -- 0:00:55
Average standard deviation of split frequencies: 0.022453
140500 -- [-765.769] (-768.620) (-765.219) (-771.559) * (-771.791) (-766.309) (-767.640) [-765.200] -- 0:00:55
141000 -- [-765.911] (-767.775) (-766.145) (-772.112) * (-767.269) [-765.359] (-767.627) (-769.414) -- 0:00:54
141500 -- [-766.828] (-767.584) (-766.830) (-765.061) * (-768.534) (-766.230) [-767.229] (-768.563) -- 0:00:54
142000 -- (-769.486) (-765.387) [-767.418] (-766.207) * [-766.410] (-768.117) (-766.728) (-765.981) -- 0:00:54
142500 -- (-768.985) [-765.105] (-768.873) (-766.465) * (-767.378) [-765.727] (-770.186) (-765.521) -- 0:00:54
143000 -- (-764.817) [-765.511] (-768.026) (-767.926) * (-768.958) [-765.472] (-766.090) (-768.767) -- 0:00:53
143500 -- (-766.534) (-769.294) [-767.620] (-766.807) * [-764.919] (-764.973) (-767.298) (-767.895) -- 0:00:53
144000 -- (-767.502) [-765.913] (-767.457) (-767.011) * [-766.021] (-770.962) (-767.457) (-768.207) -- 0:00:53
144500 -- [-768.637] (-766.571) (-768.125) (-767.279) * (-765.843) (-767.120) [-766.870] (-767.534) -- 0:00:53
145000 -- (-766.019) (-766.322) (-766.789) [-767.015] * [-766.306] (-766.365) (-767.616) (-771.023) -- 0:00:53
Average standard deviation of split frequencies: 0.022140
145500 -- (-767.043) (-768.621) [-767.993] (-765.428) * (-766.493) [-765.362] (-767.106) (-767.694) -- 0:00:52
146000 -- [-769.473] (-767.975) (-768.609) (-765.080) * [-769.348] (-765.667) (-777.643) (-766.014) -- 0:00:52
146500 -- (-768.970) (-766.203) [-765.836] (-764.983) * (-767.818) (-765.500) (-766.978) [-765.975] -- 0:00:52
147000 -- (-768.334) (-767.478) [-766.065] (-766.043) * (-767.689) [-766.969] (-768.740) (-766.721) -- 0:00:52
147500 -- [-765.619] (-766.546) (-769.983) (-767.315) * (-767.470) [-766.603] (-765.559) (-767.297) -- 0:00:52
148000 -- (-766.017) [-767.981] (-771.910) (-765.233) * (-771.515) (-768.590) [-765.268] (-765.698) -- 0:00:51
148500 -- [-766.942] (-765.395) (-771.784) (-766.432) * (-767.194) [-765.849] (-767.685) (-766.185) -- 0:00:51
149000 -- (-766.768) (-766.980) [-767.614] (-765.662) * (-765.841) [-765.280] (-765.499) (-767.874) -- 0:00:51
149500 -- (-766.856) [-766.644] (-765.587) (-765.930) * (-765.681) (-765.172) (-769.942) [-765.648] -- 0:00:56
150000 -- [-768.485] (-765.773) (-765.201) (-769.106) * (-769.463) [-766.374] (-774.404) (-766.665) -- 0:00:56
Average standard deviation of split frequencies: 0.019711
150500 -- [-766.969] (-771.734) (-765.422) (-765.910) * (-769.264) (-767.282) [-767.329] (-765.592) -- 0:00:56
151000 -- (-767.506) (-767.873) [-768.313] (-767.941) * (-769.446) (-765.739) [-768.647] (-765.806) -- 0:00:56
151500 -- [-766.251] (-764.766) (-766.811) (-766.382) * (-766.792) (-764.655) (-769.747) [-765.876] -- 0:00:56
152000 -- [-765.142] (-766.694) (-767.006) (-767.316) * (-765.873) [-766.196] (-767.490) (-765.500) -- 0:00:55
152500 -- (-767.121) (-766.823) (-765.499) [-770.220] * (-769.438) (-766.624) (-767.318) [-765.965] -- 0:00:55
153000 -- (-769.166) [-769.566] (-767.638) (-766.714) * (-766.759) (-767.568) [-766.261] (-765.684) -- 0:00:55
153500 -- (-768.662) (-764.643) (-765.774) [-767.657] * (-765.496) (-768.776) (-765.120) [-765.753] -- 0:00:55
154000 -- (-766.297) (-766.045) [-766.634] (-771.460) * (-765.491) (-772.288) [-767.293] (-767.037) -- 0:00:54
154500 -- (-767.897) (-764.973) [-765.400] (-766.920) * (-768.067) (-768.540) [-771.184] (-768.447) -- 0:00:54
155000 -- [-766.506] (-766.643) (-766.995) (-765.870) * (-766.978) (-771.118) (-772.171) [-768.131] -- 0:00:54
Average standard deviation of split frequencies: 0.020145
155500 -- (-770.673) (-765.451) [-768.546] (-765.840) * (-768.231) [-765.760] (-769.615) (-773.212) -- 0:00:54
156000 -- (-767.785) (-765.722) [-765.503] (-765.384) * (-767.427) (-765.453) [-766.413] (-768.314) -- 0:00:54
156500 -- (-765.785) (-766.253) [-765.416] (-770.126) * [-770.236] (-765.561) (-766.913) (-769.260) -- 0:00:53
157000 -- (-765.354) (-768.236) (-766.936) [-765.851] * (-765.882) [-767.957] (-769.218) (-768.378) -- 0:00:53
157500 -- (-767.203) (-767.566) (-766.244) [-765.748] * (-765.150) (-766.417) (-766.403) [-770.123] -- 0:00:53
158000 -- (-765.817) (-767.725) (-766.309) [-767.618] * (-765.763) (-769.126) [-765.288] (-767.923) -- 0:00:53
158500 -- [-767.393] (-766.465) (-768.991) (-768.235) * (-768.805) [-767.267] (-765.134) (-766.731) -- 0:00:53
159000 -- [-765.642] (-766.948) (-768.197) (-769.747) * (-765.646) [-767.972] (-765.258) (-768.548) -- 0:00:52
159500 -- (-766.864) (-765.662) (-766.798) [-769.106] * (-770.901) (-766.706) [-767.287] (-766.683) -- 0:00:52
160000 -- (-766.988) (-769.507) [-769.064] (-774.490) * (-766.615) [-769.914] (-768.098) (-766.604) -- 0:00:52
Average standard deviation of split frequencies: 0.020375
160500 -- (-768.842) [-772.535] (-766.375) (-767.510) * (-765.769) (-766.940) (-767.946) [-767.048] -- 0:00:52
161000 -- (-768.251) (-767.980) [-768.958] (-767.941) * (-766.960) (-770.783) (-766.793) [-767.043] -- 0:00:52
161500 -- (-767.200) (-766.409) [-766.265] (-767.115) * [-769.793] (-765.952) (-770.427) (-769.585) -- 0:00:51
162000 -- (-770.350) [-768.928] (-765.316) (-767.624) * (-768.839) [-766.838] (-768.100) (-768.526) -- 0:00:51
162500 -- (-767.739) (-766.831) (-765.718) [-766.720] * [-766.244] (-772.015) (-766.727) (-773.314) -- 0:00:51
163000 -- (-768.032) (-765.250) [-769.578] (-765.247) * (-766.408) (-767.966) (-766.434) [-767.020] -- 0:00:51
163500 -- (-769.563) (-766.245) (-766.627) [-768.679] * (-769.420) (-766.247) (-765.198) [-765.790] -- 0:00:51
164000 -- (-765.920) (-768.912) (-768.861) [-770.453] * (-766.526) (-768.461) (-766.730) [-765.541] -- 0:00:56
164500 -- [-768.445] (-768.659) (-765.870) (-767.643) * (-765.652) (-766.873) (-764.797) [-768.651] -- 0:00:55
165000 -- [-769.496] (-770.737) (-769.874) (-768.682) * (-765.450) (-767.615) [-765.838] (-768.761) -- 0:00:55
Average standard deviation of split frequencies: 0.018743
165500 -- (-766.842) (-765.396) (-770.190) [-767.558] * (-765.251) (-765.311) (-765.555) [-767.679] -- 0:00:55
166000 -- (-766.222) [-767.988] (-767.863) (-767.032) * (-765.296) (-766.892) (-768.340) [-765.469] -- 0:00:55
166500 -- (-766.174) (-768.259) (-768.897) [-765.503] * (-767.204) (-767.149) (-768.311) [-766.383] -- 0:00:55
167000 -- (-766.768) [-768.040] (-773.205) (-770.442) * (-766.197) [-766.569] (-766.664) (-766.766) -- 0:00:54
167500 -- (-765.503) (-770.036) [-769.069] (-766.080) * [-767.008] (-766.179) (-764.725) (-767.969) -- 0:00:54
168000 -- (-765.911) (-769.961) (-765.387) [-767.492] * (-766.394) (-765.072) [-764.749] (-767.052) -- 0:00:54
168500 -- (-766.733) [-767.797] (-770.328) (-767.284) * (-767.925) (-771.428) [-765.158] (-765.760) -- 0:00:54
169000 -- (-766.959) (-765.948) (-766.049) [-765.339] * (-766.179) (-770.966) [-765.515] (-764.804) -- 0:00:54
169500 -- (-769.736) (-767.210) (-766.606) [-768.731] * [-768.055] (-765.296) (-766.463) (-769.345) -- 0:00:53
170000 -- (-769.562) (-765.618) (-766.057) [-769.093] * (-767.218) [-771.032] (-765.480) (-775.998) -- 0:00:53
Average standard deviation of split frequencies: 0.016704
170500 -- (-767.229) [-767.112] (-773.606) (-767.893) * (-768.313) (-771.439) (-766.544) [-768.195] -- 0:00:53
171000 -- (-768.001) (-769.237) (-770.366) [-768.859] * [-767.938] (-768.232) (-765.118) (-767.075) -- 0:00:53
171500 -- (-766.156) (-770.234) (-768.850) [-765.211] * (-766.314) [-765.366] (-767.547) (-765.665) -- 0:00:53
172000 -- (-766.875) (-767.898) (-769.729) [-764.794] * (-765.922) (-768.403) (-771.561) [-767.159] -- 0:00:52
172500 -- (-768.923) [-766.862] (-768.025) (-765.726) * (-765.966) (-767.994) [-767.032] (-767.784) -- 0:00:52
173000 -- (-766.197) (-767.261) (-766.970) [-767.878] * (-767.664) (-765.521) (-765.284) [-768.893] -- 0:00:52
173500 -- [-768.346] (-766.676) (-767.166) (-768.266) * [-766.663] (-769.201) (-767.859) (-769.166) -- 0:00:52
174000 -- (-767.065) (-767.394) [-766.656] (-768.243) * [-770.472] (-770.632) (-767.354) (-765.465) -- 0:00:52
174500 -- [-764.745] (-766.814) (-767.786) (-767.847) * (-767.422) (-766.264) (-765.283) [-769.558] -- 0:00:52
175000 -- [-766.814] (-765.062) (-767.215) (-766.303) * (-767.174) (-766.789) [-767.520] (-769.288) -- 0:00:51
Average standard deviation of split frequencies: 0.015930
175500 -- (-768.604) (-766.306) (-765.414) [-768.577] * [-764.936] (-766.424) (-768.998) (-768.012) -- 0:00:51
176000 -- (-770.507) (-767.844) [-766.124] (-766.245) * [-764.946] (-769.754) (-766.029) (-768.842) -- 0:00:51
176500 -- (-769.347) (-768.725) (-766.636) [-766.830] * [-765.617] (-770.793) (-766.096) (-768.860) -- 0:00:51
177000 -- [-767.376] (-767.344) (-765.332) (-765.023) * [-767.808] (-767.759) (-767.616) (-768.724) -- 0:00:51
177500 -- (-766.323) (-769.730) (-766.548) [-765.373] * (-765.450) (-771.051) (-765.154) [-769.714] -- 0:00:50
178000 -- (-765.537) [-771.597] (-764.700) (-770.611) * [-765.543] (-768.768) (-765.810) (-767.709) -- 0:00:50
178500 -- [-766.629] (-770.085) (-766.262) (-769.026) * [-768.091] (-767.666) (-768.014) (-766.191) -- 0:00:55
179000 -- (-766.752) (-771.722) (-765.487) [-769.112] * (-766.323) (-767.986) [-766.601] (-767.475) -- 0:00:55
179500 -- (-766.088) [-766.413] (-765.543) (-772.142) * (-768.580) (-768.417) (-766.651) [-766.228] -- 0:00:54
180000 -- (-765.383) [-766.178] (-765.319) (-767.818) * (-765.961) (-766.338) (-765.948) [-764.934] -- 0:00:54
Average standard deviation of split frequencies: 0.015518
180500 -- (-766.430) [-766.208] (-768.982) (-768.147) * (-767.198) (-767.900) (-767.999) [-766.835] -- 0:00:54
181000 -- [-766.414] (-765.401) (-767.470) (-768.972) * (-769.357) (-769.360) (-768.539) [-767.302] -- 0:00:54
181500 -- (-778.700) (-764.829) (-765.292) [-771.279] * (-766.122) (-769.391) (-768.673) [-767.840] -- 0:00:54
182000 -- [-767.397] (-774.153) (-765.811) (-769.287) * (-764.705) (-765.068) (-767.951) [-770.514] -- 0:00:53
182500 -- [-766.188] (-765.739) (-769.200) (-767.330) * (-766.108) (-769.404) (-765.577) [-767.856] -- 0:00:53
183000 -- [-772.075] (-769.226) (-766.383) (-766.164) * (-766.925) (-766.323) (-771.532) [-765.813] -- 0:00:53
183500 -- (-767.571) [-766.333] (-765.613) (-769.443) * [-768.388] (-766.769) (-767.274) (-766.312) -- 0:00:53
184000 -- (-765.875) (-765.568) [-766.007] (-766.091) * (-768.388) (-767.681) (-767.658) [-768.245] -- 0:00:53
184500 -- (-765.859) (-771.582) [-766.701] (-766.922) * (-765.497) (-768.665) [-766.484] (-773.866) -- 0:00:53
185000 -- [-765.312] (-769.295) (-768.039) (-767.827) * (-764.694) (-767.682) [-765.883] (-766.132) -- 0:00:52
Average standard deviation of split frequencies: 0.017017
185500 -- [-764.984] (-770.653) (-768.029) (-769.211) * [-765.374] (-767.174) (-765.552) (-767.923) -- 0:00:52
186000 -- [-770.294] (-768.407) (-765.945) (-770.975) * [-765.052] (-767.081) (-765.285) (-767.036) -- 0:00:52
186500 -- [-771.058] (-770.365) (-765.039) (-765.094) * [-766.396] (-769.180) (-766.920) (-765.816) -- 0:00:52
187000 -- (-769.027) (-764.971) [-767.042] (-767.060) * (-765.509) (-769.439) (-768.060) [-766.111] -- 0:00:52
187500 -- [-768.118] (-764.995) (-765.279) (-766.141) * (-766.475) (-766.660) [-767.708] (-768.634) -- 0:00:52
188000 -- (-765.472) (-764.743) [-768.435] (-770.717) * (-772.379) (-765.347) (-767.957) [-765.514] -- 0:00:51
188500 -- (-765.359) (-766.774) [-765.632] (-769.894) * [-767.286] (-766.076) (-766.029) (-764.831) -- 0:00:51
189000 -- [-766.695] (-765.276) (-767.382) (-765.864) * (-769.851) (-764.898) [-766.600] (-767.609) -- 0:00:51
189500 -- (-765.571) [-766.268] (-767.864) (-766.628) * (-769.493) (-766.177) [-766.725] (-765.318) -- 0:00:51
190000 -- (-766.637) [-767.338] (-768.588) (-766.350) * (-764.662) (-767.517) [-768.425] (-764.937) -- 0:00:51
Average standard deviation of split frequencies: 0.018131
190500 -- (-766.307) [-769.362] (-768.778) (-768.629) * (-769.033) (-765.824) (-766.409) [-764.731] -- 0:00:50
191000 -- (-766.336) (-769.991) [-766.336] (-766.071) * [-767.650] (-771.317) (-766.838) (-766.565) -- 0:00:50
191500 -- (-768.057) (-767.973) [-766.080] (-766.693) * (-766.873) [-766.557] (-767.062) (-765.650) -- 0:00:50
192000 -- [-768.765] (-767.534) (-766.308) (-765.900) * [-766.229] (-764.756) (-768.244) (-768.515) -- 0:00:50
192500 -- [-766.997] (-766.521) (-768.590) (-765.069) * [-765.566] (-767.972) (-765.799) (-768.888) -- 0:00:50
193000 -- [-765.897] (-768.887) (-768.823) (-770.767) * (-766.151) (-766.564) [-766.015] (-767.493) -- 0:00:54
193500 -- [-766.479] (-767.356) (-771.187) (-769.075) * (-766.468) (-768.236) (-766.765) [-765.622] -- 0:00:54
194000 -- [-769.174] (-768.539) (-766.049) (-766.700) * (-765.207) (-766.622) [-766.920] (-765.779) -- 0:00:54
194500 -- (-767.604) (-766.356) (-768.494) [-767.952] * [-765.374] (-765.608) (-770.427) (-764.963) -- 0:00:53
195000 -- (-770.176) [-766.326] (-765.645) (-764.890) * (-765.373) (-768.624) (-770.188) [-765.050] -- 0:00:53
Average standard deviation of split frequencies: 0.017055
195500 -- (-769.195) (-766.622) (-767.340) [-765.181] * (-766.338) (-767.639) [-765.456] (-765.797) -- 0:00:53
196000 -- (-766.052) (-766.746) (-765.909) [-768.410] * [-768.941] (-772.826) (-765.354) (-768.714) -- 0:00:53
196500 -- (-768.112) [-765.790] (-765.742) (-767.058) * (-769.198) (-769.657) (-767.843) [-764.485] -- 0:00:53
197000 -- (-770.992) (-765.562) (-766.638) [-765.695] * (-769.704) (-771.460) [-765.672] (-767.544) -- 0:00:52
197500 -- (-768.030) (-765.947) (-766.954) [-766.841] * (-767.987) [-765.778] (-766.763) (-766.710) -- 0:00:52
198000 -- (-766.444) [-769.392] (-766.707) (-766.325) * [-768.177] (-770.346) (-767.752) (-765.376) -- 0:00:52
198500 -- [-766.790] (-767.112) (-766.743) (-766.453) * (-769.364) (-769.144) (-768.454) [-766.833] -- 0:00:52
199000 -- (-766.600) [-766.443] (-766.280) (-767.429) * [-765.525] (-769.167) (-770.198) (-766.630) -- 0:00:52
199500 -- (-767.825) [-769.742] (-767.471) (-766.067) * (-770.338) (-767.053) [-766.459] (-768.642) -- 0:00:52
200000 -- (-765.735) (-765.192) (-765.872) [-764.749] * (-771.879) (-767.114) [-767.045] (-767.425) -- 0:00:51
Average standard deviation of split frequencies: 0.017063
200500 -- (-764.878) (-769.030) (-768.280) [-765.148] * (-769.558) (-769.175) (-767.698) [-765.770] -- 0:00:51
201000 -- (-766.906) (-766.817) [-765.700] (-769.900) * (-767.693) (-765.985) [-766.515] (-771.081) -- 0:00:51
201500 -- [-767.028] (-771.845) (-766.720) (-767.188) * (-768.262) (-768.038) [-765.355] (-765.945) -- 0:00:51
202000 -- (-766.000) (-769.122) [-768.536] (-766.120) * (-766.352) (-771.086) [-768.293] (-767.209) -- 0:00:51
202500 -- (-767.168) (-766.435) [-767.737] (-766.969) * (-765.977) (-766.698) (-766.672) [-766.313] -- 0:00:51
203000 -- (-767.934) (-768.350) (-765.265) [-766.462] * [-769.323] (-767.373) (-765.653) (-766.583) -- 0:00:51
203500 -- (-768.879) (-766.274) [-764.597] (-766.193) * [-766.170] (-767.420) (-764.553) (-778.279) -- 0:00:50
204000 -- (-765.723) [-765.637] (-770.079) (-765.667) * [-766.269] (-769.101) (-765.904) (-772.573) -- 0:00:50
204500 -- (-765.743) (-765.743) [-767.159] (-772.075) * (-766.869) (-768.807) (-765.949) [-769.614] -- 0:00:50
205000 -- (-765.704) (-767.548) [-767.659] (-773.501) * (-765.146) (-768.155) [-767.527] (-767.642) -- 0:00:50
Average standard deviation of split frequencies: 0.016563
205500 -- [-766.089] (-767.819) (-766.472) (-774.237) * (-767.034) (-769.061) [-768.672] (-769.372) -- 0:00:50
206000 -- [-766.291] (-766.602) (-769.774) (-774.081) * (-766.766) [-765.085] (-766.157) (-767.687) -- 0:00:50
206500 -- [-766.533] (-765.072) (-766.915) (-767.903) * (-767.264) [-766.323] (-767.134) (-768.537) -- 0:00:49
207000 -- (-765.005) [-764.507] (-767.945) (-766.242) * (-766.068) [-765.611] (-766.482) (-773.039) -- 0:00:49
207500 -- (-765.693) [-766.856] (-767.544) (-768.058) * (-768.557) (-775.267) [-768.873] (-766.368) -- 0:00:53
208000 -- (-764.942) (-765.249) [-767.455] (-766.446) * [-767.171] (-773.114) (-767.633) (-766.865) -- 0:00:53
208500 -- [-767.495] (-765.274) (-765.263) (-767.607) * (-769.882) [-767.676] (-766.742) (-766.536) -- 0:00:53
209000 -- (-767.458) (-766.606) (-764.912) [-767.830] * (-769.994) (-766.551) [-767.575] (-766.309) -- 0:00:52
209500 -- (-766.269) (-765.731) (-766.226) [-767.966] * (-770.109) (-766.340) (-767.501) [-765.670] -- 0:00:52
210000 -- [-767.140] (-766.530) (-765.667) (-767.148) * (-765.704) (-766.690) (-766.326) [-769.664] -- 0:00:52
Average standard deviation of split frequencies: 0.015776
210500 -- (-766.375) [-767.902] (-768.602) (-767.562) * (-766.559) (-768.366) (-768.907) [-766.110] -- 0:00:52
211000 -- (-765.870) [-767.239] (-767.089) (-770.016) * (-769.245) [-765.867] (-766.916) (-767.445) -- 0:00:52
211500 -- [-765.948] (-767.919) (-768.058) (-767.800) * (-770.761) (-766.144) [-767.367] (-769.853) -- 0:00:52
212000 -- (-766.942) (-769.351) [-767.730] (-765.861) * (-771.342) (-766.198) [-769.194] (-769.688) -- 0:00:52
212500 -- (-767.661) (-771.594) (-765.207) [-770.946] * (-771.224) (-767.186) (-769.960) [-766.157] -- 0:00:51
213000 -- (-768.503) [-769.283] (-770.446) (-768.127) * (-767.056) (-767.739) (-768.669) [-765.061] -- 0:00:51
213500 -- [-767.760] (-771.417) (-764.869) (-768.584) * (-771.937) (-770.893) [-766.672] (-765.871) -- 0:00:51
214000 -- (-766.184) (-768.549) (-766.509) [-764.814] * (-765.511) (-766.992) [-769.096] (-764.907) -- 0:00:51
214500 -- [-767.051] (-767.719) (-766.362) (-766.538) * [-766.417] (-765.997) (-765.578) (-766.757) -- 0:00:51
215000 -- (-765.726) (-768.497) (-766.772) [-765.252] * [-765.748] (-768.800) (-768.810) (-766.583) -- 0:00:51
Average standard deviation of split frequencies: 0.016041
215500 -- [-766.120] (-765.682) (-766.153) (-765.161) * (-765.500) (-768.830) [-766.363] (-767.073) -- 0:00:50
216000 -- (-768.425) [-766.024] (-766.335) (-766.956) * (-766.046) (-766.857) (-765.943) [-766.273] -- 0:00:50
216500 -- (-768.212) (-766.396) (-765.320) [-767.041] * (-765.929) [-766.281] (-764.935) (-765.237) -- 0:00:50
217000 -- (-766.009) [-766.398] (-767.352) (-765.144) * (-769.544) (-766.158) [-765.304] (-765.992) -- 0:00:50
217500 -- (-767.512) (-765.846) [-768.972] (-766.168) * (-766.566) [-766.226] (-766.952) (-767.616) -- 0:00:50
218000 -- (-768.309) [-765.227] (-768.590) (-767.955) * (-766.891) (-765.011) (-766.188) [-766.616] -- 0:00:50
218500 -- (-772.587) [-765.209] (-766.705) (-770.467) * (-768.451) (-765.507) [-765.621] (-765.568) -- 0:00:50
219000 -- (-769.810) (-767.742) (-766.820) [-767.461] * (-767.511) [-766.550] (-765.926) (-767.923) -- 0:00:49
219500 -- (-772.214) (-768.556) [-767.617] (-768.233) * (-766.681) (-767.824) [-765.111] (-769.732) -- 0:00:49
220000 -- (-766.182) (-766.884) (-768.921) [-768.240] * [-766.179] (-765.481) (-766.616) (-777.282) -- 0:00:49
Average standard deviation of split frequencies: 0.016449
220500 -- (-764.909) [-767.020] (-766.520) (-766.745) * [-766.550] (-765.158) (-766.925) (-770.120) -- 0:00:49
221000 -- [-765.599] (-767.970) (-765.723) (-768.805) * (-771.349) (-767.299) [-766.569] (-765.385) -- 0:00:49
221500 -- [-765.467] (-769.144) (-765.206) (-768.201) * (-765.322) (-765.245) (-767.565) [-767.010] -- 0:00:49
222000 -- (-767.201) (-770.628) (-766.595) [-766.108] * (-767.976) (-765.303) [-769.232] (-766.905) -- 0:00:49
222500 -- [-765.823] (-768.886) (-766.020) (-765.785) * (-765.867) (-766.341) (-764.828) [-767.932] -- 0:00:52
223000 -- (-766.354) [-771.964] (-769.492) (-767.054) * (-766.740) (-767.312) [-766.137] (-768.915) -- 0:00:52
223500 -- [-764.987] (-768.297) (-770.055) (-765.056) * (-767.961) (-765.066) [-766.618] (-767.268) -- 0:00:52
224000 -- (-766.679) (-768.866) [-766.036] (-764.917) * (-765.923) (-765.285) (-770.588) [-768.571] -- 0:00:51
224500 -- (-768.122) [-766.535] (-770.050) (-765.862) * (-767.224) [-765.526] (-770.907) (-771.610) -- 0:00:51
225000 -- (-765.091) [-766.162] (-771.316) (-765.905) * [-767.302] (-767.697) (-769.372) (-771.868) -- 0:00:51
Average standard deviation of split frequencies: 0.016091
225500 -- (-765.306) (-766.082) [-768.663] (-765.313) * [-765.962] (-767.239) (-766.132) (-767.025) -- 0:00:51
226000 -- (-767.399) (-770.602) (-765.434) [-765.880] * [-766.429] (-767.390) (-765.517) (-770.289) -- 0:00:51
226500 -- (-768.398) (-771.131) (-765.987) [-766.768] * (-766.571) [-766.944] (-770.366) (-768.869) -- 0:00:51
227000 -- (-769.136) [-766.818] (-764.936) (-767.357) * (-766.159) (-767.366) (-769.981) [-766.687] -- 0:00:51
227500 -- (-767.493) (-767.258) (-766.348) [-769.426] * (-765.060) (-765.454) [-769.717] (-769.614) -- 0:00:50
228000 -- (-765.797) (-765.246) [-765.420] (-765.515) * (-765.823) (-766.282) [-765.463] (-771.096) -- 0:00:50
228500 -- (-767.399) (-767.302) (-766.271) [-765.581] * (-767.835) (-765.559) [-767.520] (-769.777) -- 0:00:50
229000 -- (-766.229) (-765.356) [-764.844] (-765.923) * (-767.321) (-767.123) (-771.219) [-767.824] -- 0:00:50
229500 -- (-769.589) [-765.361] (-766.841) (-766.081) * [-765.433] (-767.733) (-768.223) (-765.001) -- 0:00:50
230000 -- [-767.218] (-765.772) (-768.189) (-766.087) * [-765.302] (-768.086) (-767.615) (-766.743) -- 0:00:50
Average standard deviation of split frequencies: 0.015596
230500 -- (-772.250) (-765.659) [-765.812] (-769.253) * [-765.393] (-773.285) (-766.544) (-766.212) -- 0:00:50
231000 -- (-771.505) (-768.604) [-766.381] (-766.629) * (-767.094) (-767.253) (-771.073) [-765.286] -- 0:00:49
231500 -- (-769.774) [-768.337] (-767.898) (-769.508) * (-767.513) (-767.305) (-767.640) [-766.243] -- 0:00:49
232000 -- [-771.831] (-766.282) (-765.588) (-770.368) * (-770.138) [-766.817] (-769.629) (-765.287) -- 0:00:49
232500 -- (-767.209) (-765.790) (-768.754) [-765.392] * (-765.938) (-766.718) (-768.118) [-764.898] -- 0:00:49
233000 -- [-768.440] (-764.921) (-766.037) (-765.549) * (-767.672) (-766.231) [-768.301] (-766.176) -- 0:00:49
233500 -- (-772.174) (-767.201) [-766.105] (-767.372) * (-765.970) (-766.525) [-765.970] (-769.068) -- 0:00:49
234000 -- (-766.487) (-766.033) [-765.722] (-766.078) * (-768.040) [-767.223] (-771.811) (-770.561) -- 0:00:49
234500 -- (-769.328) (-766.612) (-766.113) [-767.845] * [-766.916] (-766.666) (-772.132) (-766.630) -- 0:00:48
235000 -- (-768.197) (-767.508) (-769.618) [-768.561] * (-766.237) (-767.580) [-764.997] (-766.573) -- 0:00:48
Average standard deviation of split frequencies: 0.016926
235500 -- (-768.258) (-765.367) [-767.788] (-766.800) * (-766.287) (-766.947) (-767.487) [-767.896] -- 0:00:48
236000 -- (-767.154) (-766.959) [-766.127] (-769.683) * (-768.063) [-765.669] (-770.058) (-766.496) -- 0:00:48
236500 -- (-770.561) (-765.233) [-765.211] (-766.635) * (-765.819) (-766.877) [-766.250] (-769.834) -- 0:00:48
237000 -- (-767.420) (-767.574) (-767.572) [-764.932] * (-770.242) [-765.395] (-768.792) (-768.745) -- 0:00:48
237500 -- (-769.416) [-766.461] (-767.973) (-765.323) * (-773.448) (-770.101) (-769.677) [-768.837] -- 0:00:48
238000 -- (-767.288) (-766.838) [-765.859] (-767.661) * (-765.244) [-766.367] (-767.702) (-765.918) -- 0:00:51
238500 -- (-765.318) [-768.192] (-766.273) (-765.957) * [-766.661] (-766.481) (-766.420) (-765.036) -- 0:00:51
239000 -- [-766.043] (-766.820) (-767.923) (-768.235) * [-764.927] (-766.897) (-768.932) (-766.305) -- 0:00:50
239500 -- (-765.975) (-767.694) [-765.656] (-768.328) * [-765.535] (-770.665) (-773.316) (-765.320) -- 0:00:50
240000 -- (-767.893) [-768.655] (-765.189) (-765.950) * [-765.608] (-766.331) (-766.776) (-765.211) -- 0:00:50
Average standard deviation of split frequencies: 0.017010
240500 -- [-765.807] (-766.286) (-767.925) (-767.354) * [-764.664] (-767.645) (-767.414) (-767.987) -- 0:00:50
241000 -- (-766.584) (-765.870) (-764.726) [-764.944] * (-766.460) [-764.952] (-765.879) (-770.874) -- 0:00:50
241500 -- (-769.874) (-765.205) (-768.881) [-765.622] * [-766.517] (-765.908) (-765.743) (-770.398) -- 0:00:50
242000 -- (-774.103) (-765.529) [-766.520] (-767.471) * [-766.031] (-769.046) (-767.846) (-765.872) -- 0:00:50
242500 -- (-766.980) [-764.828] (-770.794) (-768.231) * [-767.610] (-769.381) (-768.171) (-769.355) -- 0:00:49
243000 -- (-766.038) [-765.562] (-766.969) (-769.726) * (-767.211) [-765.915] (-766.825) (-771.117) -- 0:00:49
243500 -- [-766.183] (-765.410) (-769.009) (-768.922) * (-768.073) (-766.035) (-766.863) [-766.735] -- 0:00:49
244000 -- [-768.387] (-765.391) (-765.254) (-765.622) * (-767.713) (-766.227) (-767.442) [-766.962] -- 0:00:49
244500 -- (-766.128) [-767.950] (-766.140) (-765.481) * (-767.270) (-765.715) (-768.962) [-767.848] -- 0:00:49
245000 -- (-769.738) (-767.045) [-766.567] (-766.907) * (-772.370) (-765.843) (-767.088) [-765.740] -- 0:00:49
Average standard deviation of split frequencies: 0.015330
245500 -- (-765.505) [-766.728] (-766.433) (-768.048) * (-771.594) (-765.345) (-766.609) [-767.895] -- 0:00:49
246000 -- [-766.809] (-764.858) (-766.265) (-766.858) * (-767.267) [-766.224] (-766.662) (-768.634) -- 0:00:49
246500 -- [-768.531] (-767.301) (-766.156) (-766.194) * (-766.158) (-766.300) [-765.483] (-765.898) -- 0:00:48
247000 -- (-766.593) (-766.071) (-768.088) [-764.889] * (-767.415) [-765.123] (-770.122) (-769.439) -- 0:00:48
247500 -- (-766.373) [-768.799] (-768.193) (-764.767) * [-765.305] (-769.647) (-771.456) (-767.414) -- 0:00:48
248000 -- (-766.085) (-768.836) (-767.626) [-764.649] * [-766.147] (-768.510) (-768.457) (-766.727) -- 0:00:48
248500 -- [-768.411] (-766.151) (-765.403) (-768.003) * (-766.209) (-766.672) [-765.722] (-767.771) -- 0:00:48
249000 -- (-767.355) (-764.926) [-766.523] (-771.480) * (-769.352) (-771.924) [-766.249] (-767.968) -- 0:00:48
249500 -- [-766.409] (-766.105) (-766.364) (-767.385) * (-767.720) (-767.843) [-767.136] (-767.114) -- 0:00:48
250000 -- (-766.550) (-767.528) (-766.738) [-765.992] * [-765.349] (-766.836) (-767.741) (-765.569) -- 0:00:48
Average standard deviation of split frequencies: 0.015243
250500 -- [-766.444] (-764.817) (-767.450) (-764.799) * (-765.615) [-768.132] (-767.578) (-767.189) -- 0:00:47
251000 -- [-766.706] (-764.954) (-769.848) (-768.965) * (-766.253) (-767.343) [-768.061] (-769.018) -- 0:00:47
251500 -- (-767.442) (-765.409) (-765.285) [-770.401] * [-771.518] (-771.099) (-769.901) (-765.751) -- 0:00:50
252000 -- [-769.169] (-766.642) (-769.104) (-765.658) * (-766.984) (-767.895) [-767.316] (-767.119) -- 0:00:50
252500 -- [-769.016] (-771.396) (-765.375) (-769.477) * (-767.984) (-768.129) [-766.190] (-767.315) -- 0:00:50
253000 -- (-766.135) (-770.028) [-765.391] (-765.857) * [-769.276] (-769.184) (-765.803) (-768.942) -- 0:00:50
253500 -- (-768.158) (-765.743) (-765.982) [-766.263] * [-768.276] (-768.236) (-765.886) (-767.190) -- 0:00:50
254000 -- (-766.336) (-766.657) [-765.797] (-766.265) * [-769.490] (-767.793) (-765.115) (-765.216) -- 0:00:49
254500 -- (-766.288) (-766.307) (-769.333) [-764.890] * (-769.189) [-767.300] (-765.482) (-771.905) -- 0:00:49
255000 -- (-765.207) (-767.809) (-765.661) [-766.362] * (-766.103) (-765.994) [-765.298] (-771.022) -- 0:00:49
Average standard deviation of split frequencies: 0.014406
255500 -- (-765.153) (-765.305) [-764.996] (-768.063) * (-766.169) [-766.212] (-765.018) (-765.651) -- 0:00:49
256000 -- (-765.142) (-765.815) [-765.468] (-769.368) * [-769.161] (-769.979) (-765.042) (-766.045) -- 0:00:49
256500 -- (-768.758) [-765.286] (-767.187) (-766.903) * (-769.669) (-766.453) [-766.120] (-765.897) -- 0:00:49
257000 -- [-766.413] (-768.370) (-766.661) (-767.966) * (-768.505) [-767.841] (-765.071) (-765.109) -- 0:00:49
257500 -- (-769.022) (-769.050) (-767.803) [-766.785] * (-768.814) (-768.256) [-766.057] (-765.733) -- 0:00:49
258000 -- (-772.954) (-765.634) [-766.128] (-766.913) * (-765.517) (-768.474) [-765.577] (-765.533) -- 0:00:48
258500 -- (-765.645) [-765.863] (-766.205) (-765.735) * (-765.907) (-765.518) (-771.692) [-764.943] -- 0:00:48
259000 -- (-772.842) (-767.088) (-767.069) [-765.377] * [-765.558] (-765.755) (-765.630) (-764.950) -- 0:00:48
259500 -- (-768.642) [-769.715] (-765.937) (-766.092) * (-765.929) (-767.427) (-770.338) [-765.785] -- 0:00:48
260000 -- [-764.864] (-766.527) (-769.142) (-766.737) * (-767.827) (-766.231) (-765.241) [-765.550] -- 0:00:48
Average standard deviation of split frequencies: 0.015146
260500 -- [-765.900] (-767.275) (-767.169) (-768.838) * [-765.445] (-767.988) (-766.022) (-765.256) -- 0:00:48
261000 -- [-766.006] (-766.079) (-768.100) (-771.394) * (-765.474) (-765.697) (-767.620) [-765.504] -- 0:00:48
261500 -- [-764.850] (-766.957) (-769.398) (-773.085) * (-766.660) (-770.015) [-767.572] (-766.108) -- 0:00:48
262000 -- [-766.293] (-766.603) (-770.452) (-770.910) * (-767.127) (-767.137) (-768.543) [-766.541] -- 0:00:47
262500 -- (-766.835) [-765.074] (-765.835) (-767.604) * [-766.816] (-765.441) (-767.402) (-767.659) -- 0:00:47
263000 -- (-767.120) (-765.598) [-769.977] (-767.835) * (-769.568) [-766.499] (-764.748) (-767.803) -- 0:00:47
263500 -- (-767.350) (-768.413) (-767.552) [-766.540] * (-765.141) [-765.943] (-767.657) (-768.702) -- 0:00:47
264000 -- (-764.946) [-767.401] (-772.088) (-767.257) * (-767.931) (-765.587) [-768.739] (-768.156) -- 0:00:47
264500 -- (-764.750) [-765.840] (-770.778) (-765.577) * (-770.470) (-765.900) [-766.000] (-766.177) -- 0:00:50
265000 -- (-765.861) (-768.677) (-777.642) [-766.090] * (-769.444) [-766.624] (-766.028) (-766.543) -- 0:00:49
Average standard deviation of split frequencies: 0.014073
265500 -- (-765.580) [-765.457] (-765.926) (-767.774) * [-765.352] (-766.207) (-768.979) (-764.716) -- 0:00:49
266000 -- (-767.886) (-769.245) [-765.585] (-771.564) * (-765.030) (-766.067) (-768.524) [-766.627] -- 0:00:49
266500 -- (-766.320) [-766.035] (-767.108) (-767.499) * (-767.084) (-766.626) [-765.728] (-768.196) -- 0:00:49
267000 -- (-766.476) (-766.928) (-767.587) [-765.778] * (-766.960) (-766.141) [-767.387] (-766.080) -- 0:00:49
267500 -- (-770.375) [-771.615] (-765.009) (-767.089) * [-766.656] (-765.436) (-769.078) (-768.820) -- 0:00:49
268000 -- (-766.686) [-768.798] (-767.009) (-767.338) * (-767.544) [-764.835] (-767.954) (-766.964) -- 0:00:49
268500 -- (-767.376) (-764.932) (-765.865) [-765.940] * [-767.740] (-772.268) (-764.696) (-769.335) -- 0:00:49
269000 -- (-767.967) (-767.666) (-767.573) [-767.840] * (-767.712) (-769.586) (-764.607) [-768.529] -- 0:00:48
269500 -- [-768.553] (-765.277) (-765.509) (-766.814) * [-765.653] (-766.030) (-765.321) (-765.514) -- 0:00:48
270000 -- [-766.236] (-766.343) (-766.631) (-769.496) * (-765.287) (-766.292) (-765.329) [-765.654] -- 0:00:48
Average standard deviation of split frequencies: 0.012482
270500 -- (-767.654) (-766.196) (-767.068) [-768.509] * [-768.666] (-766.353) (-765.382) (-766.811) -- 0:00:48
271000 -- (-767.054) (-767.801) [-767.036] (-766.510) * (-770.052) (-767.323) (-772.299) [-770.009] -- 0:00:48
271500 -- (-766.342) [-770.620] (-770.772) (-765.121) * (-768.473) [-768.739] (-773.366) (-766.432) -- 0:00:48
272000 -- [-766.165] (-768.068) (-768.537) (-765.497) * (-773.892) (-768.081) [-775.513] (-766.767) -- 0:00:48
272500 -- [-767.666] (-766.879) (-765.624) (-766.004) * (-769.939) (-766.920) [-768.316] (-768.118) -- 0:00:48
273000 -- [-767.493] (-767.725) (-765.954) (-767.273) * (-765.435) (-766.783) [-767.127] (-766.604) -- 0:00:47
273500 -- (-767.344) (-765.207) (-765.836) [-765.898] * [-766.267] (-766.740) (-766.026) (-765.269) -- 0:00:47
274000 -- (-765.554) [-765.433] (-767.238) (-774.217) * (-766.708) [-765.525] (-765.059) (-765.663) -- 0:00:47
274500 -- (-766.289) (-768.603) [-766.171] (-768.337) * (-765.616) (-765.593) [-768.666] (-767.729) -- 0:00:47
275000 -- [-766.617] (-765.359) (-765.186) (-766.809) * [-773.190] (-766.168) (-767.014) (-768.063) -- 0:00:47
Average standard deviation of split frequencies: 0.012051
275500 -- (-768.138) (-766.876) (-764.948) [-768.420] * [-765.689] (-768.370) (-767.322) (-765.022) -- 0:00:47
276000 -- [-765.566] (-765.845) (-768.474) (-766.662) * (-765.406) [-766.337] (-765.940) (-767.181) -- 0:00:47
276500 -- (-768.483) (-766.737) (-770.215) [-767.148] * (-766.233) (-765.760) [-766.045] (-766.467) -- 0:00:47
277000 -- (-768.456) [-765.535] (-768.518) (-766.354) * [-766.580] (-766.479) (-767.150) (-765.562) -- 0:00:46
277500 -- [-766.433] (-766.839) (-765.835) (-766.624) * (-766.454) (-766.703) [-765.163] (-768.171) -- 0:00:46
278000 -- [-768.441] (-766.460) (-765.730) (-767.381) * (-770.094) [-766.302] (-764.977) (-766.984) -- 0:00:46
278500 -- [-767.279] (-770.967) (-766.363) (-764.710) * (-766.740) (-769.040) (-765.832) [-764.985] -- 0:00:46
279000 -- (-766.951) [-767.432] (-767.500) (-767.517) * (-765.360) [-770.518] (-768.667) (-765.797) -- 0:00:46
279500 -- (-766.397) (-766.743) [-767.119] (-765.288) * (-765.368) (-768.209) (-764.993) [-765.669] -- 0:00:46
280000 -- (-766.910) (-766.579) (-766.386) [-769.533] * (-767.406) (-765.737) (-767.728) [-765.794] -- 0:00:46
Average standard deviation of split frequencies: 0.011934
280500 -- (-766.222) (-766.539) [-770.431] (-771.476) * [-768.975] (-768.926) (-766.170) (-765.296) -- 0:00:48
281000 -- [-765.170] (-767.492) (-765.656) (-771.074) * (-773.010) (-765.169) (-766.453) [-768.169] -- 0:00:48
281500 -- (-768.309) (-767.399) [-765.391] (-767.521) * (-770.982) (-766.893) (-766.038) [-766.071] -- 0:00:48
282000 -- (-764.672) (-766.541) (-767.672) [-766.813] * (-767.757) (-766.766) (-765.757) [-765.618] -- 0:00:48
282500 -- (-764.738) (-767.143) (-764.947) [-767.190] * (-769.535) (-766.323) [-770.021] (-764.959) -- 0:00:48
283000 -- (-766.063) (-769.115) (-766.412) [-766.155] * (-769.457) [-766.529] (-766.653) (-764.833) -- 0:00:48
283500 -- (-766.576) [-767.006] (-765.200) (-768.715) * (-765.764) (-766.366) [-767.142] (-765.032) -- 0:00:48
284000 -- [-765.497] (-766.261) (-765.925) (-768.317) * (-775.318) [-765.773] (-767.636) (-765.033) -- 0:00:47
284500 -- (-768.702) (-772.466) [-765.880] (-767.883) * (-767.720) (-767.398) [-766.491] (-765.340) -- 0:00:47
285000 -- (-768.096) [-768.219] (-766.644) (-769.183) * (-767.003) (-765.852) (-767.501) [-765.170] -- 0:00:47
Average standard deviation of split frequencies: 0.011355
285500 -- (-772.169) (-765.596) [-765.241] (-770.101) * (-768.958) (-767.623) [-767.799] (-768.407) -- 0:00:47
286000 -- (-765.782) (-767.040) (-765.010) [-770.021] * (-768.319) (-766.568) (-767.971) [-768.136] -- 0:00:47
286500 -- (-767.135) (-768.269) (-765.010) [-767.730] * [-766.393] (-765.689) (-765.036) (-766.567) -- 0:00:47
287000 -- [-766.764] (-765.982) (-765.202) (-769.126) * (-766.817) (-768.275) (-765.472) [-766.332] -- 0:00:47
287500 -- (-766.762) (-768.455) [-765.647] (-767.873) * [-767.369] (-769.251) (-765.631) (-766.716) -- 0:00:47
288000 -- (-766.783) (-767.466) (-767.846) [-766.283] * (-767.525) (-766.340) (-765.911) [-768.767] -- 0:00:46
288500 -- [-767.690] (-765.481) (-768.472) (-766.435) * (-768.291) [-765.065] (-768.233) (-767.650) -- 0:00:46
289000 -- [-768.811] (-765.221) (-767.244) (-766.745) * (-767.577) (-765.068) [-768.258] (-765.558) -- 0:00:46
289500 -- [-766.521] (-771.121) (-765.052) (-764.929) * (-764.770) (-764.954) (-768.753) [-768.596] -- 0:00:46
290000 -- (-765.386) (-768.195) (-766.942) [-765.357] * [-765.123] (-766.012) (-765.272) (-768.967) -- 0:00:46
Average standard deviation of split frequencies: 0.012254
290500 -- (-764.701) (-767.088) (-766.469) [-765.205] * (-765.558) (-765.880) [-767.641] (-768.895) -- 0:00:46
291000 -- [-768.179] (-766.697) (-765.382) (-769.534) * [-765.556] (-768.333) (-769.437) (-768.216) -- 0:00:46
291500 -- (-768.499) (-767.811) [-765.510] (-767.319) * [-764.956] (-767.185) (-767.199) (-766.524) -- 0:00:46
292000 -- [-768.055] (-769.568) (-766.953) (-771.056) * (-769.511) (-768.948) (-767.485) [-767.102] -- 0:00:46
292500 -- [-765.531] (-766.692) (-764.680) (-767.980) * (-768.581) (-766.415) [-767.125] (-765.392) -- 0:00:45
293000 -- (-766.583) [-765.757] (-767.792) (-767.127) * (-769.135) (-767.711) [-766.824] (-765.380) -- 0:00:45
293500 -- [-767.721] (-769.526) (-765.212) (-767.251) * (-768.890) (-770.654) (-768.364) [-766.420] -- 0:00:45
294000 -- (-765.036) (-767.397) (-766.500) [-769.244] * (-770.134) (-770.299) [-767.054] (-767.883) -- 0:00:45
294500 -- (-764.842) (-767.895) (-768.272) [-765.090] * [-767.805] (-765.500) (-766.137) (-767.332) -- 0:00:45
295000 -- [-766.898] (-769.604) (-768.632) (-765.451) * [-771.677] (-765.995) (-766.673) (-765.702) -- 0:00:45
Average standard deviation of split frequencies: 0.013714
295500 -- (-766.017) (-769.869) (-768.127) [-765.099] * (-768.975) (-766.658) [-766.949] (-765.388) -- 0:00:47
296000 -- (-766.103) (-766.786) (-765.647) [-764.556] * [-773.789] (-766.215) (-768.746) (-765.653) -- 0:00:47
296500 -- [-765.390] (-767.174) (-769.892) (-767.887) * (-771.110) (-766.136) (-765.429) [-765.466] -- 0:00:47
297000 -- [-765.260] (-765.568) (-767.581) (-768.345) * (-773.583) (-765.038) (-765.642) [-770.554] -- 0:00:47
297500 -- (-765.391) [-766.012] (-765.305) (-768.646) * [-770.462] (-765.344) (-766.723) (-767.081) -- 0:00:47
298000 -- (-770.270) [-766.953] (-766.237) (-766.179) * [-767.381] (-767.892) (-768.693) (-765.026) -- 0:00:47
298500 -- [-767.640] (-766.215) (-768.648) (-765.872) * (-767.637) (-768.052) (-767.406) [-767.478] -- 0:00:47
299000 -- (-765.523) (-766.921) [-771.423] (-767.834) * (-767.858) (-765.964) [-765.757] (-765.997) -- 0:00:46
299500 -- (-768.398) (-768.843) [-767.504] (-767.994) * (-765.438) (-766.377) [-766.470] (-766.453) -- 0:00:46
300000 -- (-769.047) (-766.348) [-766.283] (-766.216) * (-769.534) (-766.406) (-766.419) [-771.576] -- 0:00:46
Average standard deviation of split frequencies: 0.013937
300500 -- (-766.588) (-767.040) [-768.331] (-765.487) * (-769.087) [-765.322] (-765.813) (-770.349) -- 0:00:46
301000 -- (-768.310) (-766.804) (-766.108) [-766.352] * (-767.574) [-765.477] (-766.070) (-770.046) -- 0:00:46
301500 -- (-769.697) [-765.486] (-768.133) (-767.864) * (-768.622) (-766.517) (-767.001) [-766.225] -- 0:00:46
302000 -- (-767.588) (-768.040) [-765.990] (-768.138) * (-768.650) (-766.682) [-764.899] (-766.849) -- 0:00:46
302500 -- [-767.740] (-766.657) (-765.799) (-766.974) * (-772.503) (-765.715) (-766.792) [-766.996] -- 0:00:46
303000 -- (-767.268) [-765.765] (-765.051) (-766.657) * (-766.872) [-765.276] (-768.888) (-766.553) -- 0:00:46
303500 -- (-767.338) (-765.688) (-766.941) [-766.336] * [-765.414] (-766.262) (-767.513) (-765.442) -- 0:00:45
304000 -- (-766.982) [-767.051] (-768.965) (-766.841) * [-769.277] (-765.165) (-766.123) (-765.068) -- 0:00:45
304500 -- [-767.018] (-766.468) (-767.985) (-765.936) * (-767.788) (-765.994) (-765.741) [-768.445] -- 0:00:45
305000 -- (-768.982) [-766.294] (-769.783) (-768.305) * (-766.793) [-765.975] (-768.538) (-766.105) -- 0:00:45
Average standard deviation of split frequencies: 0.013865
305500 -- (-770.268) (-766.188) [-765.817] (-767.360) * (-765.022) (-765.263) (-767.903) [-765.215] -- 0:00:45
306000 -- (-767.254) (-765.921) (-765.513) [-765.511] * (-765.997) [-765.266] (-766.344) (-765.817) -- 0:00:45
306500 -- (-767.203) [-765.717] (-766.134) (-767.755) * [-767.076] (-767.082) (-766.606) (-768.500) -- 0:00:45
307000 -- (-765.371) (-765.705) (-765.259) [-766.655] * (-768.396) (-768.076) [-765.307] (-767.232) -- 0:00:45
307500 -- (-770.014) [-765.989] (-766.660) (-774.515) * (-773.660) (-769.556) (-766.216) [-770.107] -- 0:00:45
308000 -- (-766.787) (-766.157) (-766.778) [-764.868] * (-767.567) (-769.209) [-766.864] (-768.990) -- 0:00:44
308500 -- (-766.310) (-767.961) [-767.332] (-769.369) * (-767.920) [-767.549] (-767.311) (-766.013) -- 0:00:44
309000 -- (-767.793) (-767.795) (-767.299) [-766.695] * (-766.335) [-768.039] (-765.781) (-765.877) -- 0:00:44
309500 -- (-766.187) (-767.816) (-766.020) [-765.999] * (-767.422) [-767.305] (-766.890) (-767.815) -- 0:00:44
310000 -- [-766.743] (-769.413) (-764.724) (-768.598) * (-768.516) (-769.503) (-769.409) [-765.224] -- 0:00:44
Average standard deviation of split frequencies: 0.014584
310500 -- (-768.000) (-765.206) [-765.083] (-768.626) * (-768.251) (-767.062) (-768.489) [-766.798] -- 0:00:46
311000 -- (-766.971) (-765.356) (-765.233) [-769.841] * [-765.593] (-766.905) (-765.760) (-768.163) -- 0:00:46
311500 -- (-767.447) (-768.981) (-765.547) [-767.007] * (-771.191) [-764.895] (-766.495) (-765.790) -- 0:00:46
312000 -- (-767.061) (-766.587) [-766.286] (-767.558) * (-767.317) (-767.664) (-770.778) [-768.147] -- 0:00:46
312500 -- [-768.834] (-765.293) (-766.932) (-767.425) * (-765.122) (-766.842) (-767.635) [-766.174] -- 0:00:46
313000 -- [-766.326] (-768.868) (-769.162) (-768.001) * [-765.157] (-766.177) (-768.151) (-765.690) -- 0:00:46
313500 -- (-767.167) (-766.692) [-768.450] (-769.333) * [-766.212] (-767.758) (-767.639) (-765.426) -- 0:00:45
314000 -- (-767.551) (-766.352) (-766.015) [-766.727] * [-765.731] (-770.018) (-768.261) (-766.531) -- 0:00:45
314500 -- (-764.744) [-767.667] (-771.195) (-767.404) * (-766.045) [-767.450] (-767.231) (-765.937) -- 0:00:45
315000 -- (-765.295) (-767.749) [-768.606] (-767.513) * (-769.037) [-766.795] (-767.896) (-765.167) -- 0:00:45
Average standard deviation of split frequencies: 0.013758
315500 -- (-766.393) (-766.760) [-765.853] (-767.082) * [-766.987] (-767.013) (-769.056) (-767.190) -- 0:00:45
316000 -- (-767.831) [-765.458] (-767.109) (-771.969) * (-765.075) (-765.569) (-767.458) [-765.741] -- 0:00:45
316500 -- [-769.984] (-767.649) (-766.914) (-770.355) * [-766.855] (-768.117) (-769.195) (-767.007) -- 0:00:45
317000 -- [-767.956] (-764.876) (-768.085) (-768.041) * [-768.942] (-767.119) (-766.837) (-765.749) -- 0:00:45
317500 -- (-765.846) (-766.467) (-765.483) [-769.695] * [-765.607] (-767.708) (-766.989) (-767.125) -- 0:00:45
318000 -- (-765.087) (-769.274) [-765.135] (-767.668) * [-766.583] (-770.603) (-765.544) (-768.218) -- 0:00:45
318500 -- (-764.876) (-767.742) (-766.966) [-767.009] * (-768.140) (-766.016) (-765.081) [-766.433] -- 0:00:44
319000 -- (-766.589) [-766.431] (-773.060) (-768.577) * (-771.872) (-768.558) (-765.172) [-764.906] -- 0:00:44
319500 -- (-766.727) (-765.931) [-770.167] (-767.416) * (-765.091) (-770.623) (-765.971) [-765.475] -- 0:00:44
320000 -- (-766.258) (-770.025) (-765.455) [-767.164] * (-764.712) [-765.435] (-766.993) (-768.443) -- 0:00:44
Average standard deviation of split frequencies: 0.014374
320500 -- (-764.540) [-767.886] (-766.739) (-765.464) * [-767.062] (-766.833) (-767.407) (-769.372) -- 0:00:44
321000 -- (-768.933) (-772.251) [-765.572] (-771.919) * (-767.944) (-766.798) [-766.686] (-765.826) -- 0:00:44
321500 -- [-769.220] (-767.499) (-765.331) (-765.764) * [-767.148] (-765.951) (-767.702) (-767.286) -- 0:00:44
322000 -- (-767.161) [-765.774] (-766.286) (-768.033) * [-765.533] (-767.141) (-767.487) (-769.239) -- 0:00:44
322500 -- (-766.140) [-769.665] (-765.026) (-765.227) * (-767.061) (-768.356) [-766.815] (-768.875) -- 0:00:44
323000 -- (-768.879) (-765.648) [-766.426] (-767.451) * (-767.815) (-768.798) (-765.588) [-769.882] -- 0:00:44
323500 -- (-768.099) (-767.103) (-766.592) [-765.935] * [-766.874] (-768.358) (-765.609) (-773.035) -- 0:00:43
324000 -- [-766.095] (-764.814) (-765.587) (-764.951) * (-766.822) (-773.382) (-766.620) [-770.228] -- 0:00:43
324500 -- (-764.845) [-766.257] (-765.835) (-766.034) * (-766.883) [-767.043] (-766.733) (-769.473) -- 0:00:43
325000 -- (-767.184) [-765.367] (-766.000) (-767.287) * (-767.285) (-767.038) (-766.419) [-764.880] -- 0:00:43
Average standard deviation of split frequencies: 0.013657
325500 -- [-766.183] (-767.961) (-770.997) (-765.723) * (-774.263) [-767.689] (-766.413) (-770.969) -- 0:00:45
326000 -- (-770.580) [-769.078] (-774.255) (-768.364) * (-765.896) (-765.453) (-765.659) [-769.851] -- 0:00:45
326500 -- [-768.554] (-765.421) (-768.574) (-765.807) * [-765.796] (-767.912) (-765.153) (-766.342) -- 0:00:45
327000 -- (-766.021) (-768.608) (-766.497) [-766.133] * (-765.657) [-766.428] (-766.405) (-767.399) -- 0:00:45
327500 -- [-765.844] (-767.618) (-766.551) (-766.312) * [-765.948] (-770.595) (-767.838) (-771.926) -- 0:00:45
328000 -- (-766.384) [-768.796] (-767.647) (-765.295) * [-765.003] (-770.909) (-769.425) (-770.005) -- 0:00:45
328500 -- [-766.849] (-769.665) (-767.629) (-766.714) * [-765.162] (-767.682) (-765.879) (-765.866) -- 0:00:44
329000 -- [-765.989] (-766.114) (-765.399) (-767.318) * [-765.658] (-769.050) (-772.391) (-765.617) -- 0:00:44
329500 -- [-766.232] (-771.208) (-766.130) (-765.458) * (-769.723) [-767.302] (-768.070) (-770.110) -- 0:00:44
330000 -- (-766.547) (-767.107) (-764.915) [-765.636] * (-767.054) [-768.595] (-769.324) (-765.508) -- 0:00:44
Average standard deviation of split frequencies: 0.012672
330500 -- (-767.203) (-765.838) (-766.258) [-768.565] * [-767.090] (-765.950) (-766.373) (-766.538) -- 0:00:44
331000 -- (-767.405) (-768.618) [-770.353] (-766.284) * [-768.166] (-770.116) (-768.980) (-768.854) -- 0:00:44
331500 -- (-765.282) (-767.990) [-765.398] (-766.444) * (-767.034) [-766.198] (-770.044) (-770.081) -- 0:00:44
332000 -- (-766.129) (-773.098) (-768.979) [-770.345] * (-768.058) [-765.693] (-765.363) (-769.169) -- 0:00:44
332500 -- [-764.752] (-771.927) (-770.172) (-772.209) * (-769.902) (-765.381) [-765.363] (-766.854) -- 0:00:44
333000 -- (-768.429) (-772.063) [-766.795] (-772.832) * (-765.766) (-765.186) (-772.061) [-765.769] -- 0:00:44
333500 -- [-767.754] (-768.620) (-770.162) (-767.818) * (-766.944) (-766.588) (-766.669) [-766.264] -- 0:00:43
334000 -- (-767.176) (-766.970) [-766.796] (-766.178) * (-765.318) (-766.417) (-769.075) [-765.906] -- 0:00:43
334500 -- (-767.240) [-765.793] (-766.190) (-767.066) * (-767.920) (-764.759) [-770.206] (-764.754) -- 0:00:43
335000 -- (-768.002) (-765.135) (-768.646) [-766.667] * (-765.147) (-765.050) (-770.904) [-764.821] -- 0:00:43
Average standard deviation of split frequencies: 0.011847
335500 -- (-770.961) (-769.535) (-766.166) [-764.832] * [-764.653] (-765.862) (-765.623) (-766.588) -- 0:00:43
336000 -- [-767.156] (-766.332) (-767.438) (-765.249) * (-766.009) (-766.027) (-767.954) [-765.239] -- 0:00:43
336500 -- [-766.755] (-765.999) (-770.289) (-766.684) * (-767.455) (-767.346) (-770.625) [-764.834] -- 0:00:43
337000 -- [-766.915] (-768.184) (-768.609) (-767.459) * [-768.528] (-769.158) (-767.162) (-765.447) -- 0:00:43
337500 -- (-767.399) (-767.259) [-766.021] (-768.771) * (-769.307) [-769.579] (-765.711) (-767.020) -- 0:00:43
338000 -- (-764.899) (-766.793) (-765.187) [-768.710] * (-766.075) (-766.589) (-768.463) [-768.833] -- 0:00:43
338500 -- (-765.118) (-766.292) [-769.039] (-767.087) * (-768.201) (-768.498) (-766.705) [-766.915] -- 0:00:42
339000 -- (-768.482) [-766.968] (-765.448) (-767.576) * (-766.147) [-768.722] (-765.641) (-768.617) -- 0:00:42
339500 -- (-767.963) (-766.800) (-765.727) [-764.722] * (-765.322) (-766.147) [-770.937] (-765.673) -- 0:00:42
340000 -- (-765.539) (-766.343) (-765.496) [-764.545] * (-768.641) [-767.809] (-770.664) (-766.213) -- 0:00:42
Average standard deviation of split frequencies: 0.012047
340500 -- (-765.838) (-766.792) (-766.720) [-764.528] * [-767.272] (-768.019) (-768.251) (-765.448) -- 0:00:44
341000 -- (-771.061) (-769.875) [-765.984] (-766.461) * (-764.705) (-771.118) (-764.892) [-765.866] -- 0:00:44
341500 -- (-767.720) (-769.266) [-766.780] (-765.400) * (-767.043) (-767.039) [-765.134] (-765.399) -- 0:00:44
342000 -- (-766.691) (-766.769) [-769.455] (-770.521) * (-766.699) [-764.991] (-766.011) (-766.350) -- 0:00:44
342500 -- (-768.023) (-770.260) (-767.200) [-767.981] * (-767.498) [-770.184] (-773.780) (-769.198) -- 0:00:44
343000 -- (-766.553) (-766.836) (-765.357) [-767.162] * (-765.301) (-766.537) [-766.568] (-767.268) -- 0:00:44
343500 -- (-767.587) (-764.640) (-766.107) [-767.636] * [-766.030] (-766.488) (-766.509) (-767.248) -- 0:00:43
344000 -- (-768.231) (-770.902) [-765.936] (-765.700) * (-768.568) [-766.868] (-766.743) (-770.123) -- 0:00:43
344500 -- (-770.802) (-769.927) (-766.039) [-765.707] * [-765.584] (-766.013) (-768.171) (-767.753) -- 0:00:43
345000 -- (-767.848) (-765.261) [-765.935] (-769.127) * [-765.832] (-768.565) (-769.319) (-764.845) -- 0:00:43
Average standard deviation of split frequencies: 0.011354
345500 -- (-769.316) (-770.438) [-765.597] (-765.433) * (-771.502) (-764.999) (-769.549) [-765.622] -- 0:00:43
346000 -- (-767.004) (-768.754) (-766.282) [-767.369] * (-768.475) (-766.895) (-767.875) [-769.614] -- 0:00:43
346500 -- (-767.500) [-769.673] (-767.816) (-765.807) * (-766.703) (-767.619) (-765.522) [-765.408] -- 0:00:43
347000 -- (-765.256) [-766.522] (-768.607) (-767.309) * (-769.287) (-767.699) (-768.040) [-768.466] -- 0:00:43
347500 -- [-766.852] (-766.480) (-773.992) (-766.432) * [-767.974] (-767.264) (-766.824) (-765.569) -- 0:00:43
348000 -- (-765.687) (-768.517) (-766.520) [-767.226] * (-766.544) [-766.908] (-769.556) (-765.587) -- 0:00:43
348500 -- [-768.846] (-765.743) (-765.455) (-765.840) * [-765.067] (-767.341) (-766.707) (-764.810) -- 0:00:42
349000 -- (-768.566) [-766.367] (-768.773) (-768.989) * [-765.217] (-769.244) (-767.526) (-764.993) -- 0:00:42
349500 -- (-767.378) [-768.293] (-768.813) (-768.220) * (-766.767) (-767.923) (-765.762) [-764.949] -- 0:00:42
350000 -- [-765.977] (-769.616) (-770.049) (-768.705) * (-766.723) (-766.759) [-769.477] (-764.642) -- 0:00:42
Average standard deviation of split frequencies: 0.011427
350500 -- (-765.846) (-767.275) (-765.553) [-765.759] * [-766.369] (-766.145) (-766.755) (-769.707) -- 0:00:42
351000 -- (-765.062) (-766.709) [-765.575] (-765.681) * [-766.278] (-765.693) (-768.179) (-767.253) -- 0:00:42
351500 -- (-768.895) [-766.489] (-764.938) (-766.983) * (-768.515) (-766.569) (-767.050) [-768.543] -- 0:00:42
352000 -- (-767.471) (-766.708) [-766.616] (-767.252) * [-765.698] (-766.200) (-767.140) (-771.790) -- 0:00:42
352500 -- (-766.100) (-767.222) (-766.070) [-767.381] * (-767.453) (-766.251) [-768.470] (-768.422) -- 0:00:42
353000 -- (-766.116) (-770.257) [-767.786] (-766.466) * (-765.483) [-767.831] (-765.213) (-770.998) -- 0:00:42
353500 -- (-769.314) (-769.268) [-767.575] (-766.381) * (-770.332) (-765.374) (-764.751) [-769.302] -- 0:00:42
354000 -- (-770.941) (-770.703) (-770.576) [-769.035] * [-769.345] (-769.525) (-767.747) (-767.872) -- 0:00:41
354500 -- (-770.847) (-766.874) (-765.072) [-770.267] * (-769.344) (-767.698) (-768.247) [-765.655] -- 0:00:41
355000 -- (-766.192) [-765.037] (-765.563) (-765.672) * (-768.053) (-769.218) [-767.952] (-765.481) -- 0:00:41
Average standard deviation of split frequencies: 0.011255
355500 -- (-766.809) [-765.720] (-765.615) (-771.386) * (-767.991) [-767.615] (-767.984) (-772.467) -- 0:00:43
356000 -- (-771.796) [-765.622] (-765.755) (-767.817) * (-767.188) (-768.548) [-768.054] (-767.301) -- 0:00:43
356500 -- (-765.837) (-768.574) [-766.412] (-765.836) * (-770.882) (-766.487) (-766.938) [-767.395] -- 0:00:43
357000 -- (-768.320) (-767.922) [-767.086] (-767.831) * (-770.359) [-767.970] (-765.223) (-765.852) -- 0:00:43
357500 -- (-769.029) (-771.134) [-766.540] (-767.967) * (-766.028) (-767.909) (-769.194) [-766.436] -- 0:00:43
358000 -- [-769.280] (-766.884) (-769.461) (-765.710) * [-767.302] (-769.735) (-768.550) (-767.436) -- 0:00:43
358500 -- (-766.373) (-767.861) [-769.912] (-769.462) * (-768.431) (-766.426) (-766.309) [-765.382] -- 0:00:42
359000 -- (-767.540) (-766.677) (-770.972) [-766.981] * (-766.282) (-765.679) (-770.965) [-764.539] -- 0:00:42
359500 -- (-768.743) (-766.210) (-767.881) [-766.361] * (-769.295) (-766.930) [-768.414] (-764.569) -- 0:00:42
360000 -- (-767.401) (-766.248) (-764.949) [-765.272] * [-766.106] (-770.453) (-766.161) (-768.129) -- 0:00:42
Average standard deviation of split frequencies: 0.010674
360500 -- (-767.887) [-766.931] (-766.864) (-765.168) * (-765.614) [-765.665] (-767.762) (-766.198) -- 0:00:42
361000 -- [-767.531] (-767.911) (-766.373) (-765.684) * [-765.655] (-766.355) (-766.195) (-766.370) -- 0:00:42
361500 -- (-768.273) (-766.312) [-765.878] (-767.353) * [-765.302] (-767.972) (-768.910) (-773.214) -- 0:00:42
362000 -- (-767.107) (-769.704) [-770.128] (-768.195) * (-769.846) [-767.246] (-766.370) (-773.273) -- 0:00:42
362500 -- (-765.866) (-769.210) [-767.213] (-766.684) * (-768.692) (-766.635) (-766.423) [-766.556] -- 0:00:42
363000 -- (-766.005) [-770.729] (-765.303) (-772.049) * (-765.486) (-768.672) [-768.780] (-766.870) -- 0:00:42
363500 -- (-765.943) (-767.775) (-769.181) [-770.471] * (-769.078) (-767.650) [-767.659] (-765.571) -- 0:00:42
364000 -- (-765.329) (-766.883) (-766.371) [-769.110] * (-765.855) [-769.276] (-768.695) (-768.286) -- 0:00:41
364500 -- (-767.400) (-767.510) [-768.764] (-771.009) * (-766.604) (-767.690) (-769.508) [-766.608] -- 0:00:41
365000 -- (-770.638) (-766.802) [-766.785] (-767.296) * (-767.394) (-766.682) (-772.369) [-765.183] -- 0:00:41
Average standard deviation of split frequencies: 0.010018
365500 -- (-767.489) [-769.351] (-766.035) (-767.985) * (-768.348) (-765.976) (-766.449) [-764.911] -- 0:00:41
366000 -- (-768.644) [-766.446] (-765.959) (-766.128) * [-765.522] (-769.294) (-766.619) (-765.773) -- 0:00:41
366500 -- (-765.536) (-768.302) (-764.726) [-765.686] * [-771.610] (-765.970) (-765.590) (-769.209) -- 0:00:41
367000 -- (-767.645) [-765.611] (-767.308) (-766.057) * (-769.655) [-765.566] (-764.838) (-769.610) -- 0:00:41
367500 -- (-766.113) (-766.563) (-765.588) [-764.973] * (-769.941) (-767.070) (-766.564) [-768.142] -- 0:00:41
368000 -- (-767.558) (-767.302) (-766.001) [-766.044] * (-767.283) (-767.217) [-767.800] (-766.107) -- 0:00:41
368500 -- (-768.225) (-765.208) [-765.037] (-768.345) * (-770.951) (-767.933) (-768.211) [-767.925] -- 0:00:41
369000 -- (-765.496) [-767.392] (-765.637) (-766.733) * (-772.368) (-767.668) [-768.933] (-767.024) -- 0:00:41
369500 -- (-766.315) [-770.961] (-767.887) (-765.388) * (-765.323) (-767.474) [-767.528] (-769.219) -- 0:00:40
370000 -- (-770.972) (-766.066) [-766.255] (-768.756) * (-765.804) [-767.627] (-766.030) (-768.553) -- 0:00:40
Average standard deviation of split frequencies: 0.010174
370500 -- (-767.787) (-767.407) (-767.727) [-765.795] * [-771.372] (-771.263) (-766.654) (-768.869) -- 0:00:40
371000 -- (-766.837) (-765.379) (-765.175) [-767.072] * (-768.562) (-769.453) [-764.825] (-767.815) -- 0:00:42
371500 -- (-769.781) (-765.585) (-767.597) [-767.168] * (-767.422) (-767.246) (-768.929) [-768.645] -- 0:00:42
372000 -- (-768.884) (-764.990) (-767.177) [-765.143] * (-765.543) (-767.590) (-768.413) [-765.775] -- 0:00:42
372500 -- [-766.626] (-769.056) (-766.171) (-769.140) * (-765.430) (-770.380) (-773.234) [-765.807] -- 0:00:42
373000 -- (-768.504) (-769.078) (-767.052) [-765.727] * [-765.125] (-767.666) (-770.247) (-766.870) -- 0:00:42
373500 -- [-768.545] (-769.338) (-766.421) (-768.691) * [-766.478] (-767.516) (-775.705) (-766.873) -- 0:00:41
374000 -- (-766.222) (-771.615) [-766.094] (-766.529) * (-768.959) (-766.598) [-765.042] (-767.285) -- 0:00:41
374500 -- (-771.208) (-771.286) [-765.973] (-765.720) * (-768.012) (-768.514) [-764.955] (-766.393) -- 0:00:41
375000 -- (-765.891) (-767.026) (-765.236) [-765.049] * (-766.594) (-766.636) [-765.046] (-766.451) -- 0:00:41
Average standard deviation of split frequencies: 0.010251
375500 -- (-765.444) [-764.739] (-765.756) (-769.012) * (-766.626) (-766.200) (-766.398) [-766.073] -- 0:00:41
376000 -- (-767.515) [-766.225] (-766.049) (-769.077) * (-767.973) (-765.621) [-766.224] (-768.979) -- 0:00:41
376500 -- (-766.633) [-766.192] (-765.735) (-766.411) * (-766.754) (-764.996) [-767.450] (-767.565) -- 0:00:41
377000 -- (-767.696) [-765.145] (-769.110) (-765.280) * (-769.377) [-770.489] (-766.657) (-766.317) -- 0:00:41
377500 -- (-768.161) (-766.987) (-766.574) [-765.834] * (-766.763) (-768.578) [-766.501] (-765.429) -- 0:00:41
378000 -- (-771.013) (-766.653) (-766.569) [-767.745] * (-767.182) (-770.659) (-774.251) [-766.629] -- 0:00:41
378500 -- (-769.181) (-766.526) (-767.027) [-766.036] * (-767.837) (-769.041) (-765.430) [-766.974] -- 0:00:41
379000 -- (-768.133) [-765.852] (-767.288) (-770.943) * (-769.395) (-767.805) [-765.080] (-767.706) -- 0:00:40
379500 -- (-768.475) (-770.814) [-766.673] (-766.919) * (-768.261) (-770.341) [-766.041] (-768.967) -- 0:00:40
380000 -- (-766.088) [-767.032] (-768.264) (-768.923) * (-766.279) (-769.459) [-766.315] (-766.688) -- 0:00:40
Average standard deviation of split frequencies: 0.009834
380500 -- (-766.880) (-768.568) (-765.029) [-765.640] * (-766.020) (-768.838) (-767.855) [-766.071] -- 0:00:40
381000 -- (-766.783) [-767.220] (-765.296) (-765.944) * [-767.569] (-769.259) (-768.364) (-765.413) -- 0:00:40
381500 -- (-766.707) (-767.594) [-766.806] (-765.896) * (-767.086) (-768.094) [-765.761] (-767.164) -- 0:00:40
382000 -- [-767.089] (-770.914) (-767.062) (-768.589) * (-765.999) [-766.358] (-771.029) (-767.161) -- 0:00:40
382500 -- (-766.403) (-769.205) [-771.547] (-767.786) * (-766.953) (-770.808) (-765.518) [-768.414] -- 0:00:40
383000 -- [-769.778] (-766.434) (-767.421) (-766.678) * [-765.421] (-765.392) (-765.894) (-766.698) -- 0:00:40
383500 -- [-766.186] (-767.420) (-766.193) (-766.521) * (-767.705) (-766.948) [-766.075] (-765.839) -- 0:00:40
384000 -- (-767.124) (-772.585) (-765.467) [-764.982] * (-765.700) [-767.393] (-767.988) (-765.241) -- 0:00:40
384500 -- (-766.316) (-771.835) [-766.237] (-766.662) * [-768.439] (-766.996) (-766.563) (-765.846) -- 0:00:40
385000 -- (-767.982) [-765.940] (-766.004) (-770.236) * (-765.020) (-770.590) [-765.574] (-767.857) -- 0:00:39
Average standard deviation of split frequencies: 0.009842
385500 -- (-765.902) [-767.776] (-770.240) (-767.006) * (-770.044) (-768.879) (-764.901) [-766.664] -- 0:00:39
386000 -- (-766.792) (-768.843) [-768.155] (-766.251) * [-765.773] (-768.607) (-765.094) (-773.514) -- 0:00:39
386500 -- (-766.407) (-765.175) [-766.660] (-766.503) * [-766.017] (-765.573) (-767.235) (-767.958) -- 0:00:41
387000 -- (-768.816) (-765.816) [-765.503] (-766.306) * [-767.284] (-770.283) (-768.226) (-765.855) -- 0:00:41
387500 -- (-766.525) [-766.995] (-768.561) (-765.295) * (-771.106) (-768.912) (-765.823) [-766.570] -- 0:00:41
388000 -- (-765.892) (-768.906) [-765.873] (-765.061) * (-764.780) (-768.170) [-764.963] (-767.141) -- 0:00:41
388500 -- (-772.279) (-766.653) (-765.156) [-766.581] * (-764.733) (-766.310) (-765.473) [-768.647] -- 0:00:40
389000 -- (-769.818) (-766.205) [-765.180] (-768.015) * [-765.797] (-770.084) (-767.861) (-767.347) -- 0:00:40
389500 -- (-770.187) (-767.704) (-766.286) [-768.305] * (-767.415) [-773.941] (-765.261) (-767.211) -- 0:00:40
390000 -- (-771.710) [-766.878] (-766.413) (-765.636) * [-769.077] (-769.562) (-766.218) (-768.962) -- 0:00:40
Average standard deviation of split frequencies: 0.010576
390500 -- [-767.592] (-769.311) (-769.713) (-768.119) * (-768.621) (-768.834) (-767.086) [-766.107] -- 0:00:40
391000 -- [-766.139] (-767.270) (-768.424) (-770.198) * [-765.199] (-769.888) (-767.420) (-769.602) -- 0:00:40
391500 -- (-766.527) [-767.237] (-765.086) (-765.384) * (-767.761) (-769.380) [-768.269] (-771.474) -- 0:00:40
392000 -- (-766.480) (-768.766) (-765.567) [-765.449] * (-767.716) [-769.414] (-769.981) (-766.126) -- 0:00:40
392500 -- (-769.802) [-764.707] (-769.860) (-765.851) * (-767.861) [-765.182] (-766.475) (-767.045) -- 0:00:40
393000 -- (-768.817) [-766.962] (-766.244) (-765.789) * (-767.675) (-765.400) [-765.957] (-768.639) -- 0:00:40
393500 -- [-766.108] (-766.391) (-766.034) (-765.810) * (-767.077) (-768.946) [-764.690] (-766.004) -- 0:00:40
394000 -- (-767.363) (-765.827) [-765.479] (-768.773) * (-772.074) (-765.166) (-765.074) [-766.307] -- 0:00:39
394500 -- (-766.797) (-766.910) (-766.284) [-767.279] * (-766.690) (-770.002) (-766.306) [-767.235] -- 0:00:39
395000 -- (-768.426) (-769.709) (-772.930) [-767.353] * (-767.536) [-766.220] (-766.609) (-767.634) -- 0:00:39
Average standard deviation of split frequencies: 0.010119
395500 -- (-766.175) (-765.482) (-773.108) [-765.914] * (-766.911) [-765.887] (-771.286) (-766.348) -- 0:00:39
396000 -- (-766.693) (-773.958) [-766.782] (-765.728) * (-769.393) (-766.252) [-768.307] (-768.542) -- 0:00:39
396500 -- (-768.543) (-771.307) [-767.039] (-766.143) * (-770.232) (-767.809) [-766.386] (-764.795) -- 0:00:39
397000 -- (-769.723) (-767.251) [-766.080] (-767.630) * (-768.683) (-765.775) (-767.795) [-764.973] -- 0:00:39
397500 -- (-769.193) [-766.026] (-764.799) (-769.262) * (-766.706) (-766.920) [-765.651] (-764.927) -- 0:00:39
398000 -- (-765.580) [-764.910] (-764.709) (-772.810) * [-766.855] (-766.962) (-767.518) (-764.944) -- 0:00:39
398500 -- [-765.656] (-765.847) (-769.263) (-769.853) * (-766.847) (-766.893) [-767.649] (-764.792) -- 0:00:39
399000 -- [-771.019] (-769.351) (-770.104) (-768.831) * (-767.943) [-768.428] (-770.287) (-766.787) -- 0:00:39
399500 -- [-770.080] (-767.796) (-767.016) (-768.351) * (-765.923) (-768.040) [-767.586] (-765.838) -- 0:00:39
400000 -- (-767.106) (-765.229) [-767.325] (-768.659) * (-769.881) [-765.249] (-766.988) (-765.434) -- 0:00:39
Average standard deviation of split frequencies: 0.010589
400500 -- [-765.646] (-766.594) (-768.717) (-765.152) * (-766.884) (-769.054) [-767.004] (-769.004) -- 0:00:38
401000 -- [-766.663] (-767.170) (-766.141) (-765.507) * (-768.553) (-765.452) (-768.734) [-767.747] -- 0:00:38
401500 -- (-766.368) (-767.053) [-765.801] (-766.296) * (-765.798) (-765.426) [-765.217] (-766.111) -- 0:00:40
402000 -- [-767.119] (-767.553) (-767.258) (-767.421) * (-765.043) [-769.532] (-770.695) (-766.934) -- 0:00:40
402500 -- (-765.267) (-767.377) [-768.747] (-767.752) * [-766.901] (-768.773) (-768.543) (-767.185) -- 0:00:40
403000 -- (-766.803) (-767.543) (-770.051) [-765.601] * [-765.147] (-766.873) (-764.905) (-767.471) -- 0:00:39
403500 -- (-767.734) (-767.308) [-768.784] (-766.490) * (-768.161) (-764.790) (-767.429) [-767.804] -- 0:00:39
404000 -- (-766.094) (-766.044) (-769.679) [-767.543] * (-768.385) (-767.802) (-765.601) [-767.418] -- 0:00:39
404500 -- (-766.993) (-768.352) [-770.656] (-770.575) * (-766.429) (-771.710) (-771.971) [-766.953] -- 0:00:39
405000 -- (-768.482) (-771.152) (-766.857) [-767.241] * (-767.343) (-765.242) [-765.346] (-765.698) -- 0:00:39
Average standard deviation of split frequencies: 0.009740
405500 -- [-767.086] (-767.966) (-769.267) (-764.854) * (-771.725) (-768.192) (-766.270) [-766.848] -- 0:00:39
406000 -- [-768.911] (-767.083) (-767.820) (-766.370) * [-766.570] (-771.009) (-766.435) (-765.159) -- 0:00:39
406500 -- (-767.457) (-770.392) [-768.519] (-764.975) * (-767.315) [-772.090] (-766.670) (-766.406) -- 0:00:39
407000 -- [-768.146] (-768.385) (-768.457) (-766.544) * (-766.395) (-768.382) (-766.264) [-765.400] -- 0:00:39
407500 -- (-766.837) (-770.769) (-767.802) [-765.432] * (-768.327) (-767.117) [-765.733] (-768.920) -- 0:00:39
408000 -- (-766.886) [-771.228] (-772.117) (-770.033) * (-770.568) [-769.258] (-767.228) (-767.026) -- 0:00:39
408500 -- (-766.048) (-765.242) (-766.878) [-766.904] * (-768.493) [-766.308] (-765.654) (-766.796) -- 0:00:39
409000 -- [-768.934] (-766.254) (-770.508) (-769.384) * (-767.368) (-765.638) (-765.325) [-764.616] -- 0:00:39
409500 -- [-765.874] (-765.679) (-765.025) (-766.095) * (-766.394) (-766.032) (-765.536) [-766.823] -- 0:00:38
410000 -- (-767.000) [-766.629] (-766.812) (-767.849) * (-766.711) (-767.925) (-767.271) [-766.384] -- 0:00:38
Average standard deviation of split frequencies: 0.008508
410500 -- [-769.896] (-772.181) (-771.127) (-769.455) * [-767.072] (-767.502) (-767.210) (-767.487) -- 0:00:38
411000 -- [-766.024] (-768.711) (-766.783) (-769.385) * (-767.221) (-767.806) [-769.767] (-765.092) -- 0:00:38
411500 -- [-766.276] (-767.768) (-765.641) (-766.863) * (-768.038) [-765.665] (-765.687) (-765.419) -- 0:00:38
412000 -- (-767.959) (-769.999) [-765.351] (-764.596) * [-767.544] (-767.764) (-767.928) (-767.731) -- 0:00:38
412500 -- (-765.149) (-769.711) [-765.134] (-765.175) * (-767.701) (-771.757) (-767.356) [-765.939] -- 0:00:38
413000 -- (-767.286) [-770.724] (-771.092) (-767.456) * (-769.442) (-769.568) (-767.373) [-766.234] -- 0:00:38
413500 -- (-766.098) [-767.634] (-765.714) (-768.294) * (-770.922) (-771.590) (-766.130) [-765.440] -- 0:00:38
414000 -- (-768.706) [-767.503] (-767.873) (-769.591) * (-767.553) [-766.235] (-773.293) (-766.282) -- 0:00:38
414500 -- (-767.926) [-767.967] (-768.370) (-765.265) * (-768.665) (-766.045) [-766.178] (-765.999) -- 0:00:38
415000 -- [-766.097] (-766.442) (-767.083) (-765.923) * (-765.587) [-765.668] (-766.983) (-765.198) -- 0:00:38
Average standard deviation of split frequencies: 0.009132
415500 -- [-768.465] (-766.724) (-767.695) (-765.786) * (-767.313) [-766.778] (-768.024) (-765.580) -- 0:00:37
416000 -- (-767.550) (-767.216) (-767.643) [-767.374] * (-765.975) (-768.632) [-765.464] (-769.948) -- 0:00:39
416500 -- (-767.094) (-766.075) [-768.556] (-768.702) * (-766.367) [-768.735] (-766.799) (-768.512) -- 0:00:39
417000 -- (-765.411) (-769.732) [-767.884] (-769.921) * (-766.754) (-771.697) (-768.277) [-772.236] -- 0:00:39
417500 -- (-767.392) [-766.626] (-766.702) (-766.849) * (-765.927) (-768.962) (-773.961) [-767.858] -- 0:00:39
418000 -- (-766.022) (-765.748) [-766.425] (-766.912) * (-765.895) (-766.558) (-766.186) [-767.452] -- 0:00:38
418500 -- (-765.163) [-765.693] (-770.297) (-766.128) * (-767.250) (-769.050) [-766.506] (-766.521) -- 0:00:38
419000 -- (-766.932) (-772.021) (-767.662) [-767.458] * (-769.813) (-766.232) (-764.986) [-769.333] -- 0:00:38
419500 -- (-767.365) [-766.221] (-772.559) (-765.303) * (-767.360) [-767.448] (-765.019) (-769.779) -- 0:00:38
420000 -- [-765.009] (-765.367) (-765.996) (-768.400) * (-766.969) (-765.763) [-764.806] (-765.297) -- 0:00:38
Average standard deviation of split frequencies: 0.009031
420500 -- [-768.212] (-766.283) (-767.747) (-766.580) * [-766.705] (-766.323) (-768.129) (-765.804) -- 0:00:38
421000 -- (-768.245) (-769.375) (-765.655) [-767.552] * (-768.516) [-766.774] (-771.837) (-766.864) -- 0:00:38
421500 -- [-768.991] (-768.534) (-766.675) (-765.557) * (-769.565) [-765.959] (-767.128) (-766.886) -- 0:00:38
422000 -- (-767.093) (-767.152) (-769.908) [-766.287] * (-765.792) [-766.676] (-767.351) (-768.790) -- 0:00:38
422500 -- (-769.645) (-766.457) [-767.952] (-768.683) * (-766.152) [-776.098] (-768.048) (-767.701) -- 0:00:38
423000 -- [-765.224] (-766.373) (-770.177) (-773.192) * [-766.070] (-768.897) (-765.334) (-769.650) -- 0:00:38
423500 -- [-766.101] (-766.808) (-767.411) (-769.166) * [-766.616] (-767.569) (-767.840) (-766.946) -- 0:00:38
424000 -- (-770.429) (-769.121) [-766.876] (-765.962) * (-766.675) [-767.329] (-765.455) (-772.883) -- 0:00:38
424500 -- [-766.334] (-770.051) (-766.542) (-765.772) * (-770.426) (-765.469) [-769.398] (-767.868) -- 0:00:37
425000 -- (-770.880) (-764.930) (-765.283) [-766.760] * (-774.647) (-765.350) (-768.052) [-767.133] -- 0:00:37
Average standard deviation of split frequencies: 0.009569
425500 -- (-768.157) (-767.121) [-765.465] (-767.915) * (-771.539) (-766.491) (-766.820) [-767.787] -- 0:00:37
426000 -- (-768.376) [-766.493] (-765.695) (-765.265) * (-768.465) (-767.423) (-769.043) [-767.874] -- 0:00:37
426500 -- (-766.177) [-769.925] (-767.278) (-768.097) * (-766.148) (-765.543) (-766.347) [-766.224] -- 0:00:37
427000 -- (-765.898) (-768.754) (-766.368) [-768.583] * (-766.063) [-771.396] (-765.473) (-768.166) -- 0:00:37
427500 -- (-766.284) (-767.502) [-768.576] (-767.195) * [-768.795] (-765.778) (-775.304) (-765.255) -- 0:00:37
428000 -- (-765.878) (-764.735) [-766.025] (-765.692) * (-773.583) [-768.301] (-769.869) (-766.378) -- 0:00:37
428500 -- [-767.020] (-766.722) (-769.935) (-765.785) * (-765.291) (-768.332) (-766.592) [-766.585] -- 0:00:37
429000 -- [-766.721] (-766.260) (-766.743) (-772.268) * (-769.191) [-765.862] (-767.570) (-766.596) -- 0:00:37
429500 -- [-766.751] (-766.477) (-766.816) (-767.224) * [-768.534] (-769.151) (-765.786) (-765.642) -- 0:00:37
430000 -- (-766.992) (-770.641) (-768.821) [-765.781] * (-768.411) (-769.434) (-766.717) [-765.763] -- 0:00:37
Average standard deviation of split frequencies: 0.009787
430500 -- (-767.260) (-770.242) (-768.111) [-766.758] * (-765.173) (-770.417) (-765.850) [-767.376] -- 0:00:37
431000 -- (-765.983) (-766.017) (-767.703) [-766.520] * [-766.407] (-768.024) (-765.530) (-764.674) -- 0:00:38
431500 -- (-767.624) [-767.172] (-766.589) (-765.779) * (-767.072) (-765.627) (-765.961) [-766.173] -- 0:00:38
432000 -- [-766.826] (-765.547) (-767.151) (-764.947) * (-767.917) [-766.802] (-765.662) (-770.635) -- 0:00:38
432500 -- (-765.825) (-768.295) [-768.868] (-765.944) * [-771.693] (-766.095) (-767.215) (-773.080) -- 0:00:38
433000 -- (-765.463) (-766.475) [-766.261] (-767.073) * [-768.889] (-765.517) (-769.598) (-772.297) -- 0:00:37
433500 -- [-768.250] (-765.841) (-766.918) (-767.846) * (-769.184) (-767.851) (-766.996) [-766.077] -- 0:00:37
434000 -- (-767.182) [-769.660] (-765.275) (-765.835) * [-766.133] (-770.482) (-766.350) (-766.385) -- 0:00:37
434500 -- [-767.321] (-766.273) (-765.065) (-767.504) * (-769.543) [-767.592] (-766.413) (-765.181) -- 0:00:37
435000 -- [-769.373] (-767.173) (-765.770) (-767.104) * (-773.960) (-766.271) [-767.265] (-765.150) -- 0:00:37
Average standard deviation of split frequencies: 0.009604
435500 -- (-766.711) [-766.054] (-768.915) (-766.126) * (-766.805) (-768.273) (-767.467) [-766.588] -- 0:00:37
436000 -- [-767.403] (-766.160) (-769.889) (-769.886) * [-768.100] (-766.939) (-767.880) (-766.861) -- 0:00:37
436500 -- (-768.800) (-765.752) [-765.863] (-766.288) * (-768.907) [-769.635] (-766.556) (-767.283) -- 0:00:37
437000 -- (-770.876) (-765.370) [-765.542] (-768.779) * (-767.902) (-766.165) (-767.613) [-766.508] -- 0:00:37
437500 -- (-771.343) (-765.825) (-767.942) [-766.050] * [-767.769] (-773.977) (-768.181) (-766.755) -- 0:00:37
438000 -- (-766.406) (-765.655) (-767.898) [-767.523] * (-767.722) (-766.267) (-768.381) [-766.602] -- 0:00:37
438500 -- [-765.018] (-769.371) (-766.482) (-765.955) * (-771.012) (-768.294) [-766.040] (-767.615) -- 0:00:37
439000 -- (-766.608) (-766.628) (-766.932) [-766.481] * [-767.117] (-767.014) (-769.040) (-768.457) -- 0:00:37
439500 -- (-768.970) [-764.660] (-768.144) (-766.545) * (-767.632) (-767.839) [-768.721] (-768.758) -- 0:00:36
440000 -- (-765.846) (-768.181) [-767.596] (-766.214) * (-769.967) [-766.723] (-768.326) (-768.419) -- 0:00:36
Average standard deviation of split frequencies: 0.010194
440500 -- (-767.600) [-767.075] (-766.902) (-768.096) * [-769.438] (-765.660) (-767.844) (-767.229) -- 0:00:36
441000 -- (-766.016) [-767.457] (-769.158) (-767.456) * (-765.976) [-768.135] (-767.187) (-766.296) -- 0:00:36
441500 -- (-765.054) (-766.472) (-768.193) [-767.103] * (-767.411) [-767.390] (-767.022) (-769.047) -- 0:00:36
442000 -- (-765.493) [-766.704] (-765.252) (-770.080) * (-766.149) (-772.343) (-771.436) [-767.850] -- 0:00:36
442500 -- (-765.815) [-765.631] (-765.017) (-766.826) * (-766.525) (-770.142) [-767.635] (-767.170) -- 0:00:36
443000 -- (-767.443) [-764.928] (-765.251) (-766.364) * [-769.317] (-768.716) (-765.391) (-765.281) -- 0:00:36
443500 -- (-767.241) (-765.333) [-764.926] (-767.932) * [-768.113] (-768.223) (-765.378) (-766.577) -- 0:00:36
444000 -- [-768.111] (-768.987) (-765.928) (-767.179) * (-768.563) [-767.328] (-765.392) (-768.475) -- 0:00:36
444500 -- [-766.286] (-766.865) (-765.473) (-767.837) * (-768.060) [-764.692] (-764.825) (-770.747) -- 0:00:36
445000 -- (-769.037) [-765.864] (-769.379) (-766.081) * (-767.972) (-765.402) [-766.615] (-767.464) -- 0:00:36
Average standard deviation of split frequencies: 0.009761
445500 -- (-767.495) (-765.537) (-768.050) [-767.234] * [-765.288] (-766.183) (-766.654) (-768.463) -- 0:00:37
446000 -- [-767.315] (-765.577) (-772.146) (-769.883) * (-768.956) (-768.337) [-768.783] (-766.734) -- 0:00:37
446500 -- (-767.725) (-766.040) (-769.387) [-766.916] * (-768.316) (-765.754) [-767.523] (-770.117) -- 0:00:37
447000 -- (-768.037) [-770.911] (-766.505) (-766.274) * (-767.919) (-767.751) [-766.374] (-767.502) -- 0:00:37
447500 -- (-768.267) (-766.216) [-766.644] (-766.410) * (-766.390) (-766.225) [-766.713] (-765.937) -- 0:00:37
448000 -- (-774.689) (-767.174) [-766.203] (-767.438) * [-767.843] (-766.522) (-767.245) (-769.744) -- 0:00:36
448500 -- (-767.066) (-767.325) (-766.058) [-766.942] * (-766.450) [-766.201] (-771.266) (-768.361) -- 0:00:36
449000 -- (-765.381) [-766.103] (-768.383) (-765.984) * (-766.397) [-768.649] (-776.042) (-766.803) -- 0:00:36
449500 -- (-765.616) (-768.275) (-768.388) [-765.718] * (-765.183) (-765.921) [-766.655] (-766.596) -- 0:00:36
450000 -- [-767.117] (-767.776) (-768.397) (-766.465) * (-767.012) [-766.930] (-768.947) (-764.937) -- 0:00:36
Average standard deviation of split frequencies: 0.009124
450500 -- [-767.461] (-769.336) (-768.234) (-766.078) * (-766.071) (-769.714) (-772.556) [-766.958] -- 0:00:36
451000 -- [-766.751] (-774.061) (-770.053) (-767.081) * (-765.858) [-767.137] (-771.304) (-766.786) -- 0:00:36
451500 -- (-766.075) (-768.448) [-766.111] (-769.283) * [-766.567] (-768.615) (-768.360) (-766.818) -- 0:00:36
452000 -- (-766.410) [-766.201] (-764.914) (-769.050) * (-773.370) (-767.995) [-774.938] (-769.998) -- 0:00:36
452500 -- [-767.127] (-768.677) (-766.123) (-767.833) * (-768.536) [-766.157] (-767.764) (-767.588) -- 0:00:36
453000 -- (-767.557) [-766.709] (-768.283) (-767.530) * (-765.793) [-764.965] (-768.950) (-775.170) -- 0:00:36
453500 -- (-765.880) (-767.314) [-766.965] (-770.931) * (-765.450) [-768.236] (-765.940) (-768.238) -- 0:00:36
454000 -- (-766.662) (-765.067) (-766.708) [-768.156] * (-766.240) [-766.709] (-768.230) (-766.110) -- 0:00:36
454500 -- (-766.132) [-764.847] (-766.506) (-768.997) * (-765.674) [-764.796] (-765.258) (-768.340) -- 0:00:36
455000 -- (-770.321) [-766.412] (-768.118) (-768.894) * (-765.249) (-765.686) (-767.649) [-768.020] -- 0:00:35
Average standard deviation of split frequencies: 0.009304
455500 -- [-766.935] (-769.240) (-766.339) (-766.180) * [-765.150] (-765.686) (-765.976) (-768.502) -- 0:00:35
456000 -- (-769.823) [-766.042] (-766.815) (-766.079) * [-765.073] (-765.686) (-767.677) (-766.122) -- 0:00:35
456500 -- [-772.570] (-766.779) (-770.243) (-766.093) * (-765.980) [-767.192] (-766.247) (-769.835) -- 0:00:35
457000 -- (-769.452) [-766.045] (-767.000) (-765.897) * (-765.402) (-765.915) [-766.241] (-771.753) -- 0:00:35
457500 -- (-767.696) (-765.780) [-766.487] (-770.400) * (-766.566) (-766.884) [-765.259] (-768.679) -- 0:00:35
458000 -- [-766.839] (-767.715) (-766.344) (-769.564) * (-770.538) (-767.853) [-764.727] (-765.277) -- 0:00:35
458500 -- (-771.838) [-768.183] (-766.326) (-767.977) * [-766.802] (-767.567) (-767.782) (-765.765) -- 0:00:35
459000 -- (-770.662) [-765.887] (-766.262) (-767.020) * (-767.388) (-771.353) (-766.296) [-766.355] -- 0:00:35
459500 -- [-766.459] (-767.419) (-767.290) (-766.153) * [-766.509] (-767.793) (-765.733) (-768.359) -- 0:00:35
460000 -- (-766.362) (-765.403) (-767.438) [-766.366] * (-766.994) [-765.702] (-766.430) (-765.435) -- 0:00:35
Average standard deviation of split frequencies: 0.009210
460500 -- (-765.646) [-766.098] (-765.193) (-765.231) * (-767.868) (-767.244) [-764.735] (-766.822) -- 0:00:36
461000 -- (-766.349) (-773.443) (-766.068) [-768.510] * (-768.053) (-767.376) [-766.980] (-765.166) -- 0:00:36
461500 -- (-768.726) [-766.391] (-766.055) (-765.652) * (-765.588) (-769.892) (-769.494) [-766.959] -- 0:00:36
462000 -- [-771.605] (-766.520) (-766.051) (-766.809) * (-767.317) [-773.123] (-768.712) (-768.312) -- 0:00:36
462500 -- (-765.753) [-765.864] (-770.506) (-769.920) * (-766.573) (-767.426) [-767.363] (-769.398) -- 0:00:36
463000 -- (-766.979) (-767.007) (-767.253) [-768.755] * (-765.375) (-766.813) [-766.471] (-770.532) -- 0:00:35
463500 -- (-767.679) [-770.075] (-769.545) (-765.018) * [-765.620] (-766.050) (-768.694) (-765.924) -- 0:00:35
464000 -- (-767.398) [-767.670] (-770.606) (-767.492) * (-764.540) (-766.249) [-765.373] (-765.313) -- 0:00:35
464500 -- [-766.422] (-766.891) (-768.796) (-767.653) * [-767.636] (-766.415) (-766.600) (-765.307) -- 0:00:35
465000 -- (-767.967) (-765.738) (-766.725) [-765.418] * (-766.838) [-766.552] (-768.913) (-765.335) -- 0:00:35
Average standard deviation of split frequencies: 0.008271
465500 -- (-765.698) (-768.875) (-765.926) [-767.963] * [-764.687] (-768.928) (-765.381) (-765.335) -- 0:00:35
466000 -- [-766.476] (-768.861) (-770.234) (-766.311) * (-766.410) [-765.988] (-765.932) (-767.858) -- 0:00:35
466500 -- (-766.869) [-765.668] (-766.661) (-766.112) * (-766.671) [-766.172] (-765.921) (-765.536) -- 0:00:35
467000 -- (-770.574) [-765.393] (-768.892) (-766.992) * (-765.158) [-765.717] (-769.487) (-769.010) -- 0:00:35
467500 -- (-772.780) [-765.376] (-767.641) (-770.593) * (-768.503) (-766.826) (-768.418) [-772.074] -- 0:00:35
468000 -- (-771.125) (-764.821) [-767.386] (-767.656) * (-765.317) [-767.376] (-765.159) (-766.722) -- 0:00:35
468500 -- [-766.737] (-766.774) (-767.525) (-767.772) * (-767.109) (-770.497) (-765.455) [-767.974] -- 0:00:35
469000 -- [-765.014] (-773.088) (-766.459) (-768.333) * (-768.214) (-767.212) [-765.763] (-765.708) -- 0:00:35
469500 -- (-770.468) (-767.368) [-766.198] (-767.741) * [-766.757] (-766.628) (-766.217) (-765.200) -- 0:00:35
470000 -- (-767.089) (-765.097) [-765.040] (-768.818) * (-766.195) (-769.707) (-766.261) [-767.128] -- 0:00:34
Average standard deviation of split frequencies: 0.008425
470500 -- (-766.850) (-766.514) [-766.065] (-766.375) * (-766.421) (-768.694) [-769.741] (-765.055) -- 0:00:34
471000 -- (-771.003) [-766.862] (-772.462) (-772.140) * (-765.363) [-766.736] (-768.716) (-771.013) -- 0:00:34
471500 -- (-771.706) (-767.133) (-770.482) [-767.542] * (-765.976) [-767.748] (-765.288) (-768.462) -- 0:00:34
472000 -- [-765.830] (-767.341) (-770.916) (-770.197) * [-765.891] (-766.341) (-768.012) (-769.815) -- 0:00:34
472500 -- (-768.912) [-767.068] (-765.311) (-767.328) * [-767.793] (-766.279) (-765.094) (-767.272) -- 0:00:34
473000 -- (-768.103) [-766.487] (-765.766) (-768.730) * (-768.772) (-767.006) [-765.145] (-766.780) -- 0:00:34
473500 -- (-768.412) (-769.187) (-768.810) [-765.903] * [-766.292] (-765.592) (-766.740) (-765.080) -- 0:00:34
474000 -- (-768.504) (-765.901) [-765.977] (-765.201) * (-764.851) [-766.623] (-768.590) (-765.011) -- 0:00:34
474500 -- [-768.140] (-765.778) (-768.775) (-769.234) * (-765.057) [-767.390] (-764.870) (-766.539) -- 0:00:34
475000 -- (-766.220) (-765.527) (-766.841) [-769.329] * (-765.645) (-770.398) [-767.249] (-765.373) -- 0:00:35
Average standard deviation of split frequencies: 0.008389
475500 -- (-766.618) [-767.119] (-768.581) (-768.784) * (-766.711) (-768.933) (-771.998) [-766.718] -- 0:00:35
476000 -- (-770.587) [-767.819] (-768.031) (-770.403) * [-773.302] (-768.681) (-765.596) (-767.843) -- 0:00:35
476500 -- (-771.017) (-765.655) [-768.340] (-766.173) * (-769.029) (-766.051) (-767.174) [-765.694] -- 0:00:35
477000 -- [-766.860] (-765.261) (-766.604) (-766.148) * (-766.769) [-767.024] (-766.221) (-766.258) -- 0:00:35
477500 -- [-769.018] (-766.811) (-766.039) (-765.432) * (-770.695) (-769.452) [-768.077] (-764.631) -- 0:00:35
478000 -- (-771.884) (-767.232) [-766.039] (-767.590) * (-767.622) (-768.435) [-767.521] (-767.984) -- 0:00:34
478500 -- (-769.602) (-769.579) (-765.535) [-765.584] * (-766.759) (-767.932) [-769.814] (-765.102) -- 0:00:34
479000 -- (-768.883) (-765.148) (-766.864) [-765.128] * [-768.707] (-767.244) (-768.722) (-766.520) -- 0:00:34
479500 -- (-769.608) [-767.805] (-765.276) (-767.704) * [-768.373] (-767.176) (-768.315) (-768.253) -- 0:00:34
480000 -- (-767.982) (-768.507) [-765.687] (-766.693) * (-768.644) (-765.593) [-765.698] (-771.243) -- 0:00:34
Average standard deviation of split frequencies: 0.008250
480500 -- (-769.078) (-769.335) [-765.081] (-765.675) * (-766.484) [-766.009] (-773.131) (-766.296) -- 0:00:34
481000 -- (-769.293) (-766.940) [-767.035] (-768.650) * (-766.741) (-766.010) (-768.607) [-766.540] -- 0:00:34
481500 -- (-767.376) (-766.263) (-779.134) [-767.935] * (-771.654) (-766.393) [-769.625] (-766.202) -- 0:00:34
482000 -- [-768.438] (-766.747) (-765.635) (-766.061) * [-767.792] (-765.891) (-767.245) (-767.577) -- 0:00:34
482500 -- (-768.931) (-767.872) (-766.660) [-766.256] * (-766.509) (-765.428) (-766.488) [-765.434] -- 0:00:34
483000 -- (-766.026) [-765.725] (-766.669) (-768.376) * (-765.792) (-767.109) (-765.803) [-768.840] -- 0:00:34
483500 -- (-766.967) [-765.331] (-766.824) (-764.999) * (-767.020) [-766.437] (-766.600) (-767.972) -- 0:00:34
484000 -- (-767.664) (-767.190) (-766.757) [-766.279] * (-769.345) (-768.029) (-766.161) [-765.763] -- 0:00:34
484500 -- (-767.121) (-766.871) [-766.027] (-766.517) * [-767.640] (-769.104) (-768.539) (-766.056) -- 0:00:34
485000 -- (-766.408) (-767.042) [-764.850] (-766.214) * (-765.067) (-766.566) [-765.971] (-765.220) -- 0:00:33
Average standard deviation of split frequencies: 0.007646
485500 -- (-768.329) (-765.705) (-767.982) [-769.809] * (-767.294) [-766.293] (-765.573) (-766.319) -- 0:00:33
486000 -- (-767.484) [-766.138] (-765.519) (-767.659) * (-767.254) (-770.494) [-766.562] (-766.128) -- 0:00:33
486500 -- (-771.398) [-767.711] (-772.060) (-767.907) * (-767.105) (-769.058) [-769.289] (-766.147) -- 0:00:33
487000 -- (-765.535) (-767.137) (-765.870) [-766.512] * (-767.007) (-765.642) (-767.642) [-765.334] -- 0:00:33
487500 -- [-767.115] (-765.773) (-766.638) (-765.416) * [-769.806] (-769.665) (-769.170) (-767.998) -- 0:00:33
488000 -- (-765.079) (-765.477) (-765.924) [-766.149] * (-766.580) (-768.002) (-766.052) [-766.301] -- 0:00:33
488500 -- (-766.067) (-773.067) [-764.923] (-768.003) * (-768.051) (-768.413) [-765.887] (-768.957) -- 0:00:33
489000 -- (-766.970) [-764.875] (-765.683) (-766.714) * [-766.779] (-765.391) (-771.394) (-768.784) -- 0:00:33
489500 -- (-768.788) [-766.275] (-770.034) (-766.400) * (-767.312) (-767.220) (-765.215) [-768.321] -- 0:00:33
490000 -- [-767.353] (-766.275) (-764.889) (-768.876) * (-768.417) (-767.411) (-764.688) [-767.797] -- 0:00:34
Average standard deviation of split frequencies: 0.007460
490500 -- (-766.323) (-768.255) (-769.686) [-764.806] * (-771.282) (-767.143) (-767.838) [-767.846] -- 0:00:34
491000 -- (-767.928) (-767.194) [-766.114] (-766.603) * (-768.027) (-765.199) (-769.654) [-768.218] -- 0:00:34
491500 -- (-768.546) (-769.309) (-768.145) [-764.924] * (-765.946) [-766.430] (-767.221) (-766.481) -- 0:00:34
492000 -- [-767.067] (-769.513) (-771.782) (-766.340) * (-766.112) (-767.879) [-765.953] (-767.732) -- 0:00:34
492500 -- (-765.582) [-766.628] (-765.964) (-767.591) * [-766.074] (-767.043) (-766.202) (-766.499) -- 0:00:34
493000 -- (-765.850) (-767.854) (-768.769) [-770.726] * (-768.192) [-770.684] (-769.580) (-766.373) -- 0:00:33
493500 -- (-767.219) [-765.378] (-766.793) (-766.379) * (-766.648) (-768.937) [-765.393] (-767.513) -- 0:00:33
494000 -- [-766.167] (-766.395) (-767.478) (-769.659) * [-767.020] (-766.166) (-766.189) (-766.700) -- 0:00:33
494500 -- (-767.098) (-768.746) [-767.946] (-769.066) * (-765.902) (-767.764) [-772.927] (-767.904) -- 0:00:33
495000 -- (-768.322) (-765.613) (-766.977) [-767.195] * (-765.389) (-769.611) [-768.403] (-766.383) -- 0:00:33
Average standard deviation of split frequencies: 0.007939
495500 -- (-767.787) (-765.628) [-767.196] (-767.912) * (-765.300) [-768.930] (-766.810) (-768.196) -- 0:00:33
496000 -- (-767.482) [-766.048] (-766.375) (-767.478) * [-768.872] (-765.539) (-767.415) (-767.426) -- 0:00:33
496500 -- [-767.881] (-766.896) (-772.940) (-766.726) * (-765.676) (-766.318) (-766.828) [-765.730] -- 0:00:33
497000 -- (-768.740) [-766.798] (-766.437) (-764.704) * (-765.918) (-768.901) (-769.180) [-765.835] -- 0:00:33
497500 -- (-770.422) (-765.749) [-768.506] (-764.842) * (-767.641) (-766.706) [-765.902] (-772.873) -- 0:00:33
498000 -- (-765.216) [-765.232] (-766.107) (-765.362) * (-765.344) [-767.474] (-765.614) (-765.918) -- 0:00:33
498500 -- (-767.355) [-766.265] (-767.291) (-764.751) * (-768.238) (-765.570) (-765.686) [-766.569] -- 0:00:33
499000 -- (-770.843) [-768.265] (-768.561) (-765.524) * (-768.757) (-766.384) (-768.191) [-764.955] -- 0:00:33
499500 -- [-768.867] (-765.052) (-767.278) (-764.923) * (-769.084) (-766.652) (-766.887) [-767.827] -- 0:00:33
500000 -- (-766.789) (-764.937) [-766.953] (-767.036) * (-764.924) [-766.147] (-765.164) (-766.864) -- 0:00:33
Average standard deviation of split frequencies: 0.007062
500500 -- [-765.376] (-767.012) (-768.381) (-767.036) * [-765.222] (-775.881) (-766.268) (-767.105) -- 0:00:32
501000 -- (-766.044) [-765.865] (-766.124) (-764.863) * [-767.529] (-768.088) (-767.626) (-766.308) -- 0:00:32
501500 -- (-766.686) (-765.683) (-766.587) [-764.942] * [-766.793] (-767.875) (-768.587) (-767.449) -- 0:00:32
502000 -- (-768.457) [-767.413] (-766.606) (-765.341) * [-765.276] (-769.986) (-771.146) (-769.203) -- 0:00:32
502500 -- (-768.131) (-775.687) (-767.922) [-765.895] * [-765.803] (-773.046) (-767.717) (-765.579) -- 0:00:32
503000 -- [-765.030] (-766.357) (-768.832) (-765.850) * (-767.089) (-767.078) [-765.162] (-766.660) -- 0:00:32
503500 -- (-771.293) (-768.002) [-767.247] (-765.909) * (-766.502) (-767.504) [-766.083] (-770.959) -- 0:00:32
504000 -- (-769.619) (-769.225) [-765.706] (-766.980) * (-768.056) (-767.276) (-769.974) [-765.544] -- 0:00:32
504500 -- (-765.153) (-768.684) (-769.794) [-766.436] * (-766.159) (-767.372) [-765.085] (-766.550) -- 0:00:33
505000 -- (-766.674) (-773.387) (-770.619) [-765.682] * (-764.958) [-766.000] (-765.918) (-767.995) -- 0:00:33
Average standard deviation of split frequencies: 0.007220
505500 -- (-768.392) [-769.351] (-766.751) (-766.332) * [-767.458] (-766.552) (-769.686) (-769.609) -- 0:00:33
506000 -- (-768.218) (-770.541) [-771.880] (-767.907) * (-766.230) (-767.397) (-765.955) [-767.566] -- 0:00:33
506500 -- (-769.984) (-767.594) [-767.353] (-766.371) * (-767.239) (-767.316) [-766.253] (-767.157) -- 0:00:33
507000 -- (-765.839) (-766.779) (-768.001) [-766.850] * (-766.288) (-769.353) [-765.101] (-767.962) -- 0:00:33
507500 -- [-764.972] (-768.423) (-771.099) (-766.767) * (-766.154) (-772.120) [-765.167] (-769.358) -- 0:00:32
508000 -- [-765.144] (-765.559) (-766.940) (-765.230) * (-766.681) [-766.396] (-765.587) (-767.519) -- 0:00:32
508500 -- (-765.705) (-767.549) [-768.862] (-768.112) * (-767.623) [-766.504] (-765.613) (-767.660) -- 0:00:32
509000 -- (-765.842) (-767.797) [-765.872] (-765.667) * (-770.659) [-765.096] (-767.257) (-765.560) -- 0:00:32
509500 -- (-768.495) (-767.229) [-768.464] (-765.240) * (-773.286) (-765.804) [-765.410] (-767.124) -- 0:00:32
510000 -- (-768.776) (-768.455) (-766.370) [-767.864] * (-767.965) [-769.014] (-764.994) (-768.215) -- 0:00:32
Average standard deviation of split frequencies: 0.007731
510500 -- (-767.117) (-768.275) [-765.478] (-769.544) * (-766.363) [-768.233] (-766.814) (-765.870) -- 0:00:32
511000 -- (-768.057) (-766.206) [-768.354] (-767.281) * (-767.066) (-765.589) (-767.962) [-768.186] -- 0:00:32
511500 -- (-768.330) [-770.912] (-769.120) (-771.594) * (-766.415) (-766.371) [-764.644] (-766.849) -- 0:00:32
512000 -- (-768.889) [-771.561] (-766.143) (-768.071) * (-767.618) (-767.892) [-764.948] (-767.216) -- 0:00:32
512500 -- [-766.193] (-772.332) (-766.047) (-770.052) * (-767.962) (-766.480) (-766.661) [-766.015] -- 0:00:32
513000 -- [-765.094] (-768.795) (-767.981) (-766.987) * (-770.327) [-767.422] (-766.556) (-766.816) -- 0:00:32
513500 -- (-766.360) (-770.768) [-765.999] (-765.742) * (-769.685) (-766.860) (-768.491) [-766.845] -- 0:00:32
514000 -- [-767.187] (-769.776) (-766.722) (-766.370) * (-768.314) [-767.584] (-768.689) (-765.360) -- 0:00:32
514500 -- (-767.786) (-768.634) (-765.229) [-766.915] * (-765.796) [-767.259] (-766.281) (-768.408) -- 0:00:32
515000 -- (-766.476) (-768.828) [-766.938] (-765.347) * (-769.136) (-768.578) (-766.342) [-769.963] -- 0:00:32
Average standard deviation of split frequencies: 0.008383
515500 -- [-766.252] (-770.302) (-766.752) (-765.536) * (-765.811) (-765.503) [-767.146] (-766.702) -- 0:00:31
516000 -- (-766.237) [-766.472] (-765.081) (-766.101) * (-767.879) (-767.463) [-766.391] (-764.904) -- 0:00:31
516500 -- (-765.953) [-765.755] (-771.969) (-766.259) * (-766.645) (-768.789) (-765.951) [-765.979] -- 0:00:31
517000 -- [-765.615] (-765.191) (-768.931) (-767.891) * (-770.249) [-765.422] (-764.798) (-766.665) -- 0:00:31
517500 -- (-766.110) [-768.260] (-766.777) (-765.773) * [-765.276] (-768.000) (-768.183) (-768.221) -- 0:00:31
518000 -- [-765.548] (-765.703) (-766.725) (-767.014) * (-766.849) (-769.759) (-766.545) [-765.632] -- 0:00:31
518500 -- (-769.150) [-767.076] (-768.542) (-767.129) * (-764.952) (-769.073) (-767.125) [-765.097] -- 0:00:31
519000 -- (-769.194) (-766.852) [-765.944] (-765.965) * (-766.540) (-768.989) [-767.425] (-766.650) -- 0:00:31
519500 -- [-767.360] (-766.913) (-766.431) (-766.975) * (-768.498) (-767.734) (-769.586) [-768.657] -- 0:00:31
520000 -- (-767.000) [-767.664] (-765.424) (-768.679) * [-767.252] (-767.839) (-769.406) (-768.859) -- 0:00:31
Average standard deviation of split frequencies: 0.008601
520500 -- (-765.896) (-767.327) (-770.199) [-768.465] * (-768.206) (-766.294) (-767.111) [-764.966] -- 0:00:32
521000 -- (-767.320) (-766.644) [-767.234] (-766.811) * (-766.782) (-766.372) [-770.188] (-766.225) -- 0:00:32
521500 -- (-767.875) [-765.942] (-771.002) (-765.348) * (-767.525) (-766.203) [-768.453] (-767.985) -- 0:00:32
522000 -- (-768.339) (-766.371) (-766.675) [-766.666] * (-766.254) [-769.200] (-765.508) (-767.127) -- 0:00:32
522500 -- (-770.730) (-767.253) (-766.759) [-766.658] * (-766.215) (-768.383) [-765.249] (-766.596) -- 0:00:31
523000 -- (-768.909) [-767.044] (-767.871) (-766.776) * (-766.102) [-767.538] (-768.596) (-767.787) -- 0:00:31
523500 -- (-765.655) (-766.058) [-772.624] (-768.180) * (-766.501) (-772.898) (-767.746) [-765.527] -- 0:00:31
524000 -- (-765.818) (-765.020) (-767.424) [-766.068] * [-766.676] (-771.193) (-766.790) (-765.157) -- 0:00:31
524500 -- (-765.585) (-769.169) [-771.045] (-765.329) * (-770.493) (-772.763) [-765.741] (-768.202) -- 0:00:31
525000 -- [-766.094] (-766.707) (-766.197) (-765.406) * (-767.717) (-766.085) [-766.766] (-775.371) -- 0:00:31
Average standard deviation of split frequencies: 0.007898
525500 -- (-769.247) (-768.508) [-765.960] (-765.372) * [-767.667] (-768.693) (-766.569) (-768.467) -- 0:00:31
526000 -- (-766.865) (-766.303) [-765.807] (-765.967) * (-766.585) (-767.926) [-767.655] (-770.733) -- 0:00:31
526500 -- (-767.220) (-768.669) [-765.244] (-766.563) * (-768.321) (-767.763) (-765.058) [-766.995] -- 0:00:31
527000 -- (-768.015) (-767.241) (-765.311) [-766.098] * (-768.221) (-766.056) [-764.901] (-767.339) -- 0:00:31
527500 -- (-770.000) [-765.217] (-765.550) (-767.148) * (-771.384) (-766.402) [-764.633] (-768.540) -- 0:00:31
528000 -- (-766.527) (-767.290) [-767.206] (-770.237) * [-770.259] (-766.758) (-772.177) (-769.384) -- 0:00:31
528500 -- [-767.180] (-767.190) (-766.975) (-767.984) * [-770.257] (-766.101) (-766.412) (-769.965) -- 0:00:31
529000 -- (-767.072) [-766.412] (-769.041) (-768.333) * [-768.490] (-766.400) (-766.083) (-767.023) -- 0:00:31
529500 -- [-766.621] (-767.130) (-766.208) (-769.614) * [-766.087] (-765.060) (-773.074) (-765.752) -- 0:00:31
530000 -- [-766.561] (-768.037) (-768.492) (-766.739) * [-766.478] (-766.066) (-769.497) (-765.895) -- 0:00:31
Average standard deviation of split frequencies: 0.008439
530500 -- (-770.056) (-773.470) [-767.629] (-768.047) * (-765.234) (-766.155) [-766.949] (-770.277) -- 0:00:30
531000 -- [-765.593] (-765.559) (-766.349) (-767.058) * (-766.711) (-767.188) (-769.379) [-768.394] -- 0:00:30
531500 -- (-765.907) (-766.093) (-768.836) [-765.118] * (-767.509) [-768.253] (-768.736) (-766.984) -- 0:00:30
532000 -- (-764.988) (-768.117) (-767.179) [-765.364] * (-767.009) (-768.835) (-768.541) [-766.757] -- 0:00:30
532500 -- [-765.790] (-772.734) (-765.420) (-766.351) * (-765.782) [-766.201] (-769.644) (-767.073) -- 0:00:30
533000 -- (-768.873) (-766.671) [-764.855] (-768.304) * (-766.246) (-767.473) [-765.953] (-767.595) -- 0:00:30
533500 -- (-767.739) [-766.749] (-765.342) (-769.298) * [-766.603] (-765.422) (-765.758) (-767.929) -- 0:00:30
534000 -- (-771.509) (-765.507) [-766.977] (-769.746) * (-764.961) (-768.330) [-768.906] (-768.629) -- 0:00:30
534500 -- (-773.715) [-769.722] (-766.206) (-767.331) * (-768.283) (-766.021) (-766.745) [-766.118] -- 0:00:30
535000 -- (-766.635) (-766.752) [-766.331] (-766.020) * (-766.967) (-766.580) [-768.494] (-769.856) -- 0:00:30
Average standard deviation of split frequencies: 0.008190
535500 -- [-766.344] (-766.872) (-766.788) (-768.321) * (-766.701) [-765.720] (-768.593) (-765.506) -- 0:00:30
536000 -- [-765.291] (-765.710) (-769.317) (-770.190) * [-768.006] (-765.440) (-767.050) (-765.807) -- 0:00:30
536500 -- (-765.129) [-764.994] (-767.660) (-766.855) * (-765.974) (-767.263) (-765.723) [-766.120] -- 0:00:31
537000 -- (-764.926) (-765.480) (-768.144) [-764.874] * (-765.534) (-769.702) (-765.708) [-765.967] -- 0:00:31
537500 -- (-765.018) (-765.242) (-771.147) [-764.844] * [-766.580] (-768.294) (-766.109) (-768.192) -- 0:00:30
538000 -- (-766.604) (-766.898) (-768.767) [-768.009] * (-768.889) [-765.212] (-768.973) (-765.967) -- 0:00:30
538500 -- (-766.054) [-766.783] (-767.187) (-769.300) * (-769.124) (-768.561) [-766.767] (-765.847) -- 0:00:30
539000 -- (-767.418) (-766.328) (-766.888) [-768.137] * [-767.508] (-765.845) (-769.266) (-767.644) -- 0:00:30
539500 -- (-766.576) [-769.747] (-766.536) (-768.601) * [-767.606] (-765.322) (-768.124) (-764.501) -- 0:00:30
540000 -- (-765.287) (-773.036) [-768.545] (-769.105) * (-768.527) (-768.890) (-770.975) [-766.369] -- 0:00:30
Average standard deviation of split frequencies: 0.007357
540500 -- (-764.730) (-769.430) (-766.576) [-765.571] * (-766.621) (-766.904) [-771.195] (-768.670) -- 0:00:30
541000 -- (-765.230) (-767.676) [-766.655] (-766.153) * (-766.351) (-766.983) [-766.734] (-765.607) -- 0:00:30
541500 -- [-764.899] (-767.561) (-765.076) (-766.912) * (-765.320) [-765.324] (-765.752) (-766.457) -- 0:00:30
542000 -- (-767.624) (-770.186) (-766.239) [-764.943] * (-766.044) (-764.956) (-768.620) [-766.851] -- 0:00:30
542500 -- (-768.176) (-770.041) [-766.885] (-765.042) * (-767.831) (-765.604) [-771.337] (-766.128) -- 0:00:30
543000 -- (-767.794) [-767.977] (-768.942) (-765.514) * [-765.825] (-766.410) (-769.929) (-766.877) -- 0:00:30
543500 -- (-768.202) [-765.682] (-766.096) (-766.017) * (-765.927) (-765.914) [-767.248] (-772.494) -- 0:00:30
544000 -- [-766.329] (-768.164) (-767.434) (-767.784) * [-765.802] (-767.173) (-765.720) (-768.444) -- 0:00:30
544500 -- (-769.171) (-768.113) [-766.802] (-767.487) * (-766.395) (-765.902) (-767.113) [-765.559] -- 0:00:30
545000 -- (-766.210) (-771.096) [-770.380] (-766.115) * (-766.901) (-768.146) (-768.745) [-765.681] -- 0:00:30
Average standard deviation of split frequencies: 0.007824
545500 -- (-766.772) (-770.507) [-766.808] (-766.525) * (-766.076) [-767.131] (-771.193) (-765.192) -- 0:00:29
546000 -- [-766.868] (-766.660) (-765.539) (-765.537) * [-766.542] (-769.036) (-767.756) (-765.352) -- 0:00:29
546500 -- (-766.216) [-765.597] (-766.680) (-765.647) * (-769.698) (-771.244) (-769.004) [-766.530] -- 0:00:29
547000 -- (-767.515) (-768.931) [-766.903] (-768.619) * (-770.963) [-766.372] (-766.189) (-766.783) -- 0:00:29
547500 -- (-765.116) [-766.981] (-765.867) (-769.939) * (-769.286) [-765.898] (-765.613) (-765.637) -- 0:00:29
548000 -- (-765.250) [-766.034] (-767.356) (-771.468) * (-771.445) (-766.071) [-765.684] (-766.013) -- 0:00:29
548500 -- [-766.901] (-767.388) (-767.095) (-767.807) * (-767.827) (-768.615) [-765.622] (-773.523) -- 0:00:29
549000 -- (-765.776) (-766.256) [-767.933] (-766.812) * (-771.749) (-768.732) [-764.901] (-769.562) -- 0:00:29
549500 -- (-765.505) (-766.022) [-771.320] (-769.381) * [-769.112] (-766.626) (-765.283) (-767.936) -- 0:00:29
550000 -- (-766.218) [-766.133] (-773.259) (-766.721) * (-766.653) (-765.763) [-766.371] (-768.225) -- 0:00:29
Average standard deviation of split frequencies: 0.008400
550500 -- (-767.918) (-766.838) [-768.981] (-765.801) * (-764.985) [-767.554] (-766.811) (-769.376) -- 0:00:29
551000 -- (-767.105) [-768.588] (-767.116) (-765.749) * [-766.400] (-766.089) (-765.510) (-766.549) -- 0:00:29
551500 -- (-769.103) (-768.623) [-767.941] (-765.249) * (-766.773) (-767.278) (-769.884) [-767.364] -- 0:00:30
552000 -- (-765.605) [-768.681] (-766.646) (-765.399) * [-766.006] (-767.795) (-767.347) (-765.840) -- 0:00:30
552500 -- [-766.881] (-768.596) (-767.234) (-769.574) * [-769.940] (-766.851) (-767.477) (-765.680) -- 0:00:29
553000 -- (-765.422) [-768.061] (-766.277) (-765.442) * (-766.508) [-767.279] (-769.446) (-765.899) -- 0:00:29
553500 -- (-766.949) [-767.768] (-765.008) (-767.016) * (-766.068) (-767.997) [-768.453] (-765.576) -- 0:00:29
554000 -- (-767.180) [-766.053] (-772.031) (-769.739) * [-766.698] (-765.639) (-768.199) (-765.387) -- 0:00:29
554500 -- (-769.687) (-767.065) (-767.828) [-767.444] * (-765.044) (-766.611) [-766.613] (-770.025) -- 0:00:29
555000 -- (-773.493) [-768.308] (-767.068) (-766.018) * (-766.657) [-764.570] (-766.044) (-766.460) -- 0:00:29
Average standard deviation of split frequencies: 0.007896
555500 -- (-767.801) [-765.886] (-765.918) (-765.117) * (-768.900) (-766.464) (-765.624) [-765.885] -- 0:00:29
556000 -- (-767.219) (-769.292) (-768.877) [-766.039] * [-774.450] (-768.479) (-766.161) (-765.639) -- 0:00:29
556500 -- [-770.874] (-764.886) (-767.203) (-767.911) * (-769.189) (-769.306) (-770.950) [-765.001] -- 0:00:29
557000 -- (-765.436) (-764.899) (-766.625) [-767.782] * (-765.801) (-767.466) [-767.202] (-765.155) -- 0:00:29
557500 -- (-768.220) (-768.795) [-766.975] (-767.526) * (-766.523) (-767.115) (-768.060) [-765.363] -- 0:00:29
558000 -- (-766.737) (-769.069) (-767.100) [-768.255] * (-766.532) (-766.520) [-766.847] (-768.583) -- 0:00:29
558500 -- [-769.030] (-766.673) (-771.059) (-767.941) * (-769.677) (-765.858) (-766.945) [-765.380] -- 0:00:29
559000 -- (-769.229) [-766.351] (-772.094) (-768.065) * (-765.406) [-765.904] (-766.877) (-766.266) -- 0:00:29
559500 -- (-766.553) (-768.978) [-770.080] (-766.370) * (-765.215) [-766.518] (-765.320) (-766.541) -- 0:00:29
560000 -- (-767.879) [-768.363] (-765.315) (-765.810) * (-766.457) (-768.017) (-765.320) [-769.428] -- 0:00:29
Average standard deviation of split frequencies: 0.008460
560500 -- (-767.454) (-771.998) (-768.443) [-766.340] * (-764.975) [-766.662] (-765.553) (-766.264) -- 0:00:29
561000 -- (-771.169) (-765.346) [-768.796] (-769.842) * (-765.226) (-767.111) [-768.735] (-765.956) -- 0:00:28
561500 -- [-767.463] (-767.392) (-766.573) (-770.059) * (-766.485) [-768.133] (-765.612) (-768.172) -- 0:00:28
562000 -- [-764.758] (-766.508) (-766.597) (-767.068) * (-767.896) (-767.006) (-766.824) [-767.597] -- 0:00:28
562500 -- (-765.440) (-765.110) (-765.777) [-767.420] * (-765.975) (-767.920) (-766.745) [-768.268] -- 0:00:28
563000 -- (-766.892) (-766.558) [-767.099] (-769.311) * (-769.872) (-766.743) (-767.036) [-765.344] -- 0:00:28
563500 -- (-766.806) [-765.862] (-766.050) (-768.784) * [-767.544] (-766.981) (-765.843) (-765.571) -- 0:00:28
564000 -- (-767.467) (-771.287) (-765.694) [-766.165] * (-765.810) (-771.611) (-765.107) [-769.417] -- 0:00:28
564500 -- [-765.395] (-768.375) (-767.846) (-769.101) * (-765.880) (-772.395) [-765.533] (-767.241) -- 0:00:28
565000 -- (-766.078) (-768.841) (-767.207) [-768.105] * (-764.589) (-767.678) [-767.968] (-770.907) -- 0:00:28
Average standard deviation of split frequencies: 0.008770
565500 -- (-767.107) (-766.093) (-766.245) [-766.624] * (-767.941) (-765.170) (-766.116) [-768.040] -- 0:00:28
566000 -- (-772.354) (-770.487) (-766.891) [-766.728] * [-766.101] (-765.806) (-766.355) (-765.904) -- 0:00:28
566500 -- (-767.167) (-765.920) (-767.458) [-766.149] * (-765.036) (-766.113) (-764.992) [-768.905] -- 0:00:28
567000 -- [-768.432] (-766.828) (-766.680) (-766.375) * [-765.281] (-767.336) (-767.591) (-767.915) -- 0:00:29
567500 -- (-771.403) (-770.106) [-766.169] (-770.114) * [-765.724] (-767.773) (-767.534) (-768.377) -- 0:00:28
568000 -- [-773.418] (-768.039) (-766.755) (-766.097) * (-768.077) [-767.163] (-769.200) (-771.217) -- 0:00:28
568500 -- (-769.465) [-767.739] (-768.206) (-770.334) * (-767.985) (-769.195) [-766.308] (-766.685) -- 0:00:28
569000 -- (-768.658) (-766.689) [-767.452] (-769.565) * (-767.928) (-770.363) [-765.905] (-767.229) -- 0:00:28
569500 -- (-768.576) [-766.544] (-767.881) (-768.089) * (-770.184) [-768.543] (-765.809) (-767.716) -- 0:00:28
570000 -- (-766.316) (-765.690) (-767.275) [-765.364] * (-768.462) [-768.137] (-765.700) (-766.755) -- 0:00:28
Average standard deviation of split frequencies: 0.008892
570500 -- [-766.870] (-765.488) (-767.384) (-767.013) * (-767.276) [-769.351] (-768.461) (-766.816) -- 0:00:28
571000 -- [-765.683] (-767.011) (-766.902) (-766.035) * [-768.631] (-766.149) (-766.186) (-764.957) -- 0:00:28
571500 -- [-767.453] (-770.634) (-767.157) (-765.334) * [-765.603] (-773.850) (-766.702) (-768.329) -- 0:00:28
572000 -- (-768.767) [-768.846] (-768.030) (-764.618) * [-768.247] (-768.007) (-768.983) (-768.277) -- 0:00:28
572500 -- (-771.271) (-766.670) [-767.045] (-764.497) * (-767.389) [-766.052] (-772.083) (-767.149) -- 0:00:28
573000 -- (-768.492) (-766.346) [-769.254] (-766.067) * (-765.443) (-769.016) [-764.529] (-767.829) -- 0:00:28
573500 -- [-766.348] (-767.364) (-766.730) (-766.406) * [-770.108] (-769.518) (-765.282) (-766.312) -- 0:00:28
574000 -- [-767.909] (-765.740) (-766.750) (-769.511) * [-769.973] (-766.181) (-765.922) (-766.890) -- 0:00:28
574500 -- (-766.628) (-766.201) [-765.725] (-768.650) * (-768.390) [-766.433] (-769.168) (-770.325) -- 0:00:28
575000 -- (-766.686) [-764.937] (-765.683) (-766.268) * (-766.805) [-765.894] (-764.758) (-768.742) -- 0:00:28
Average standard deviation of split frequencies: 0.008858
575500 -- (-765.081) [-766.498] (-765.514) (-766.535) * (-766.274) [-766.615] (-767.424) (-767.680) -- 0:00:28
576000 -- (-768.387) [-768.278] (-769.216) (-767.450) * (-766.676) (-768.208) (-771.148) [-768.019] -- 0:00:27
576500 -- (-767.993) (-765.658) (-768.115) [-767.702] * (-767.297) (-768.275) [-768.031] (-765.953) -- 0:00:27
577000 -- (-769.062) (-767.064) [-766.564] (-767.982) * [-768.044] (-765.800) (-771.001) (-767.152) -- 0:00:27
577500 -- (-765.140) (-772.051) [-765.697] (-767.295) * (-768.063) (-765.908) (-767.384) [-770.048] -- 0:00:27
578000 -- (-765.715) [-768.823] (-766.452) (-767.842) * (-766.312) [-766.529] (-767.214) (-768.656) -- 0:00:27
578500 -- [-765.436] (-768.737) (-765.105) (-768.016) * [-764.620] (-765.574) (-769.802) (-767.234) -- 0:00:27
579000 -- (-765.833) (-766.779) (-765.728) [-771.764] * (-765.183) [-765.168] (-776.866) (-767.793) -- 0:00:27
579500 -- [-765.831] (-766.511) (-768.860) (-769.297) * (-767.235) (-764.991) [-767.171] (-765.806) -- 0:00:27
580000 -- [-766.029] (-768.448) (-766.904) (-772.361) * (-765.505) (-766.187) (-767.171) [-765.860] -- 0:00:27
Average standard deviation of split frequencies: 0.008727
580500 -- [-768.848] (-765.956) (-764.910) (-767.609) * (-765.505) (-770.523) (-766.374) [-767.409] -- 0:00:27
581000 -- (-767.537) (-768.610) (-770.492) [-768.473] * (-768.214) (-768.472) [-766.147] (-767.934) -- 0:00:27
581500 -- (-766.565) [-764.721] (-771.536) (-767.862) * [-767.052] (-767.330) (-765.787) (-768.434) -- 0:00:27
582000 -- (-765.066) [-765.459] (-766.001) (-767.542) * (-767.504) [-766.625] (-764.580) (-766.152) -- 0:00:28
582500 -- (-766.643) (-766.878) (-768.792) [-767.732] * [-766.137] (-774.654) (-764.891) (-771.390) -- 0:00:27
583000 -- (-766.448) [-765.684] (-767.116) (-768.111) * (-767.407) [-771.534] (-764.794) (-770.817) -- 0:00:27
583500 -- [-765.145] (-766.589) (-768.569) (-765.967) * (-769.379) [-766.417] (-766.256) (-768.140) -- 0:00:27
584000 -- (-765.963) (-768.082) (-767.119) [-765.876] * (-764.773) (-767.813) (-767.130) [-765.419] -- 0:00:27
584500 -- (-768.157) [-765.418] (-767.032) (-768.429) * (-769.169) (-768.978) (-766.564) [-765.367] -- 0:00:27
585000 -- (-765.673) (-765.536) [-771.485] (-766.564) * (-771.234) (-765.950) (-767.183) [-766.962] -- 0:00:27
Average standard deviation of split frequencies: 0.008470
585500 -- (-767.529) (-765.306) (-769.418) [-765.881] * (-768.717) (-765.838) (-766.540) [-766.859] -- 0:00:27
586000 -- (-768.860) (-765.850) [-768.291] (-766.001) * (-767.203) (-766.481) [-766.129] (-767.239) -- 0:00:27
586500 -- (-766.562) (-765.752) (-768.561) [-765.070] * (-768.369) [-766.481] (-765.971) (-766.367) -- 0:00:27
587000 -- (-765.025) (-764.938) [-768.331] (-766.494) * (-767.779) (-765.638) [-765.418] (-767.218) -- 0:00:27
587500 -- [-767.642] (-764.935) (-769.368) (-770.119) * (-766.608) [-765.051] (-768.539) (-767.090) -- 0:00:27
588000 -- (-766.669) (-767.875) [-767.270] (-765.160) * (-766.057) (-767.286) (-766.584) [-765.887] -- 0:00:27
588500 -- (-766.718) (-768.928) [-765.230] (-764.660) * (-765.418) [-765.753] (-767.520) (-768.128) -- 0:00:27
589000 -- [-766.234] (-766.615) (-767.539) (-765.296) * (-768.488) (-765.552) (-767.461) [-766.385] -- 0:00:27
589500 -- [-766.388] (-767.780) (-766.279) (-765.104) * (-768.645) (-770.536) [-769.050] (-765.334) -- 0:00:27
590000 -- (-765.813) (-766.117) (-765.004) [-766.378] * [-765.845] (-769.747) (-770.044) (-766.574) -- 0:00:27
Average standard deviation of split frequencies: 0.008829
590500 -- (-764.862) (-765.207) (-765.527) [-767.003] * (-766.376) (-769.373) (-770.773) [-766.297] -- 0:00:27
591000 -- [-765.892] (-765.521) (-765.246) (-768.054) * (-767.594) (-767.385) [-765.589] (-766.784) -- 0:00:26
591500 -- (-765.054) (-765.302) [-770.259] (-768.766) * [-765.192] (-767.606) (-764.789) (-768.142) -- 0:00:26
592000 -- (-766.673) (-767.182) [-766.604] (-768.933) * (-767.595) [-768.165] (-768.913) (-766.985) -- 0:00:26
592500 -- (-766.579) [-765.878] (-768.730) (-767.656) * (-767.451) [-767.424] (-765.503) (-765.806) -- 0:00:26
593000 -- (-767.032) [-767.711] (-768.150) (-767.328) * (-767.203) (-767.920) (-768.168) [-764.732] -- 0:00:26
593500 -- [-764.612] (-765.974) (-770.253) (-766.903) * (-767.603) (-764.942) [-769.322] (-765.725) -- 0:00:26
594000 -- [-764.945] (-768.346) (-768.817) (-764.987) * (-765.107) (-766.686) [-770.292] (-764.830) -- 0:00:26
594500 -- (-765.647) (-765.814) [-764.888] (-766.938) * (-765.880) (-767.504) (-767.613) [-765.312] -- 0:00:26
595000 -- [-765.177] (-768.676) (-767.788) (-768.102) * (-766.893) (-767.109) [-769.068] (-766.301) -- 0:00:26
Average standard deviation of split frequencies: 0.008602
595500 -- [-765.389] (-766.587) (-765.401) (-766.087) * (-764.716) (-765.099) (-767.273) [-765.353] -- 0:00:26
596000 -- [-767.024] (-767.498) (-766.387) (-766.801) * (-772.913) (-765.116) (-767.574) [-767.700] -- 0:00:26
596500 -- (-766.357) (-766.830) (-765.415) [-766.542] * (-768.053) (-765.083) (-769.292) [-765.018] -- 0:00:26
597000 -- (-770.623) (-766.108) [-764.980] (-769.001) * (-767.539) [-765.120] (-770.439) (-764.998) -- 0:00:26
597500 -- (-766.915) [-765.593] (-770.597) (-765.246) * (-770.723) (-767.972) [-765.256] (-765.115) -- 0:00:26
598000 -- (-765.103) (-766.609) (-766.548) [-769.478] * (-766.251) [-765.232] (-766.516) (-765.790) -- 0:00:26
598500 -- (-769.804) (-765.742) (-768.526) [-766.275] * (-765.591) (-766.707) [-769.633] (-766.243) -- 0:00:26
599000 -- (-768.040) (-765.852) (-766.853) [-766.994] * (-767.666) (-765.334) (-766.658) [-765.262] -- 0:00:26
599500 -- (-765.740) (-765.028) [-766.705] (-767.514) * (-773.301) (-765.938) [-772.395] (-764.697) -- 0:00:26
600000 -- [-767.463] (-767.970) (-770.828) (-766.005) * (-773.120) (-766.312) [-769.443] (-768.841) -- 0:00:26
Average standard deviation of split frequencies: 0.008731
600500 -- (-767.057) (-769.231) [-765.876] (-767.452) * (-768.098) (-765.926) (-770.883) [-766.414] -- 0:00:26
601000 -- (-766.510) (-765.578) [-765.112] (-766.494) * (-767.115) [-765.652] (-773.380) (-765.538) -- 0:00:26
601500 -- (-767.565) [-768.308] (-768.782) (-766.254) * [-767.045] (-767.265) (-772.148) (-767.606) -- 0:00:26
602000 -- (-768.940) (-767.198) [-765.986] (-766.543) * (-765.882) (-768.635) (-766.057) [-767.220] -- 0:00:26
602500 -- (-768.046) (-771.592) (-766.512) [-766.948] * [-767.876] (-765.961) (-767.375) (-771.220) -- 0:00:26
603000 -- [-765.996] (-771.119) (-767.778) (-767.599) * (-768.846) (-765.470) (-766.792) [-765.523] -- 0:00:26
603500 -- (-768.686) [-766.357] (-765.719) (-766.807) * (-766.723) [-766.969] (-766.785) (-766.406) -- 0:00:26
604000 -- [-768.356] (-768.313) (-767.391) (-770.250) * (-765.615) (-767.629) [-767.531] (-768.079) -- 0:00:26
604500 -- (-766.952) (-770.098) [-766.110] (-768.375) * (-768.721) [-765.535] (-769.456) (-767.581) -- 0:00:26
605000 -- (-767.753) (-765.672) (-766.109) [-769.031] * (-766.124) (-766.557) [-765.714] (-765.441) -- 0:00:26
Average standard deviation of split frequencies: 0.008328
605500 -- (-769.477) (-765.159) [-767.533] (-766.412) * (-768.987) (-767.961) (-765.858) [-768.048] -- 0:00:26
606000 -- (-766.096) (-766.253) [-767.925] (-767.776) * (-768.093) (-768.740) [-766.902] (-768.114) -- 0:00:26
606500 -- [-766.295] (-766.039) (-767.054) (-765.631) * (-767.886) (-768.757) [-765.823] (-766.572) -- 0:00:25
607000 -- (-765.800) (-764.659) (-765.984) [-764.647] * (-767.268) (-767.293) [-767.148] (-766.927) -- 0:00:25
607500 -- (-765.633) (-766.266) (-765.232) [-765.397] * (-767.404) (-766.952) (-768.568) [-766.580] -- 0:00:25
608000 -- (-769.180) (-766.101) (-764.895) [-769.493] * [-765.033] (-767.379) (-768.497) (-771.108) -- 0:00:25
608500 -- (-765.974) [-769.536] (-765.369) (-765.574) * (-765.442) [-766.983] (-769.005) (-766.419) -- 0:00:25
609000 -- (-766.990) (-770.020) [-768.131] (-766.067) * (-765.298) (-767.508) (-765.108) [-768.455] -- 0:00:25
609500 -- (-766.722) [-765.922] (-767.344) (-765.919) * [-765.790] (-765.551) (-766.917) (-766.622) -- 0:00:25
610000 -- (-765.935) (-771.339) (-765.595) [-765.461] * (-767.021) [-767.776] (-766.468) (-767.291) -- 0:00:25
Average standard deviation of split frequencies: 0.008446
610500 -- [-765.806] (-766.833) (-765.612) (-768.763) * (-770.737) [-767.374] (-764.720) (-766.268) -- 0:00:25
611000 -- (-769.032) [-764.677] (-768.823) (-765.358) * (-771.794) (-773.360) (-765.043) [-770.122] -- 0:00:25
611500 -- (-766.568) [-764.819] (-766.766) (-768.902) * (-766.464) (-773.213) [-765.370] (-766.691) -- 0:00:25
612000 -- (-766.990) (-765.686) [-767.971] (-768.687) * (-765.976) (-772.076) (-766.065) [-765.574] -- 0:00:25
612500 -- (-766.856) (-767.927) [-768.396] (-765.849) * [-769.249] (-775.665) (-767.473) (-767.645) -- 0:00:25
613000 -- (-766.407) (-765.883) (-767.947) [-766.595] * (-766.401) (-769.002) (-766.289) [-764.944] -- 0:00:25
613500 -- (-768.767) (-769.174) [-766.838] (-765.884) * (-768.857) (-767.271) (-765.478) [-766.460] -- 0:00:25
614000 -- (-767.689) [-767.850] (-767.452) (-770.098) * (-765.512) (-765.674) (-765.758) [-765.625] -- 0:00:25
614500 -- (-767.635) [-766.113] (-765.416) (-772.115) * [-768.385] (-765.587) (-767.756) (-768.021) -- 0:00:25
615000 -- (-768.477) (-769.408) [-765.977] (-768.079) * [-767.038] (-771.247) (-765.388) (-767.755) -- 0:00:25
Average standard deviation of split frequencies: 0.008463
615500 -- (-766.455) (-768.333) [-764.469] (-766.266) * [-765.725] (-767.165) (-772.109) (-767.726) -- 0:00:25
616000 -- [-766.075] (-765.480) (-767.836) (-767.151) * (-766.250) (-766.819) (-768.593) [-765.342] -- 0:00:25
616500 -- (-766.101) [-766.955] (-765.394) (-766.103) * (-765.523) (-768.283) (-765.683) [-766.243] -- 0:00:25
617000 -- (-765.574) (-767.536) [-768.981] (-765.347) * [-765.219] (-765.963) (-765.619) (-765.249) -- 0:00:25
617500 -- [-766.610] (-766.192) (-766.957) (-765.359) * (-764.937) (-765.707) [-767.070] (-765.305) -- 0:00:25
618000 -- (-768.707) (-770.291) (-769.954) [-765.307] * (-767.198) [-765.333] (-766.490) (-765.979) -- 0:00:25
618500 -- (-769.472) [-767.931] (-767.094) (-765.716) * (-765.565) (-767.432) [-766.120] (-767.366) -- 0:00:25
619000 -- (-766.770) (-769.413) [-765.279] (-767.085) * (-770.992) (-771.430) [-765.804] (-764.641) -- 0:00:25
619500 -- (-766.395) [-764.709] (-766.418) (-769.815) * (-768.653) (-768.716) (-768.347) [-765.955] -- 0:00:25
620000 -- (-767.236) (-765.830) [-765.436] (-766.794) * (-766.552) [-766.039] (-766.327) (-766.974) -- 0:00:25
Average standard deviation of split frequencies: 0.008757
620500 -- (-766.176) [-768.534] (-767.599) (-765.809) * [-769.365] (-767.359) (-764.730) (-768.628) -- 0:00:25
621000 -- (-769.348) [-767.135] (-766.157) (-766.030) * (-766.015) (-765.797) [-764.995] (-771.734) -- 0:00:25
621500 -- (-765.734) (-767.069) (-770.715) [-766.839] * (-765.970) (-766.523) [-765.505] (-767.874) -- 0:00:24
622000 -- (-765.673) (-765.665) (-771.046) [-766.563] * (-766.814) (-766.227) (-766.818) [-766.760] -- 0:00:24
622500 -- (-767.193) (-768.656) (-771.505) [-765.502] * (-771.910) [-767.454] (-767.854) (-765.120) -- 0:00:24
623000 -- (-770.021) [-768.777] (-767.248) (-765.314) * (-765.669) (-765.256) [-767.580] (-767.964) -- 0:00:24
623500 -- (-770.433) [-765.763] (-767.690) (-766.189) * (-767.594) (-767.202) (-766.598) [-770.715] -- 0:00:24
624000 -- (-766.617) (-764.859) (-769.721) [-767.582] * (-770.500) (-765.241) (-766.591) [-765.113] -- 0:00:24
624500 -- [-766.879] (-766.154) (-768.913) (-767.431) * [-767.424] (-767.860) (-765.209) (-767.293) -- 0:00:24
625000 -- (-766.562) [-767.088] (-773.057) (-766.841) * (-765.986) (-766.448) [-766.420] (-766.594) -- 0:00:24
Average standard deviation of split frequencies: 0.008682
625500 -- (-764.948) [-766.950] (-766.737) (-766.528) * (-766.370) (-766.248) [-768.304] (-766.439) -- 0:00:24
626000 -- (-767.991) (-768.310) (-767.901) [-766.539] * [-767.318] (-766.828) (-766.576) (-766.822) -- 0:00:24
626500 -- (-769.070) (-768.336) [-769.186] (-768.376) * (-769.793) (-772.629) (-767.945) [-767.610] -- 0:00:24
627000 -- [-767.194] (-769.260) (-768.023) (-771.091) * (-766.142) (-770.352) (-765.860) [-768.451] -- 0:00:24
627500 -- (-766.809) (-771.007) (-767.871) [-766.222] * [-765.138] (-769.496) (-766.771) (-769.358) -- 0:00:24
628000 -- [-766.185] (-768.204) (-767.571) (-765.988) * (-767.232) (-768.410) (-765.758) [-767.320] -- 0:00:24
628500 -- (-766.722) (-768.473) (-767.016) [-765.062] * (-767.494) (-770.897) (-764.711) [-766.668] -- 0:00:24
629000 -- (-764.797) (-769.946) [-765.505] (-765.683) * (-768.867) [-764.836] (-765.416) (-766.283) -- 0:00:24
629500 -- (-765.223) (-768.057) (-766.286) [-765.963] * (-768.526) [-765.210] (-766.236) (-769.932) -- 0:00:24
630000 -- (-766.491) [-767.394] (-766.024) (-765.537) * (-766.777) (-765.166) [-767.009] (-767.190) -- 0:00:24
Average standard deviation of split frequencies: 0.008926
630500 -- (-765.392) (-768.507) (-765.988) [-765.491] * [-770.363] (-765.278) (-766.623) (-765.599) -- 0:00:24
631000 -- (-765.079) (-767.172) (-771.686) [-766.964] * (-769.436) (-769.392) (-767.081) [-766.545] -- 0:00:24
631500 -- (-766.465) [-765.836] (-766.764) (-767.648) * (-768.268) [-766.630] (-765.879) (-766.249) -- 0:00:24
632000 -- (-765.354) (-770.757) (-765.718) [-770.602] * [-767.454] (-766.288) (-766.260) (-769.819) -- 0:00:24
632500 -- (-766.995) (-768.954) [-766.001] (-766.975) * (-769.445) (-766.659) [-765.853] (-768.523) -- 0:00:24
633000 -- [-767.140] (-766.238) (-767.798) (-769.135) * (-768.645) [-770.649] (-765.276) (-766.932) -- 0:00:24
633500 -- (-765.252) (-766.067) [-766.903] (-766.922) * [-769.043] (-767.701) (-772.125) (-766.994) -- 0:00:24
634000 -- (-767.920) (-765.688) [-768.328] (-768.532) * [-765.101] (-768.866) (-774.857) (-765.292) -- 0:00:24
634500 -- [-767.047] (-768.060) (-767.825) (-768.021) * [-765.514] (-766.488) (-765.932) (-764.720) -- 0:00:24
635000 -- [-766.284] (-768.327) (-769.041) (-770.678) * [-767.426] (-765.641) (-772.455) (-767.652) -- 0:00:24
Average standard deviation of split frequencies: 0.008851
635500 -- (-766.732) (-766.891) [-767.333] (-771.977) * (-767.445) (-768.713) [-766.742] (-769.441) -- 0:00:24
636000 -- (-765.329) (-766.970) (-768.267) [-769.992] * (-769.545) (-766.504) (-768.593) [-767.202] -- 0:00:24
636500 -- (-767.320) (-765.679) [-765.784] (-765.090) * (-766.879) [-765.364] (-766.012) (-768.104) -- 0:00:23
637000 -- [-765.136] (-770.971) (-766.139) (-766.688) * (-771.407) [-767.383] (-764.823) (-768.270) -- 0:00:23
637500 -- [-771.231] (-764.969) (-768.778) (-767.474) * [-766.911] (-766.195) (-767.130) (-765.872) -- 0:00:23
638000 -- (-768.853) (-767.322) (-769.688) [-765.844] * (-770.437) (-767.535) (-765.806) [-764.785] -- 0:00:23
638500 -- (-767.718) (-767.737) (-768.770) [-767.516] * (-766.296) [-764.956] (-766.226) (-764.892) -- 0:00:23
639000 -- (-768.616) [-767.592] (-766.071) (-766.383) * (-766.159) (-768.954) [-767.258] (-765.745) -- 0:00:23
639500 -- (-766.783) (-767.000) [-769.370] (-764.920) * (-770.481) (-765.319) [-768.655] (-771.250) -- 0:00:23
640000 -- (-766.728) [-765.853] (-769.263) (-766.288) * (-764.944) (-769.265) (-765.778) [-769.870] -- 0:00:23
Average standard deviation of split frequencies: 0.008692
640500 -- (-771.506) [-766.855] (-767.268) (-771.169) * [-765.051] (-766.686) (-765.874) (-766.038) -- 0:00:23
641000 -- [-765.603] (-766.727) (-765.520) (-767.911) * (-769.063) [-767.006] (-764.844) (-767.620) -- 0:00:23
641500 -- (-765.541) (-766.186) [-767.074] (-765.789) * [-766.113] (-764.737) (-767.198) (-768.609) -- 0:00:23
642000 -- (-766.355) (-770.292) [-767.272] (-768.709) * [-766.729] (-766.987) (-770.882) (-768.063) -- 0:00:23
642500 -- [-766.663] (-766.572) (-767.415) (-767.221) * [-767.090] (-767.687) (-766.496) (-767.784) -- 0:00:23
643000 -- [-766.453] (-766.868) (-765.074) (-767.384) * (-767.402) [-765.601] (-767.002) (-771.034) -- 0:00:23
643500 -- [-769.603] (-767.984) (-766.332) (-768.496) * (-765.946) (-768.150) [-768.878] (-770.324) -- 0:00:23
644000 -- (-768.231) [-767.003] (-766.440) (-766.478) * (-765.432) (-766.223) [-768.613] (-765.724) -- 0:00:23
644500 -- (-767.557) (-766.873) (-766.446) [-766.603] * (-765.156) [-767.146] (-769.112) (-769.124) -- 0:00:23
645000 -- (-765.565) [-767.251] (-766.392) (-764.731) * [-765.884] (-766.500) (-771.381) (-765.612) -- 0:00:23
Average standard deviation of split frequencies: 0.008456
645500 -- (-765.590) (-769.624) [-766.596] (-773.364) * [-765.800] (-765.935) (-765.811) (-767.457) -- 0:00:23
646000 -- (-765.451) (-769.532) (-768.215) [-766.824] * [-771.647] (-765.584) (-765.286) (-769.447) -- 0:00:23
646500 -- (-766.565) (-767.694) (-765.917) [-765.769] * (-766.038) (-765.628) [-768.523] (-770.539) -- 0:00:23
647000 -- (-766.837) (-764.759) [-767.663] (-767.665) * (-767.150) [-765.603] (-765.374) (-768.490) -- 0:00:23
647500 -- [-766.544] (-767.956) (-767.470) (-769.763) * (-765.465) [-765.833] (-765.145) (-765.468) -- 0:00:23
648000 -- [-766.656] (-768.319) (-767.548) (-766.542) * (-765.096) [-767.427] (-767.513) (-765.099) -- 0:00:23
648500 -- [-764.732] (-771.753) (-768.504) (-767.375) * (-764.806) (-768.282) (-767.892) [-765.548] -- 0:00:23
649000 -- (-765.272) [-770.083] (-773.502) (-767.375) * (-766.464) (-765.385) [-768.098] (-766.357) -- 0:00:23
649500 -- (-765.985) [-766.222] (-772.258) (-765.784) * (-768.822) (-765.758) (-765.690) [-767.460] -- 0:00:23
650000 -- (-767.090) (-766.810) (-770.744) [-765.939] * (-770.673) [-765.093] (-765.372) (-767.786) -- 0:00:23
Average standard deviation of split frequencies: 0.008694
650500 -- [-766.158] (-768.376) (-766.333) (-769.708) * (-765.622) (-768.252) (-769.317) [-767.569] -- 0:00:23
651000 -- [-765.201] (-768.157) (-766.419) (-769.046) * [-765.723] (-770.802) (-771.053) (-765.408) -- 0:00:23
651500 -- (-768.421) (-767.073) [-770.136] (-767.509) * (-766.179) [-768.116] (-767.347) (-768.154) -- 0:00:23
652000 -- (-767.781) (-766.217) [-767.473] (-767.495) * (-765.737) (-767.117) (-766.922) [-766.309] -- 0:00:22
652500 -- (-765.827) (-768.933) [-765.735] (-766.094) * (-767.383) [-766.740] (-768.097) (-766.497) -- 0:00:22
653000 -- (-767.510) (-768.526) (-766.474) [-765.285] * (-765.475) [-766.330] (-769.016) (-765.870) -- 0:00:22
653500 -- (-766.457) (-768.725) [-766.667] (-766.976) * (-765.048) [-771.068] (-767.753) (-765.661) -- 0:00:22
654000 -- [-766.212] (-767.489) (-765.744) (-767.378) * [-765.497] (-767.417) (-767.309) (-765.793) -- 0:00:22
654500 -- (-765.677) (-764.873) [-770.348] (-767.599) * (-766.398) [-766.111] (-767.137) (-766.013) -- 0:00:22
655000 -- (-766.043) [-767.293] (-771.003) (-769.141) * (-765.042) [-767.928] (-768.085) (-767.100) -- 0:00:22
Average standard deviation of split frequencies: 0.008412
655500 -- (-769.808) (-765.812) [-767.780] (-772.357) * (-765.626) [-766.190] (-766.909) (-770.401) -- 0:00:22
656000 -- [-765.361] (-768.271) (-767.079) (-768.982) * (-768.706) (-769.942) (-769.599) [-767.294] -- 0:00:22
656500 -- (-766.703) (-768.233) (-765.737) [-764.815] * (-769.071) [-768.008] (-766.844) (-767.954) -- 0:00:22
657000 -- (-766.312) (-767.699) (-767.791) [-765.057] * (-768.555) (-766.157) [-765.536] (-766.845) -- 0:00:22
657500 -- (-766.533) [-764.986] (-768.391) (-765.044) * (-766.754) [-766.923] (-766.157) (-767.937) -- 0:00:22
658000 -- [-765.783] (-774.146) (-766.590) (-765.639) * [-766.535] (-767.549) (-766.771) (-767.646) -- 0:00:22
658500 -- (-765.890) [-768.320] (-771.054) (-767.897) * (-765.744) [-768.542] (-767.671) (-767.098) -- 0:00:22
659000 -- [-766.205] (-767.257) (-766.954) (-770.157) * (-772.913) [-766.388] (-767.772) (-767.302) -- 0:00:22
659500 -- (-767.694) [-766.495] (-768.157) (-768.118) * [-769.564] (-765.934) (-774.347) (-768.587) -- 0:00:22
660000 -- (-767.600) [-768.879] (-769.363) (-766.691) * (-771.829) (-765.300) (-766.803) [-767.084] -- 0:00:22
Average standard deviation of split frequencies: 0.007723
660500 -- [-766.073] (-765.856) (-768.664) (-766.270) * (-767.908) [-767.154] (-766.862) (-768.329) -- 0:00:22
661000 -- [-766.570] (-767.946) (-766.218) (-767.244) * [-765.757] (-765.253) (-768.618) (-767.102) -- 0:00:22
661500 -- (-765.148) (-770.460) [-765.434] (-764.899) * [-770.974] (-766.944) (-766.397) (-771.090) -- 0:00:22
662000 -- (-765.599) (-767.908) (-769.751) [-766.362] * [-768.531] (-768.919) (-769.053) (-768.750) -- 0:00:22
662500 -- [-766.992] (-766.680) (-767.439) (-766.444) * [-766.417] (-765.773) (-766.389) (-765.095) -- 0:00:22
663000 -- (-766.441) [-765.874] (-766.549) (-766.359) * [-765.867] (-765.575) (-768.724) (-767.517) -- 0:00:22
663500 -- [-767.057] (-767.364) (-771.470) (-767.434) * [-768.251] (-768.529) (-766.604) (-766.168) -- 0:00:22
664000 -- [-766.263] (-766.658) (-768.096) (-767.775) * [-768.076] (-769.068) (-768.946) (-766.773) -- 0:00:22
664500 -- (-766.961) [-766.462] (-766.611) (-766.435) * (-765.455) (-766.945) (-766.117) [-766.712] -- 0:00:22
665000 -- (-766.438) (-765.428) (-767.380) [-766.080] * (-766.599) (-766.235) (-768.170) [-767.709] -- 0:00:22
Average standard deviation of split frequencies: 0.007536
665500 -- (-766.883) [-766.630] (-767.200) (-764.870) * (-766.269) (-768.261) [-766.821] (-768.309) -- 0:00:22
666000 -- (-771.086) (-771.569) (-767.935) [-766.362] * (-766.329) (-767.352) (-765.377) [-769.964] -- 0:00:22
666500 -- (-765.901) [-768.143] (-769.551) (-765.880) * (-766.105) (-766.841) (-778.522) [-768.641] -- 0:00:22
667000 -- [-766.937] (-767.415) (-771.151) (-765.926) * (-766.860) (-768.131) (-769.809) [-764.621] -- 0:00:21
667500 -- (-767.172) (-766.764) [-767.212] (-770.849) * (-768.924) (-767.179) [-766.803] (-768.059) -- 0:00:21
668000 -- (-768.643) (-768.507) [-765.981] (-766.662) * [-770.141] (-767.757) (-766.739) (-765.728) -- 0:00:21
668500 -- (-766.458) (-769.380) (-765.255) [-768.769] * (-769.114) (-770.886) [-765.242] (-765.792) -- 0:00:21
669000 -- (-771.800) [-767.812] (-765.220) (-767.194) * [-765.495] (-768.323) (-768.973) (-769.241) -- 0:00:21
669500 -- (-766.396) (-765.663) [-768.620] (-768.035) * (-766.749) (-769.470) [-766.661] (-766.135) -- 0:00:21
670000 -- [-765.955] (-765.495) (-767.347) (-770.261) * [-765.838] (-767.035) (-767.274) (-768.811) -- 0:00:21
Average standard deviation of split frequencies: 0.007908
670500 -- (-767.776) (-765.104) [-765.371] (-770.572) * (-766.461) (-768.861) (-765.141) [-766.828] -- 0:00:21
671000 -- (-766.886) (-766.279) [-766.348] (-769.911) * (-765.888) [-767.552] (-765.323) (-772.094) -- 0:00:21
671500 -- (-765.813) [-765.959] (-765.445) (-768.043) * (-767.724) [-768.349] (-765.595) (-768.566) -- 0:00:21
672000 -- (-769.472) (-765.668) [-765.777] (-771.500) * [-768.121] (-766.129) (-768.014) (-766.174) -- 0:00:21
672500 -- (-766.620) (-766.745) [-772.575] (-771.833) * (-766.948) (-770.439) (-767.351) [-765.208] -- 0:00:21
673000 -- (-769.068) [-765.076] (-773.130) (-773.281) * [-768.300] (-766.843) (-767.840) (-767.901) -- 0:00:21
673500 -- (-766.250) (-765.041) (-767.832) [-766.890] * [-766.395] (-768.903) (-765.555) (-764.786) -- 0:00:21
674000 -- (-765.520) [-765.903] (-767.348) (-767.235) * (-766.161) (-766.321) (-766.160) [-769.087] -- 0:00:21
674500 -- (-777.816) [-767.829] (-769.494) (-768.841) * [-766.729] (-765.946) (-767.907) (-768.088) -- 0:00:21
675000 -- (-768.042) (-769.705) (-767.128) [-767.946] * (-768.054) (-765.409) (-766.559) [-765.541] -- 0:00:21
Average standard deviation of split frequencies: 0.007627
675500 -- (-770.519) (-766.171) [-767.087] (-764.677) * [-767.051] (-767.138) (-766.721) (-768.401) -- 0:00:21
676000 -- [-768.696] (-768.911) (-767.735) (-766.256) * (-770.609) (-770.706) [-765.922] (-767.468) -- 0:00:21
676500 -- (-764.546) [-764.933] (-766.950) (-769.916) * (-767.758) (-765.838) [-768.979] (-767.863) -- 0:00:21
677000 -- (-770.813) (-765.009) (-766.477) [-766.164] * (-769.265) [-767.240] (-768.505) (-769.275) -- 0:00:21
677500 -- (-769.584) [-764.764] (-764.882) (-766.837) * (-765.991) (-768.800) [-765.611] (-766.472) -- 0:00:21
678000 -- [-765.078] (-767.729) (-767.227) (-767.085) * (-765.194) (-766.879) [-766.368] (-766.862) -- 0:00:21
678500 -- (-768.309) (-765.910) [-766.430] (-765.426) * (-765.650) [-767.394] (-766.074) (-766.684) -- 0:00:21
679000 -- (-767.487) (-766.326) [-768.192] (-765.001) * [-765.618] (-767.164) (-766.659) (-767.118) -- 0:00:21
679500 -- [-766.139] (-768.858) (-766.233) (-765.280) * [-766.623] (-766.737) (-765.776) (-767.037) -- 0:00:21
680000 -- [-766.248] (-766.251) (-767.752) (-766.142) * (-766.378) [-766.271] (-765.732) (-768.631) -- 0:00:21
Average standard deviation of split frequencies: 0.007272
680500 -- (-770.179) (-766.695) [-764.918] (-767.902) * (-765.586) [-767.052] (-767.391) (-766.177) -- 0:00:21
681000 -- (-766.952) (-769.497) [-768.323] (-766.129) * (-765.798) (-766.376) [-765.781] (-771.080) -- 0:00:21
681500 -- (-768.286) [-766.286] (-768.543) (-767.632) * [-766.266] (-765.391) (-766.530) (-769.297) -- 0:00:21
682000 -- [-767.557] (-765.938) (-768.362) (-768.412) * [-766.978] (-769.525) (-765.553) (-766.970) -- 0:00:20
682500 -- (-768.145) [-766.066] (-767.364) (-766.773) * (-766.894) [-769.451] (-766.147) (-771.341) -- 0:00:20
683000 -- (-765.345) (-766.112) (-769.128) [-765.799] * (-766.220) (-767.873) (-765.942) [-768.585] -- 0:00:20
683500 -- (-764.993) (-766.680) (-766.404) [-765.170] * (-768.631) (-771.205) [-765.970] (-770.120) -- 0:00:20
684000 -- (-766.154) [-766.192] (-766.170) (-766.401) * (-765.124) (-766.692) [-765.421] (-766.714) -- 0:00:20
684500 -- (-765.772) [-765.528] (-769.965) (-767.035) * (-770.253) (-769.823) [-769.519] (-769.509) -- 0:00:20
685000 -- (-765.791) [-767.044] (-767.289) (-769.155) * [-764.486] (-767.521) (-769.606) (-766.876) -- 0:00:20
Average standard deviation of split frequencies: 0.006872
685500 -- (-766.318) (-766.315) [-765.486] (-767.355) * [-766.649] (-766.972) (-767.391) (-771.992) -- 0:00:20
686000 -- (-764.852) (-767.067) [-765.548] (-766.865) * (-765.851) [-766.401] (-769.171) (-767.664) -- 0:00:20
686500 -- (-767.238) (-770.243) [-766.832] (-769.453) * (-766.181) [-769.083] (-766.472) (-767.970) -- 0:00:20
687000 -- (-768.265) (-766.566) [-767.192] (-768.682) * (-772.026) [-769.337] (-767.089) (-766.405) -- 0:00:20
687500 -- (-769.178) (-764.815) [-764.978] (-767.838) * (-765.258) (-766.005) [-767.073] (-765.876) -- 0:00:20
688000 -- [-770.088] (-765.762) (-764.708) (-770.859) * (-768.941) [-767.028] (-767.450) (-765.156) -- 0:00:20
688500 -- (-766.691) (-765.866) [-766.133] (-772.732) * (-771.743) [-767.871] (-766.895) (-765.234) -- 0:00:20
689000 -- (-764.871) (-765.075) [-765.693] (-770.714) * (-766.861) (-764.964) [-766.071] (-768.552) -- 0:00:20
689500 -- (-764.933) (-765.200) [-765.782] (-765.807) * (-767.283) [-765.033] (-769.644) (-769.624) -- 0:00:20
690000 -- [-766.593] (-767.421) (-765.661) (-768.873) * (-766.565) [-766.203] (-765.373) (-768.136) -- 0:00:20
Average standard deviation of split frequencies: 0.006740
690500 -- (-765.779) [-766.842] (-766.249) (-767.168) * [-766.844] (-768.989) (-770.975) (-765.609) -- 0:00:20
691000 -- [-766.332] (-768.430) (-765.659) (-770.383) * [-766.540] (-768.772) (-766.026) (-765.568) -- 0:00:20
691500 -- (-767.427) (-766.440) (-765.242) [-768.616] * (-765.867) (-766.178) [-766.385] (-765.639) -- 0:00:20
692000 -- (-766.655) [-768.747] (-764.788) (-768.474) * (-766.906) [-764.961] (-770.794) (-765.552) -- 0:00:20
692500 -- (-767.842) [-766.510] (-766.665) (-769.663) * [-765.644] (-767.079) (-765.245) (-772.416) -- 0:00:20
693000 -- (-765.506) [-766.257] (-770.287) (-769.234) * [-765.847] (-769.359) (-765.401) (-770.238) -- 0:00:20
693500 -- (-767.053) [-767.621] (-769.440) (-765.459) * (-765.281) [-766.230] (-772.549) (-767.483) -- 0:00:20
694000 -- [-768.853] (-765.686) (-765.190) (-765.649) * (-767.291) [-766.329] (-767.691) (-766.433) -- 0:00:20
694500 -- (-767.937) [-765.735] (-770.849) (-766.569) * (-767.205) (-766.285) [-769.265] (-770.433) -- 0:00:20
695000 -- [-769.780] (-767.524) (-767.045) (-766.899) * (-772.038) (-769.354) [-766.747] (-771.223) -- 0:00:20
Average standard deviation of split frequencies: 0.006561
695500 -- (-767.526) (-767.384) [-764.700] (-766.914) * (-767.078) [-769.001] (-765.795) (-767.977) -- 0:00:20
696000 -- (-767.134) (-766.264) (-766.239) [-765.817] * (-771.168) (-769.018) [-766.683] (-766.641) -- 0:00:20
696500 -- (-769.839) [-765.856] (-765.722) (-765.514) * (-769.293) [-764.659] (-766.002) (-766.433) -- 0:00:20
697000 -- (-765.824) (-766.327) (-768.227) [-768.812] * [-765.823] (-766.075) (-765.439) (-766.973) -- 0:00:19
697500 -- (-765.026) (-766.206) (-766.038) [-767.307] * (-768.767) (-769.030) [-765.731] (-767.029) -- 0:00:19
698000 -- (-767.421) (-765.492) [-766.860] (-771.357) * (-765.561) [-764.998] (-766.379) (-767.256) -- 0:00:19
698500 -- (-766.016) [-766.057] (-766.620) (-770.646) * (-768.663) [-765.311] (-766.341) (-766.796) -- 0:00:19
699000 -- (-766.868) (-765.769) (-766.654) [-765.362] * (-768.469) [-765.636] (-769.411) (-770.086) -- 0:00:19
699500 -- (-768.619) [-767.757] (-765.500) (-766.832) * [-765.765] (-766.044) (-773.595) (-769.801) -- 0:00:19
700000 -- (-767.624) [-766.352] (-769.891) (-768.926) * (-769.636) (-764.948) (-769.421) [-765.515] -- 0:00:19
Average standard deviation of split frequencies: 0.006307
700500 -- (-765.755) (-768.610) [-767.508] (-766.728) * (-766.216) [-768.237] (-767.148) (-767.975) -- 0:00:19
701000 -- (-765.684) (-766.398) (-767.979) [-773.415] * [-765.585] (-773.268) (-766.704) (-767.181) -- 0:00:19
701500 -- (-765.903) (-766.678) [-767.178] (-766.758) * (-766.829) (-768.720) [-766.369] (-768.067) -- 0:00:19
702000 -- (-765.995) (-772.375) (-765.285) [-766.658] * (-766.964) [-768.043] (-766.907) (-768.130) -- 0:00:19
702500 -- [-766.561] (-770.886) (-765.907) (-766.170) * (-769.760) (-766.100) (-768.409) [-765.649] -- 0:00:19
703000 -- [-766.541] (-764.704) (-769.589) (-765.946) * (-767.816) (-765.787) [-765.984] (-766.886) -- 0:00:19
703500 -- (-766.701) (-766.473) [-768.057] (-767.563) * [-766.827] (-766.405) (-765.799) (-766.662) -- 0:00:19
704000 -- (-769.105) (-767.350) (-765.823) [-766.884] * (-767.421) (-766.134) [-767.373] (-767.159) -- 0:00:19
704500 -- (-765.528) (-767.979) (-766.072) [-766.901] * (-768.338) (-766.264) (-768.353) [-767.436] -- 0:00:19
705000 -- [-767.179] (-767.089) (-766.145) (-772.503) * (-768.999) (-767.441) [-766.003] (-767.732) -- 0:00:19
Average standard deviation of split frequencies: 0.006135
705500 -- (-766.214) (-765.648) (-765.133) [-768.047] * (-768.364) [-764.727] (-768.860) (-771.932) -- 0:00:19
706000 -- (-766.360) (-765.744) (-765.525) [-767.805] * (-767.158) (-764.724) [-771.977] (-767.164) -- 0:00:19
706500 -- (-765.407) [-768.686] (-766.352) (-770.789) * (-767.081) (-765.569) (-766.845) [-767.869] -- 0:00:19
707000 -- (-768.322) [-765.973] (-766.839) (-766.996) * (-767.934) (-772.185) [-767.669] (-768.571) -- 0:00:19
707500 -- (-765.366) [-765.902] (-765.341) (-766.512) * (-772.847) (-765.716) (-768.714) [-769.791] -- 0:00:19
708000 -- (-765.878) (-766.195) [-765.341] (-767.192) * (-767.813) (-765.352) (-768.776) [-767.279] -- 0:00:19
708500 -- [-766.025] (-767.334) (-765.863) (-766.508) * (-766.114) [-765.938] (-767.303) (-764.973) -- 0:00:19
709000 -- (-765.421) (-765.920) (-765.260) [-766.171] * (-765.467) [-768.248] (-766.698) (-765.043) -- 0:00:19
709500 -- (-767.275) (-766.273) (-765.679) [-765.692] * (-765.602) (-768.980) [-766.096] (-767.717) -- 0:00:19
710000 -- (-765.192) (-767.407) [-766.939] (-765.435) * [-765.041] (-768.545) (-765.473) (-767.577) -- 0:00:19
Average standard deviation of split frequencies: 0.005970
710500 -- (-766.495) [-765.910] (-766.951) (-764.580) * [-773.200] (-767.155) (-764.596) (-767.953) -- 0:00:19
711000 -- (-768.556) (-765.068) (-769.442) [-765.855] * (-766.736) (-764.893) [-766.967] (-766.704) -- 0:00:19
711500 -- (-769.749) [-766.799] (-766.630) (-764.934) * [-766.519] (-767.177) (-766.889) (-772.650) -- 0:00:19
712000 -- (-765.595) (-768.596) (-767.003) [-765.194] * (-772.633) (-768.186) (-777.387) [-768.622] -- 0:00:19
712500 -- (-766.827) (-768.154) (-767.708) [-769.540] * (-765.916) (-766.929) (-768.188) [-768.583] -- 0:00:18
713000 -- (-764.940) (-768.431) [-767.816] (-766.933) * (-766.065) [-764.892] (-768.283) (-766.317) -- 0:00:18
713500 -- (-771.334) [-767.045] (-771.564) (-769.374) * (-765.877) [-765.932] (-768.816) (-767.425) -- 0:00:18
714000 -- (-768.621) [-764.956] (-768.306) (-765.789) * (-767.109) (-768.125) (-765.445) [-768.279] -- 0:00:18
714500 -- (-767.860) (-766.568) [-767.657] (-765.340) * (-767.065) (-768.021) (-766.886) [-769.150] -- 0:00:18
715000 -- (-766.577) (-765.561) (-765.558) [-766.016] * (-767.597) [-766.833] (-767.477) (-766.864) -- 0:00:18
Average standard deviation of split frequencies: 0.006502
715500 -- [-766.938] (-765.600) (-765.554) (-766.229) * [-765.277] (-765.789) (-766.256) (-766.808) -- 0:00:18
716000 -- (-765.131) (-765.407) (-765.794) [-767.663] * (-765.688) (-766.397) (-766.276) [-765.570] -- 0:00:18
716500 -- (-765.681) (-766.018) [-766.093] (-767.406) * (-764.716) (-768.021) (-766.137) [-765.890] -- 0:00:18
717000 -- (-765.302) [-765.442] (-767.796) (-767.738) * (-766.351) [-767.366] (-768.412) (-766.442) -- 0:00:18
717500 -- (-768.188) (-770.511) [-765.084] (-769.669) * (-768.220) [-767.394] (-766.672) (-764.988) -- 0:00:18
718000 -- (-768.492) [-767.415] (-764.925) (-766.933) * (-766.115) (-766.650) [-765.396] (-764.908) -- 0:00:18
718500 -- (-768.133) [-768.079] (-770.849) (-767.403) * [-769.564] (-769.861) (-765.643) (-765.950) -- 0:00:18
719000 -- (-766.990) (-767.212) (-766.370) [-767.169] * [-767.088] (-767.405) (-766.394) (-769.289) -- 0:00:18
719500 -- [-765.627] (-765.610) (-769.445) (-768.436) * (-767.146) (-770.322) [-768.044] (-768.491) -- 0:00:18
720000 -- (-766.519) [-766.427] (-766.966) (-769.268) * (-768.833) (-767.797) (-765.600) [-767.432] -- 0:00:18
Average standard deviation of split frequencies: 0.006459
720500 -- (-765.803) [-764.761] (-767.534) (-770.391) * [-766.891] (-766.782) (-768.887) (-766.862) -- 0:00:18
721000 -- (-766.052) [-766.973] (-772.381) (-769.498) * (-766.487) [-766.332] (-773.813) (-768.690) -- 0:00:18
721500 -- (-766.024) (-769.285) [-768.194] (-768.525) * (-766.709) (-765.771) (-766.822) [-767.168] -- 0:00:18
722000 -- (-765.280) (-766.124) [-767.007] (-765.968) * (-767.541) (-765.844) (-766.220) [-766.061] -- 0:00:18
722500 -- (-768.330) (-767.315) [-765.593] (-768.065) * [-765.099] (-766.757) (-771.767) (-771.302) -- 0:00:18
723000 -- [-768.071] (-768.357) (-766.215) (-765.872) * [-765.041] (-764.730) (-773.339) (-767.338) -- 0:00:18
723500 -- (-765.947) (-767.324) [-765.492] (-767.876) * (-766.644) (-770.051) (-765.618) [-767.925] -- 0:00:18
724000 -- (-767.830) [-769.317] (-767.614) (-767.396) * [-766.519] (-766.794) (-767.541) (-766.471) -- 0:00:18
724500 -- [-765.712] (-768.451) (-766.266) (-767.498) * (-769.477) (-766.725) [-766.239] (-767.371) -- 0:00:18
725000 -- (-768.239) (-771.455) [-766.244] (-767.418) * [-766.273] (-770.787) (-766.006) (-767.700) -- 0:00:18
Average standard deviation of split frequencies: 0.006250
725500 -- (-766.061) (-771.922) (-766.474) [-768.315] * (-766.033) [-766.288] (-768.123) (-770.362) -- 0:00:18
726000 -- (-766.420) (-764.793) (-766.693) [-767.783] * (-765.736) (-768.442) (-770.108) [-766.558] -- 0:00:18
726500 -- (-767.303) (-765.933) (-767.172) [-767.838] * [-765.489] (-768.300) (-774.062) (-767.060) -- 0:00:18
727000 -- [-769.614] (-768.483) (-766.529) (-765.982) * (-766.662) (-770.179) [-767.093] (-769.037) -- 0:00:18
727500 -- [-767.556] (-765.506) (-768.550) (-768.051) * (-769.441) (-770.937) (-771.389) [-768.987] -- 0:00:17
728000 -- (-767.060) (-767.422) (-770.934) [-764.781] * (-766.799) [-767.467] (-765.667) (-766.269) -- 0:00:17
728500 -- (-771.119) [-767.649] (-764.856) (-769.186) * (-766.222) [-766.132] (-766.050) (-766.602) -- 0:00:17
729000 -- (-768.722) [-766.472] (-764.927) (-767.583) * (-770.067) (-767.605) (-766.063) [-764.607] -- 0:00:17
729500 -- (-768.366) (-771.052) [-768.139] (-766.138) * (-765.944) (-768.845) (-771.484) [-767.468] -- 0:00:17
730000 -- [-766.778] (-768.388) (-766.314) (-766.160) * (-766.346) (-766.413) [-768.274] (-765.764) -- 0:00:17
Average standard deviation of split frequencies: 0.006532
730500 -- (-767.282) (-767.256) [-767.575] (-767.076) * (-765.960) (-765.057) [-767.327] (-765.937) -- 0:00:17
731000 -- (-767.842) (-769.777) [-768.025] (-769.776) * (-766.463) (-765.960) [-766.632] (-766.010) -- 0:00:17
731500 -- (-769.629) (-771.700) (-766.464) [-765.283] * (-766.418) (-764.834) [-767.985] (-766.172) -- 0:00:17
732000 -- [-769.422] (-766.360) (-764.611) (-765.831) * [-765.862] (-764.834) (-765.946) (-769.261) -- 0:00:17
732500 -- [-768.855] (-768.052) (-764.652) (-765.159) * [-765.907] (-767.761) (-769.368) (-765.986) -- 0:00:17
733000 -- (-765.767) (-765.013) [-764.705] (-766.762) * [-767.873] (-769.775) (-766.501) (-764.775) -- 0:00:17
733500 -- [-769.438] (-766.183) (-765.334) (-769.896) * (-768.155) (-768.867) (-769.673) [-765.302] -- 0:00:17
734000 -- (-769.590) (-767.535) [-767.332] (-766.966) * (-766.054) (-767.728) [-766.432] (-768.850) -- 0:00:17
734500 -- (-769.025) (-768.186) [-769.566] (-765.312) * [-769.524] (-768.302) (-764.816) (-771.256) -- 0:00:17
735000 -- [-767.717] (-768.474) (-773.697) (-768.919) * (-768.583) [-768.278] (-767.044) (-766.836) -- 0:00:17
Average standard deviation of split frequencies: 0.006245
735500 -- (-768.570) (-765.714) (-767.956) [-766.134] * (-770.071) (-771.379) [-764.838] (-766.255) -- 0:00:17
736000 -- (-774.215) [-767.438] (-766.148) (-766.557) * [-767.378] (-775.768) (-766.647) (-769.450) -- 0:00:17
736500 -- (-768.737) (-769.020) [-770.005] (-768.325) * (-767.587) (-768.316) [-769.464] (-768.131) -- 0:00:17
737000 -- (-769.200) (-766.613) [-767.002] (-768.690) * (-767.680) [-766.280] (-768.156) (-767.262) -- 0:00:17
737500 -- (-767.923) (-766.699) [-766.959] (-766.339) * (-768.673) (-765.143) (-768.503) [-769.743] -- 0:00:17
738000 -- (-767.155) (-767.296) (-766.147) [-767.724] * (-768.074) (-768.305) [-768.848] (-766.696) -- 0:00:17
738500 -- (-766.335) (-767.353) [-768.498] (-766.527) * (-770.155) (-769.044) (-773.205) [-766.526] -- 0:00:17
739000 -- (-770.984) (-765.601) [-769.083] (-769.620) * [-766.982] (-767.590) (-767.094) (-765.300) -- 0:00:17
739500 -- [-766.543] (-766.602) (-766.214) (-764.700) * (-767.739) [-765.315] (-768.245) (-765.835) -- 0:00:17
740000 -- [-765.645] (-766.416) (-767.430) (-765.100) * (-767.234) (-765.755) [-771.296] (-765.383) -- 0:00:17
Average standard deviation of split frequencies: 0.006322
740500 -- (-765.923) (-765.023) (-765.804) [-768.049] * (-767.612) (-766.020) (-766.913) [-766.416] -- 0:00:17
741000 -- (-765.358) (-764.689) (-769.334) [-768.549] * (-765.535) [-769.424] (-766.431) (-766.623) -- 0:00:17
741500 -- (-765.545) (-768.494) (-766.195) [-765.209] * (-765.625) (-771.201) (-767.940) [-766.036] -- 0:00:17
742000 -- [-765.008] (-771.864) (-771.516) (-765.101) * [-766.278] (-767.079) (-767.451) (-766.694) -- 0:00:17
742500 -- [-764.722] (-767.577) (-765.511) (-766.229) * (-769.725) (-769.801) [-769.848] (-765.308) -- 0:00:16
743000 -- (-765.066) (-767.432) [-765.864] (-768.342) * (-765.335) (-769.678) [-770.384] (-769.098) -- 0:00:16
743500 -- [-768.924] (-765.649) (-765.430) (-768.408) * (-766.175) [-767.316] (-766.325) (-765.322) -- 0:00:16
744000 -- [-768.663] (-766.266) (-765.186) (-768.701) * (-766.241) (-766.700) (-768.186) [-766.407] -- 0:00:16
744500 -- (-768.244) (-765.709) [-768.185] (-765.956) * (-769.096) (-766.545) (-769.659) [-766.011] -- 0:00:16
745000 -- (-766.260) (-769.771) [-766.231] (-768.016) * (-765.819) [-765.697] (-767.476) (-765.899) -- 0:00:16
Average standard deviation of split frequencies: 0.006161
745500 -- [-766.020] (-769.408) (-765.950) (-767.452) * [-766.068] (-764.957) (-764.875) (-765.479) -- 0:00:16
746000 -- [-765.560] (-765.815) (-767.095) (-765.277) * (-766.712) [-770.882] (-766.086) (-768.651) -- 0:00:16
746500 -- (-767.957) [-765.896] (-769.739) (-766.337) * [-767.449] (-768.264) (-765.793) (-767.716) -- 0:00:16
747000 -- (-766.574) (-765.771) (-773.619) [-765.889] * (-766.170) (-766.781) [-769.473] (-768.046) -- 0:00:16
747500 -- (-770.164) (-765.036) (-768.948) [-766.821] * [-766.136] (-766.471) (-765.468) (-768.465) -- 0:00:16
748000 -- [-769.355] (-764.967) (-765.469) (-768.297) * (-767.195) (-765.216) [-765.459] (-768.205) -- 0:00:16
748500 -- (-766.973) (-765.381) [-766.691] (-764.994) * [-767.057] (-766.982) (-766.995) (-768.962) -- 0:00:16
749000 -- (-769.651) (-769.550) (-766.901) [-764.816] * (-769.356) [-765.898] (-767.460) (-767.656) -- 0:00:16
749500 -- (-767.070) (-767.563) (-769.381) [-765.501] * [-765.171] (-767.016) (-769.410) (-767.944) -- 0:00:16
750000 -- (-766.245) (-768.504) (-766.643) [-765.372] * (-766.206) (-764.852) [-765.249] (-768.432) -- 0:00:16
Average standard deviation of split frequencies: 0.006162
750500 -- (-768.778) (-768.362) [-770.236] (-765.625) * [-766.110] (-765.693) (-768.127) (-766.181) -- 0:00:16
751000 -- (-766.775) [-768.266] (-768.935) (-766.841) * (-765.773) (-766.490) (-765.538) [-766.394] -- 0:00:16
751500 -- (-766.629) [-765.841] (-771.838) (-770.492) * (-766.998) [-767.986] (-767.056) (-765.764) -- 0:00:16
752000 -- (-767.853) [-768.058] (-768.239) (-771.327) * [-765.643] (-772.364) (-767.211) (-767.130) -- 0:00:16
752500 -- (-767.921) [-764.675] (-767.150) (-766.330) * [-768.793] (-770.552) (-767.268) (-765.201) -- 0:00:16
753000 -- (-769.156) (-765.709) [-768.389] (-766.330) * [-766.185] (-765.693) (-767.497) (-766.187) -- 0:00:16
753500 -- [-766.087] (-767.455) (-767.254) (-765.539) * [-768.782] (-766.575) (-767.407) (-773.216) -- 0:00:16
754000 -- [-765.070] (-768.390) (-766.097) (-767.661) * (-770.530) (-767.844) [-765.386] (-769.600) -- 0:00:16
754500 -- (-766.908) (-769.091) [-766.798] (-767.350) * (-765.478) [-766.758] (-771.671) (-768.506) -- 0:00:16
755000 -- (-765.906) (-767.012) [-765.737] (-764.699) * [-765.771] (-769.386) (-773.122) (-769.208) -- 0:00:16
Average standard deviation of split frequencies: 0.006313
755500 -- [-766.487] (-767.135) (-766.349) (-767.371) * [-765.322] (-766.820) (-766.743) (-769.953) -- 0:00:16
756000 -- (-765.543) [-766.298] (-767.288) (-767.718) * [-766.987] (-766.623) (-766.487) (-766.724) -- 0:00:16
756500 -- [-765.632] (-768.150) (-766.383) (-767.503) * (-765.338) (-767.117) [-766.415] (-767.228) -- 0:00:16
757000 -- (-768.601) [-771.980] (-767.931) (-765.311) * (-766.600) [-765.059] (-767.165) (-769.511) -- 0:00:16
757500 -- (-765.393) [-769.607] (-767.663) (-766.352) * [-766.172] (-766.404) (-767.022) (-767.611) -- 0:00:16
758000 -- [-767.542] (-765.809) (-768.389) (-764.543) * (-768.515) [-768.663] (-769.331) (-768.111) -- 0:00:15
758500 -- (-765.531) (-768.114) [-766.344] (-765.277) * (-766.005) (-770.802) (-767.148) [-764.940] -- 0:00:15
759000 -- [-765.059] (-766.729) (-768.659) (-765.602) * (-765.211) (-766.920) [-768.326] (-765.340) -- 0:00:15
759500 -- [-767.685] (-767.204) (-766.976) (-766.347) * (-765.808) [-766.344] (-765.686) (-768.040) -- 0:00:15
760000 -- (-770.942) (-767.360) (-768.152) [-767.510] * (-766.176) [-769.578] (-769.047) (-765.358) -- 0:00:15
Average standard deviation of split frequencies: 0.006391
760500 -- (-768.396) (-766.632) (-768.052) [-766.651] * (-768.142) (-767.446) (-767.111) [-765.961] -- 0:00:15
761000 -- (-766.507) [-766.411] (-767.097) (-768.365) * (-769.089) (-768.415) [-766.412] (-770.010) -- 0:00:15
761500 -- (-769.338) (-766.374) [-767.382] (-768.381) * (-767.667) [-765.369] (-769.984) (-772.481) -- 0:00:15
762000 -- [-767.895] (-765.596) (-765.157) (-767.966) * [-767.188] (-765.487) (-764.992) (-766.394) -- 0:00:15
762500 -- (-766.281) [-767.389] (-768.755) (-769.776) * [-765.943] (-767.147) (-769.637) (-765.583) -- 0:00:15
763000 -- (-766.461) (-766.763) [-764.865] (-772.478) * (-771.393) (-767.705) (-769.880) [-765.407] -- 0:00:15
763500 -- (-767.701) (-765.153) (-765.799) [-765.463] * (-766.941) (-767.398) [-765.796] (-768.972) -- 0:00:15
764000 -- (-773.949) (-767.643) [-766.021] (-765.638) * (-765.549) (-769.144) (-766.729) [-768.729] -- 0:00:15
764500 -- [-767.076] (-767.332) (-771.372) (-769.398) * (-769.615) (-770.361) (-767.760) [-766.285] -- 0:00:15
765000 -- (-767.067) [-765.592] (-765.183) (-769.619) * (-765.732) [-773.004] (-767.889) (-765.795) -- 0:00:15
Average standard deviation of split frequencies: 0.006346
765500 -- (-770.010) (-767.669) [-767.799] (-767.581) * (-766.025) [-766.151] (-766.328) (-766.646) -- 0:00:15
766000 -- (-765.775) [-768.159] (-768.525) (-770.391) * [-765.877] (-768.507) (-765.141) (-766.929) -- 0:00:15
766500 -- (-766.815) [-765.995] (-765.825) (-768.246) * (-767.780) (-766.795) [-766.052] (-765.559) -- 0:00:15
767000 -- (-771.056) (-765.860) [-767.360] (-765.854) * (-766.976) (-767.866) (-767.926) [-765.509] -- 0:00:15
767500 -- [-769.074] (-767.320) (-765.141) (-765.688) * (-768.867) [-765.875] (-769.337) (-766.404) -- 0:00:15
768000 -- [-767.205] (-766.532) (-766.917) (-765.826) * (-766.528) [-766.701] (-766.814) (-765.903) -- 0:00:15
768500 -- (-767.975) (-767.168) [-764.656] (-772.007) * [-767.050] (-765.071) (-769.894) (-771.972) -- 0:00:15
769000 -- (-767.989) (-766.257) (-766.316) [-765.075] * [-768.945] (-773.316) (-766.457) (-766.738) -- 0:00:15
769500 -- (-768.432) (-770.716) [-765.922] (-766.085) * (-767.346) [-765.978] (-767.014) (-768.602) -- 0:00:15
770000 -- (-768.564) (-767.429) [-766.560] (-768.033) * (-766.444) (-770.026) (-767.002) [-768.738] -- 0:00:15
Average standard deviation of split frequencies: 0.006810
770500 -- (-768.682) (-768.243) [-768.105] (-767.567) * (-766.584) (-765.317) [-772.425] (-767.770) -- 0:00:15
771000 -- (-768.386) (-769.186) [-767.251] (-765.930) * (-766.885) (-770.064) (-770.910) [-767.084] -- 0:00:15
771500 -- (-765.850) (-767.662) [-765.267] (-767.480) * (-766.912) [-767.293] (-770.071) (-767.000) -- 0:00:15
772000 -- (-765.383) [-766.150] (-767.922) (-767.657) * (-766.549) (-766.987) (-765.192) [-769.672] -- 0:00:15
772500 -- [-764.796] (-766.353) (-767.744) (-765.454) * (-772.422) (-765.461) (-765.697) [-765.402] -- 0:00:15
773000 -- (-765.708) [-765.048] (-771.207) (-768.158) * (-770.224) [-768.386] (-765.801) (-765.235) -- 0:00:14
773500 -- (-765.280) (-765.500) (-772.032) [-768.651] * (-766.335) [-766.292] (-766.084) (-765.030) -- 0:00:14
774000 -- (-765.774) (-770.842) [-769.811] (-772.436) * (-766.198) (-767.472) (-768.089) [-765.772] -- 0:00:14
774500 -- [-764.512] (-765.914) (-766.503) (-765.215) * (-769.873) [-768.914] (-765.364) (-767.680) -- 0:00:14
775000 -- (-766.365) (-765.972) [-764.977] (-768.605) * (-770.353) (-767.906) (-766.306) [-766.089] -- 0:00:14
Average standard deviation of split frequencies: 0.006480
775500 -- (-765.987) (-766.173) [-765.872] (-769.812) * (-766.593) [-766.898] (-765.129) (-767.170) -- 0:00:14
776000 -- [-769.264] (-767.906) (-767.622) (-767.328) * (-765.356) (-764.516) (-769.486) [-765.607] -- 0:00:14
776500 -- (-765.466) (-767.025) [-765.468] (-766.939) * (-772.213) (-765.056) (-767.020) [-769.176] -- 0:00:14
777000 -- (-767.815) (-766.288) (-769.422) [-769.191] * (-767.290) [-764.754] (-765.262) (-768.636) -- 0:00:14
777500 -- (-767.738) (-768.833) (-765.525) [-767.875] * (-768.721) (-769.700) [-766.419] (-766.251) -- 0:00:14
778000 -- (-767.616) (-767.240) [-764.858] (-767.542) * [-764.903] (-766.724) (-768.180) (-767.133) -- 0:00:14
778500 -- (-768.001) (-765.144) [-767.580] (-766.032) * (-764.710) [-768.663] (-766.549) (-767.019) -- 0:00:14
779000 -- (-765.290) (-765.496) (-768.356) [-766.227] * [-765.274] (-768.691) (-765.736) (-766.092) -- 0:00:14
779500 -- (-769.307) [-766.434] (-766.476) (-768.798) * (-765.574) (-774.009) (-766.974) [-767.989] -- 0:00:14
780000 -- (-768.701) (-766.023) [-769.734] (-766.747) * (-765.750) [-766.311] (-769.896) (-765.041) -- 0:00:14
Average standard deviation of split frequencies: 0.006522
780500 -- (-767.572) [-766.579] (-765.475) (-768.156) * (-767.271) (-769.018) (-767.574) [-767.114] -- 0:00:14
781000 -- (-767.137) (-767.603) [-768.407] (-765.600) * (-765.972) (-768.136) (-767.205) [-765.949] -- 0:00:14
781500 -- (-767.699) [-766.854] (-768.489) (-766.670) * [-765.911] (-766.903) (-768.234) (-768.084) -- 0:00:14
782000 -- (-765.172) (-766.274) [-765.789] (-769.678) * (-765.005) (-770.296) (-765.468) [-766.267] -- 0:00:14
782500 -- (-765.975) (-766.377) [-767.385] (-767.073) * [-764.800] (-767.045) (-765.194) (-765.687) -- 0:00:14
783000 -- (-766.834) [-767.192] (-767.304) (-769.185) * [-765.576] (-766.920) (-765.204) (-767.280) -- 0:00:14
783500 -- (-768.268) [-772.741] (-768.185) (-770.157) * (-765.752) (-767.539) [-768.365] (-766.523) -- 0:00:14
784000 -- (-770.257) [-765.959] (-769.875) (-766.354) * [-765.814] (-766.999) (-766.236) (-766.008) -- 0:00:14
784500 -- (-767.208) (-765.761) (-766.695) [-767.233] * (-766.249) [-765.612] (-766.144) (-766.295) -- 0:00:14
785000 -- [-768.081] (-765.875) (-765.821) (-766.116) * (-766.245) (-770.244) [-765.367] (-766.400) -- 0:00:14
Average standard deviation of split frequencies: 0.006277
785500 -- (-768.048) (-765.760) (-766.571) [-765.752] * (-767.323) (-765.823) [-766.710] (-765.804) -- 0:00:14
786000 -- [-766.091] (-765.725) (-765.137) (-766.997) * (-768.022) (-766.148) (-766.588) [-767.628] -- 0:00:14
786500 -- (-765.364) [-765.922] (-766.917) (-765.490) * (-769.758) (-767.389) [-767.157] (-766.844) -- 0:00:14
787000 -- (-770.330) (-766.237) (-769.281) [-766.389] * (-767.678) (-767.476) (-767.902) [-765.701] -- 0:00:14
787500 -- [-768.902] (-769.428) (-766.042) (-765.992) * (-768.973) [-766.954] (-764.965) (-765.552) -- 0:00:14
788000 -- (-767.164) (-766.537) (-769.306) [-765.271] * (-765.973) [-768.080] (-768.012) (-767.251) -- 0:00:13
788500 -- [-765.043] (-769.304) (-765.981) (-765.341) * (-765.490) [-765.491] (-773.765) (-766.138) -- 0:00:13
789000 -- (-765.613) (-767.445) [-766.255] (-766.265) * (-767.413) (-767.097) [-769.737] (-767.065) -- 0:00:13
789500 -- (-767.174) [-765.198] (-767.432) (-766.073) * (-765.850) [-769.754] (-769.677) (-770.008) -- 0:00:13
790000 -- (-765.028) [-768.090] (-766.217) (-772.987) * (-766.602) (-766.988) [-765.327] (-771.836) -- 0:00:13
Average standard deviation of split frequencies: 0.006598
790500 -- [-765.874] (-767.360) (-768.680) (-767.327) * (-767.046) (-768.210) (-768.319) [-767.754] -- 0:00:13
791000 -- (-766.377) (-766.273) [-767.144] (-769.775) * (-768.057) [-766.307] (-770.130) (-768.231) -- 0:00:13
791500 -- [-768.134] (-765.928) (-765.986) (-776.859) * (-767.829) (-767.370) [-768.428] (-767.535) -- 0:00:13
792000 -- [-770.065] (-769.616) (-764.665) (-766.230) * (-766.094) [-766.708] (-765.287) (-768.701) -- 0:00:13
792500 -- (-766.517) (-772.141) (-765.857) [-768.913] * (-766.372) (-765.796) [-765.102] (-766.027) -- 0:00:13
793000 -- (-768.612) [-767.556] (-765.773) (-769.085) * (-765.844) (-767.489) [-768.358] (-767.698) -- 0:00:13
793500 -- (-768.405) [-767.149] (-768.801) (-767.043) * (-767.004) [-769.592] (-768.745) (-765.823) -- 0:00:13
794000 -- (-767.970) [-765.840] (-765.117) (-770.168) * (-769.959) (-766.864) [-766.437] (-766.754) -- 0:00:13
794500 -- (-768.496) (-768.907) (-769.026) [-767.026] * (-768.030) (-768.271) (-764.752) [-766.299] -- 0:00:13
795000 -- (-765.058) [-767.815] (-765.195) (-767.640) * (-766.681) (-766.992) [-765.331] (-767.074) -- 0:00:13
Average standard deviation of split frequencies: 0.006830
795500 -- (-765.562) (-764.999) (-768.449) [-768.485] * (-765.059) [-768.480] (-765.500) (-773.273) -- 0:00:13
796000 -- (-771.394) [-767.031] (-769.056) (-767.430) * (-764.647) [-770.656] (-766.450) (-766.650) -- 0:00:13
796500 -- (-765.938) (-768.871) [-766.462] (-768.026) * (-765.269) (-767.427) (-767.468) [-765.236] -- 0:00:13
797000 -- [-765.621] (-765.962) (-766.952) (-768.424) * [-767.979] (-767.494) (-766.784) (-766.939) -- 0:00:13
797500 -- (-766.356) (-765.670) (-766.165) [-770.701] * [-768.532] (-766.506) (-765.569) (-765.665) -- 0:00:13
798000 -- (-767.918) (-767.565) [-766.186] (-768.750) * (-769.389) [-766.281] (-767.642) (-766.593) -- 0:00:13
798500 -- [-765.231] (-765.959) (-769.993) (-765.891) * (-766.478) (-766.526) [-767.152] (-767.263) -- 0:00:13
799000 -- (-767.088) [-765.534] (-766.063) (-768.271) * (-768.775) [-766.997] (-768.926) (-766.730) -- 0:00:13
799500 -- (-766.632) (-771.568) (-768.084) [-769.659] * [-766.103] (-766.694) (-767.958) (-765.818) -- 0:00:13
800000 -- (-767.934) (-768.374) (-768.003) [-765.565] * (-775.741) (-766.619) [-768.445] (-766.382) -- 0:00:13
Average standard deviation of split frequencies: 0.007065
800500 -- (-764.957) (-766.952) [-767.233] (-767.012) * (-765.500) [-767.669] (-768.281) (-767.268) -- 0:00:13
801000 -- (-765.120) [-765.868] (-765.676) (-766.452) * (-768.884) (-766.355) (-769.557) [-766.921] -- 0:00:13
801500 -- [-765.872] (-764.890) (-764.689) (-766.215) * (-767.948) [-766.230] (-765.450) (-766.602) -- 0:00:13
802000 -- [-767.155] (-766.251) (-766.699) (-766.359) * [-765.793] (-767.598) (-766.679) (-764.851) -- 0:00:13
802500 -- (-767.116) (-769.119) [-767.221] (-766.218) * (-767.272) [-771.209] (-766.797) (-766.278) -- 0:00:13
803000 -- [-770.008] (-771.409) (-765.241) (-769.786) * (-768.410) (-774.193) (-771.036) [-765.776] -- 0:00:13
803500 -- (-766.792) (-768.211) [-765.953] (-768.336) * (-766.330) (-767.238) [-768.290] (-769.566) -- 0:00:12
804000 -- (-765.158) (-766.420) (-770.745) [-769.879] * (-765.257) (-766.071) [-765.807] (-767.560) -- 0:00:12
804500 -- (-765.772) (-767.096) (-770.582) [-764.699] * [-766.153] (-765.745) (-769.033) (-771.209) -- 0:00:12
805000 -- (-766.147) (-767.437) (-765.002) [-765.555] * [-767.822] (-765.801) (-765.928) (-767.360) -- 0:00:12
Average standard deviation of split frequencies: 0.007057
805500 -- (-765.106) [-770.525] (-769.291) (-766.129) * (-766.755) (-770.815) [-767.101] (-767.899) -- 0:00:12
806000 -- (-765.937) (-765.946) (-765.317) [-765.975] * (-767.079) (-768.399) [-766.001] (-767.010) -- 0:00:12
806500 -- (-766.583) (-768.228) (-766.439) [-767.545] * [-766.969] (-773.027) (-769.107) (-766.829) -- 0:00:12
807000 -- (-767.774) (-769.493) [-771.163] (-768.662) * (-771.301) [-766.815] (-766.072) (-772.815) -- 0:00:12
807500 -- (-765.811) (-767.697) (-768.999) [-770.604] * [-767.349] (-766.347) (-769.285) (-769.479) -- 0:00:12
808000 -- (-766.324) (-770.754) [-767.088] (-773.400) * (-767.188) [-765.781] (-769.045) (-772.553) -- 0:00:12
808500 -- (-766.426) [-766.979] (-766.175) (-766.551) * (-765.719) (-768.712) [-765.970] (-769.502) -- 0:00:12
809000 -- (-766.946) [-765.282] (-765.973) (-766.692) * (-766.761) [-766.465] (-765.345) (-769.730) -- 0:00:12
809500 -- (-766.948) [-764.884] (-766.511) (-765.299) * [-765.323] (-768.758) (-766.270) (-766.696) -- 0:00:12
810000 -- [-764.955] (-765.150) (-767.707) (-767.993) * [-765.842] (-770.866) (-771.295) (-766.571) -- 0:00:12
Average standard deviation of split frequencies: 0.007094
810500 -- [-765.416] (-764.791) (-768.599) (-767.054) * (-767.309) (-766.602) (-766.855) [-766.648] -- 0:00:12
811000 -- (-766.006) (-769.158) (-768.556) [-767.316] * (-766.796) (-773.301) (-769.740) [-765.710] -- 0:00:12
811500 -- (-766.375) (-765.710) [-765.742] (-765.890) * (-766.500) (-769.305) (-773.620) [-767.820] -- 0:00:12
812000 -- (-767.065) [-764.676] (-768.728) (-768.038) * (-765.987) (-764.824) [-767.084] (-768.559) -- 0:00:12
812500 -- (-766.036) (-766.495) (-765.270) [-765.742] * (-766.732) (-764.943) [-764.886] (-771.547) -- 0:00:12
813000 -- [-765.211] (-769.350) (-768.074) (-765.686) * (-766.467) (-765.302) (-765.088) [-768.332] -- 0:00:12
813500 -- [-764.850] (-766.335) (-765.735) (-768.640) * (-771.942) (-766.458) [-768.858] (-769.092) -- 0:00:12
814000 -- (-765.055) (-764.515) [-766.177] (-766.978) * (-765.641) (-766.168) [-766.815] (-767.986) -- 0:00:12
814500 -- (-768.235) (-768.213) (-766.338) [-766.765] * (-768.566) [-767.551] (-773.530) (-767.031) -- 0:00:12
815000 -- (-767.391) [-766.654] (-769.103) (-768.324) * (-765.803) [-766.628] (-765.873) (-765.987) -- 0:00:12
Average standard deviation of split frequencies: 0.007125
815500 -- (-770.297) (-770.575) (-769.471) [-765.192] * (-764.941) (-767.176) [-768.802] (-767.603) -- 0:00:12
816000 -- [-768.543] (-770.287) (-766.902) (-765.226) * (-766.533) (-766.239) [-766.096] (-767.316) -- 0:00:12
816500 -- [-766.480] (-772.408) (-765.662) (-769.789) * (-766.651) [-766.531] (-769.196) (-769.608) -- 0:00:12
817000 -- (-767.672) (-769.868) (-766.715) [-766.173] * (-766.152) [-766.915] (-768.186) (-767.741) -- 0:00:12
817500 -- (-765.937) (-773.623) (-765.176) [-766.340] * [-767.265] (-766.709) (-766.354) (-767.669) -- 0:00:12
818000 -- (-765.702) [-765.646] (-767.623) (-766.032) * (-766.309) (-768.728) (-768.686) [-766.852] -- 0:00:12
818500 -- (-765.071) (-767.122) (-768.043) [-766.565] * (-765.402) (-769.025) [-766.570] (-766.447) -- 0:00:11
819000 -- (-769.307) (-767.156) (-767.370) [-765.192] * (-766.093) (-766.214) (-768.415) [-766.355] -- 0:00:11
819500 -- (-766.187) [-765.538] (-767.908) (-766.927) * [-768.897] (-766.210) (-769.086) (-769.566) -- 0:00:11
820000 -- (-768.003) (-767.546) (-766.035) [-768.018] * (-771.308) [-767.139] (-764.588) (-765.433) -- 0:00:11
Average standard deviation of split frequencies: 0.007314
820500 -- (-766.747) (-766.366) (-765.402) [-765.727] * (-770.321) [-765.894] (-764.899) (-768.821) -- 0:00:11
821000 -- (-767.556) (-767.498) [-765.526] (-766.971) * [-766.610] (-769.092) (-767.430) (-768.562) -- 0:00:11
821500 -- (-767.642) [-768.138] (-766.637) (-776.951) * (-767.044) (-766.858) [-765.334] (-767.317) -- 0:00:11
822000 -- [-765.451] (-768.675) (-768.570) (-769.382) * [-766.313] (-768.207) (-766.283) (-769.342) -- 0:00:11
822500 -- [-766.253] (-768.934) (-765.610) (-765.161) * (-765.078) (-765.606) [-767.966] (-769.515) -- 0:00:11
823000 -- (-765.334) [-767.994] (-767.062) (-767.860) * (-764.797) (-766.064) [-768.204] (-772.525) -- 0:00:11
823500 -- (-767.878) [-767.371] (-768.243) (-768.075) * (-765.140) [-769.670] (-766.348) (-771.603) -- 0:00:11
824000 -- (-771.040) (-766.256) (-767.044) [-767.698] * (-772.010) [-768.273] (-765.858) (-767.358) -- 0:00:11
824500 -- (-766.066) (-768.012) (-772.611) [-769.965] * (-767.150) (-765.839) [-765.637] (-770.448) -- 0:00:11
825000 -- (-766.274) [-768.101] (-766.532) (-766.184) * (-767.622) (-766.614) [-767.451] (-766.825) -- 0:00:11
Average standard deviation of split frequencies: 0.007039
825500 -- (-770.112) (-768.464) [-765.773] (-765.042) * (-774.101) (-768.633) (-768.027) [-768.233] -- 0:00:11
826000 -- (-773.153) (-766.082) [-767.035] (-765.641) * [-766.953] (-770.421) (-767.328) (-765.229) -- 0:00:11
826500 -- (-768.814) (-766.793) (-765.395) [-768.636] * (-768.029) (-765.905) [-765.114] (-770.909) -- 0:00:11
827000 -- (-766.234) [-765.729] (-767.838) (-767.208) * [-766.154] (-769.920) (-766.100) (-766.687) -- 0:00:11
827500 -- [-765.975] (-768.055) (-767.223) (-768.606) * (-766.982) (-766.453) [-766.441] (-769.066) -- 0:00:11
828000 -- (-765.727) [-767.759] (-765.782) (-769.140) * (-766.722) (-766.172) [-768.458] (-766.521) -- 0:00:11
828500 -- (-767.543) [-766.515] (-766.910) (-764.479) * (-766.810) [-765.388] (-768.232) (-766.779) -- 0:00:11
829000 -- [-769.937] (-765.600) (-766.624) (-766.209) * (-766.993) (-766.944) (-766.233) [-769.150] -- 0:00:11
829500 -- (-765.903) [-766.218] (-765.933) (-768.371) * [-767.195] (-767.824) (-765.662) (-765.917) -- 0:00:11
830000 -- [-767.529] (-767.922) (-771.680) (-766.812) * [-770.498] (-765.445) (-766.025) (-765.328) -- 0:00:11
Average standard deviation of split frequencies: 0.006507
830500 -- (-768.394) (-766.574) [-766.810] (-768.192) * (-770.091) (-764.997) [-765.143] (-766.783) -- 0:00:11
831000 -- [-768.015] (-768.750) (-769.507) (-765.857) * (-772.149) (-764.779) [-766.170] (-765.374) -- 0:00:11
831500 -- (-767.306) [-769.621] (-767.282) (-766.718) * (-770.625) (-764.817) [-765.483] (-766.084) -- 0:00:11
832000 -- [-767.239] (-769.896) (-767.590) (-765.881) * (-768.301) [-765.312] (-768.095) (-766.868) -- 0:00:11
832500 -- [-767.682] (-769.274) (-765.996) (-765.218) * [-770.660] (-767.227) (-766.440) (-772.243) -- 0:00:11
833000 -- [-768.322] (-768.210) (-769.612) (-764.845) * (-769.722) [-766.076] (-769.441) (-767.306) -- 0:00:11
833500 -- (-767.967) [-764.972] (-767.627) (-765.340) * [-768.621] (-765.155) (-768.089) (-765.679) -- 0:00:10
834000 -- (-770.051) [-765.162] (-769.140) (-765.042) * (-769.146) (-765.184) [-766.477] (-766.516) -- 0:00:10
834500 -- (-767.328) [-765.366] (-765.489) (-766.959) * [-767.660] (-773.583) (-765.496) (-765.601) -- 0:00:10
835000 -- (-766.344) (-765.434) [-764.887] (-766.069) * (-770.470) [-766.244] (-767.266) (-771.420) -- 0:00:10
Average standard deviation of split frequencies: 0.006879
835500 -- (-766.275) [-768.207] (-769.092) (-767.012) * (-768.738) (-770.517) (-765.427) [-767.251] -- 0:00:10
836000 -- (-767.133) (-770.036) (-766.839) [-765.569] * (-766.222) [-770.184] (-767.252) (-766.212) -- 0:00:10
836500 -- (-767.225) (-766.552) [-769.440] (-765.903) * (-766.184) [-767.049] (-769.375) (-765.067) -- 0:00:10
837000 -- (-766.941) (-769.226) [-767.084] (-766.528) * (-765.916) (-766.605) (-766.490) [-765.015] -- 0:00:10
837500 -- (-770.211) (-769.090) (-764.847) [-765.214] * (-768.470) [-765.583] (-766.256) (-765.189) -- 0:00:10
838000 -- (-772.995) (-770.293) [-766.840] (-767.349) * (-767.657) (-765.001) [-765.708] (-765.267) -- 0:00:10
838500 -- (-768.104) [-765.713] (-766.363) (-767.583) * (-767.865) (-766.018) (-767.715) [-767.278] -- 0:00:10
839000 -- (-765.969) (-765.877) [-766.221] (-766.489) * (-765.873) (-766.774) [-765.748] (-765.956) -- 0:00:10
839500 -- (-766.387) (-766.943) [-768.066] (-768.235) * (-765.274) (-767.170) [-766.150] (-768.242) -- 0:00:10
840000 -- (-765.881) (-768.913) (-767.921) [-765.265] * (-766.099) [-765.213] (-766.198) (-768.007) -- 0:00:10
Average standard deviation of split frequencies: 0.007065
840500 -- [-764.816] (-767.294) (-768.957) (-766.271) * (-765.919) [-764.744] (-766.861) (-766.706) -- 0:00:10
841000 -- (-765.713) [-767.436] (-767.057) (-767.510) * [-765.979] (-766.829) (-767.248) (-769.141) -- 0:00:10
841500 -- (-766.614) (-766.434) (-773.254) [-771.876] * (-765.524) [-764.980] (-768.523) (-769.015) -- 0:00:10
842000 -- (-767.881) (-768.043) (-774.265) [-767.963] * [-765.849] (-773.503) (-766.326) (-765.654) -- 0:00:10
842500 -- (-765.916) (-767.957) [-769.488] (-767.669) * (-768.280) (-766.137) (-766.317) [-765.878] -- 0:00:10
843000 -- [-766.819] (-764.879) (-768.351) (-769.146) * (-766.556) (-766.050) [-765.747] (-770.111) -- 0:00:10
843500 -- (-765.520) (-765.374) [-767.380] (-767.553) * [-766.519] (-769.650) (-766.264) (-765.646) -- 0:00:10
844000 -- (-768.013) (-767.725) (-769.766) [-765.531] * (-768.499) (-766.726) (-765.960) [-767.775] -- 0:00:10
844500 -- (-764.821) (-768.461) [-766.083] (-764.822) * (-768.665) (-767.026) (-768.479) [-766.041] -- 0:00:10
845000 -- (-767.362) (-766.039) (-768.624) [-765.714] * (-766.197) (-764.978) (-770.410) [-766.947] -- 0:00:10
Average standard deviation of split frequencies: 0.006761
845500 -- (-766.169) (-768.513) (-768.459) [-769.568] * (-766.742) [-764.856] (-771.985) (-767.995) -- 0:00:10
846000 -- (-768.317) (-771.670) (-766.747) [-769.351] * (-770.352) (-764.950) (-767.367) [-766.705] -- 0:00:10
846500 -- (-768.401) (-767.875) [-765.760] (-770.320) * [-766.239] (-766.007) (-769.392) (-765.819) -- 0:00:10
847000 -- [-770.971] (-769.646) (-765.763) (-768.207) * [-766.154] (-767.891) (-767.531) (-765.901) -- 0:00:10
847500 -- (-764.799) (-767.052) (-766.926) [-768.275] * (-770.961) (-766.871) [-768.889] (-765.675) -- 0:00:10
848000 -- [-765.718] (-767.509) (-776.183) (-767.822) * [-765.627] (-765.885) (-767.498) (-768.978) -- 0:00:10
848500 -- (-767.894) (-770.665) [-767.092] (-768.144) * (-765.023) [-766.788] (-765.791) (-765.594) -- 0:00:09
849000 -- [-765.390] (-767.982) (-766.471) (-765.205) * [-764.464] (-766.668) (-769.466) (-768.901) -- 0:00:09
849500 -- (-766.451) [-768.692] (-765.864) (-765.898) * (-768.490) (-770.929) (-767.341) [-770.965] -- 0:00:09
850000 -- (-765.560) (-766.947) [-767.502] (-768.526) * (-767.251) (-767.382) (-769.355) [-772.257] -- 0:00:09
Average standard deviation of split frequencies: 0.007426
850500 -- (-766.769) (-768.749) [-766.778] (-766.365) * (-767.343) (-767.161) (-765.440) [-770.626] -- 0:00:09
851000 -- (-769.524) (-766.792) (-767.633) [-766.593] * [-765.471] (-767.335) (-767.023) (-766.167) -- 0:00:09
851500 -- (-773.289) [-766.418] (-765.153) (-765.603) * (-767.680) (-769.694) (-766.020) [-765.497] -- 0:00:09
852000 -- (-767.853) (-766.303) (-765.156) [-767.351] * (-767.298) (-765.253) [-765.629] (-768.299) -- 0:00:09
852500 -- (-767.362) (-769.044) (-767.026) [-767.686] * (-766.630) [-764.864] (-767.940) (-765.397) -- 0:00:09
853000 -- (-766.143) [-766.239] (-765.748) (-766.257) * (-765.177) (-764.862) [-766.277] (-766.335) -- 0:00:09
853500 -- (-767.570) (-767.780) (-767.515) [-767.860] * (-770.690) [-764.864] (-766.650) (-766.482) -- 0:00:09
854000 -- (-770.635) (-768.053) [-767.519] (-767.148) * (-767.507) (-768.092) (-768.251) [-766.503] -- 0:00:09
854500 -- [-768.826] (-769.306) (-766.174) (-765.623) * [-766.846] (-765.839) (-769.078) (-765.257) -- 0:00:09
855000 -- (-767.301) [-767.221] (-767.106) (-765.759) * [-768.460] (-767.129) (-766.537) (-767.751) -- 0:00:09
Average standard deviation of split frequencies: 0.008004
855500 -- (-765.450) (-766.499) [-766.654] (-766.138) * (-768.889) [-765.552] (-768.729) (-767.637) -- 0:00:09
856000 -- (-766.441) (-767.121) [-765.295] (-766.870) * (-769.369) (-767.975) (-767.464) [-770.136] -- 0:00:09
856500 -- [-764.935] (-769.334) (-765.486) (-766.964) * (-765.968) [-771.952] (-769.333) (-768.785) -- 0:00:09
857000 -- [-766.405] (-766.824) (-765.917) (-765.095) * [-765.547] (-769.336) (-766.236) (-769.830) -- 0:00:09
857500 -- (-765.643) [-766.208] (-769.484) (-765.860) * (-767.962) [-769.377] (-765.254) (-767.185) -- 0:00:09
858000 -- (-771.026) (-766.754) [-766.016] (-768.564) * (-766.971) (-766.666) [-765.227] (-765.911) -- 0:00:09
858500 -- [-767.646] (-767.624) (-769.486) (-766.756) * (-765.809) [-767.406] (-766.662) (-765.008) -- 0:00:09
859000 -- (-767.048) [-767.145] (-765.650) (-766.686) * (-766.988) (-770.438) (-767.124) [-767.432] -- 0:00:09
859500 -- (-765.335) (-770.056) [-769.326] (-770.946) * [-765.736] (-766.986) (-767.108) (-766.637) -- 0:00:09
860000 -- (-766.531) [-764.972] (-766.742) (-768.918) * [-765.592] (-768.303) (-766.112) (-770.681) -- 0:00:09
Average standard deviation of split frequencies: 0.008033
860500 -- (-767.870) (-766.853) (-766.108) [-767.957] * (-765.190) [-767.116] (-765.401) (-767.160) -- 0:00:09
861000 -- [-768.200] (-766.349) (-766.657) (-765.664) * (-766.038) [-767.272] (-767.942) (-766.518) -- 0:00:09
861500 -- (-767.243) [-766.036] (-764.889) (-765.348) * (-767.549) (-765.392) [-766.754] (-766.835) -- 0:00:09
862000 -- (-767.466) [-768.880] (-766.149) (-764.855) * (-765.469) (-765.630) (-770.213) [-766.536] -- 0:00:09
862500 -- [-765.834] (-770.871) (-772.829) (-765.677) * [-766.296] (-765.959) (-771.902) (-771.230) -- 0:00:09
863000 -- (-765.628) (-767.829) (-768.693) [-766.412] * (-766.058) (-765.934) [-766.206] (-770.259) -- 0:00:09
863500 -- [-768.773] (-767.280) (-770.868) (-767.728) * (-764.967) [-767.075] (-769.437) (-771.117) -- 0:00:09
864000 -- [-765.016] (-768.144) (-770.135) (-768.663) * (-765.458) (-766.319) [-767.698] (-767.266) -- 0:00:08
864500 -- [-765.070] (-767.477) (-766.638) (-766.217) * [-765.653] (-767.045) (-768.350) (-766.329) -- 0:00:08
865000 -- (-765.501) (-766.991) [-765.776] (-768.575) * (-769.496) (-768.283) [-767.438] (-766.454) -- 0:00:08
Average standard deviation of split frequencies: 0.007911
865500 -- (-767.322) (-767.183) (-766.426) [-767.333] * (-768.909) [-765.917] (-766.980) (-772.901) -- 0:00:08
866000 -- (-768.966) (-773.101) [-764.742] (-765.765) * (-765.948) (-767.331) [-765.424] (-769.440) -- 0:00:08
866500 -- (-766.850) [-766.926] (-764.863) (-769.025) * [-768.016] (-767.198) (-765.722) (-767.964) -- 0:00:08
867000 -- (-766.098) (-767.968) [-768.649] (-765.659) * (-767.303) (-767.623) [-766.058] (-765.354) -- 0:00:08
867500 -- (-773.404) (-768.109) [-768.922] (-770.956) * (-766.013) [-770.497] (-767.229) (-766.627) -- 0:00:08
868000 -- (-770.425) (-767.811) [-765.969] (-768.389) * (-765.780) [-765.123] (-765.750) (-769.164) -- 0:00:08
868500 -- (-767.819) (-767.296) [-765.949] (-768.953) * (-767.604) [-766.150] (-768.456) (-768.736) -- 0:00:08
869000 -- (-766.470) (-766.597) [-768.275] (-768.664) * (-766.796) [-766.497] (-766.106) (-768.951) -- 0:00:08
869500 -- (-767.553) (-765.229) (-765.212) [-767.369] * (-765.765) [-766.513] (-765.081) (-767.775) -- 0:00:08
870000 -- (-766.204) (-766.980) [-765.524] (-767.725) * [-766.040] (-769.756) (-764.941) (-765.947) -- 0:00:08
Average standard deviation of split frequencies: 0.007797
870500 -- (-765.775) (-767.363) [-766.582] (-766.107) * (-765.014) [-765.473] (-766.296) (-766.971) -- 0:00:08
871000 -- (-769.348) (-766.340) (-768.023) [-767.154] * [-765.268] (-765.500) (-766.447) (-769.041) -- 0:00:08
871500 -- [-768.067] (-766.092) (-768.038) (-767.666) * [-766.457] (-769.076) (-767.876) (-767.131) -- 0:00:08
872000 -- (-765.188) (-765.900) (-765.056) [-767.068] * (-768.931) (-767.161) [-767.020] (-764.937) -- 0:00:08
872500 -- (-765.679) [-766.325] (-766.797) (-768.722) * (-767.364) (-765.938) [-764.732] (-767.682) -- 0:00:08
873000 -- (-767.836) (-765.894) [-765.473] (-768.653) * (-768.329) (-764.596) [-766.635] (-767.549) -- 0:00:08
873500 -- (-772.347) (-772.270) (-767.860) [-767.631] * (-767.157) [-765.497] (-764.873) (-767.362) -- 0:00:08
874000 -- (-768.956) (-767.478) [-764.718] (-765.807) * (-767.277) [-767.160] (-765.018) (-770.240) -- 0:00:08
874500 -- (-765.908) [-766.558] (-765.427) (-765.542) * (-765.932) [-767.498] (-768.644) (-768.915) -- 0:00:08
875000 -- (-767.032) (-767.359) [-765.592] (-769.171) * (-765.892) (-767.981) (-767.504) [-765.890] -- 0:00:08
Average standard deviation of split frequencies: 0.007677
875500 -- (-768.617) (-767.675) (-765.493) [-766.677] * [-766.931] (-766.831) (-765.738) (-766.286) -- 0:00:08
876000 -- (-773.094) (-766.713) (-767.299) [-766.665] * (-765.390) [-766.903] (-765.361) (-765.510) -- 0:00:08
876500 -- (-768.307) (-769.455) (-768.827) [-766.912] * (-770.907) (-770.113) (-765.163) [-765.540] -- 0:00:08
877000 -- [-769.689] (-768.885) (-765.756) (-768.350) * (-772.067) (-770.514) (-765.766) [-767.083] -- 0:00:08
877500 -- (-769.359) (-769.099) [-768.869] (-766.654) * [-766.623] (-771.637) (-770.185) (-770.779) -- 0:00:08
878000 -- (-768.346) (-767.631) [-764.719] (-765.897) * (-768.800) [-765.926] (-766.813) (-770.545) -- 0:00:08
878500 -- (-765.112) (-765.932) (-764.684) [-765.833] * (-765.712) (-772.394) [-769.733] (-768.057) -- 0:00:08
879000 -- (-764.883) (-765.596) (-768.029) [-765.876] * (-766.614) [-769.078] (-767.110) (-766.445) -- 0:00:07
879500 -- [-764.800] (-765.720) (-766.697) (-771.684) * [-767.950] (-765.736) (-766.781) (-766.622) -- 0:00:07
880000 -- (-765.218) (-768.994) (-766.862) [-766.986] * [-765.725] (-765.565) (-766.954) (-768.805) -- 0:00:07
Average standard deviation of split frequencies: 0.007672
880500 -- (-765.138) (-766.233) (-765.780) [-764.970] * (-767.404) (-765.480) (-771.279) [-767.596] -- 0:00:07
881000 -- (-766.403) (-767.354) (-765.330) [-769.310] * (-767.976) (-767.275) (-768.480) [-766.434] -- 0:00:07
881500 -- (-766.103) (-766.895) [-765.925] (-769.508) * [-770.678] (-769.486) (-765.550) (-766.607) -- 0:00:07
882000 -- (-765.808) (-767.206) (-766.186) [-766.292] * (-765.890) (-768.622) (-766.544) [-765.023] -- 0:00:07
882500 -- (-767.173) (-768.180) (-764.898) [-765.878] * (-766.211) (-768.764) (-768.139) [-766.310] -- 0:00:07
883000 -- [-766.846] (-766.729) (-765.282) (-768.053) * [-765.666] (-767.889) (-766.483) (-767.512) -- 0:00:07
883500 -- [-771.547] (-766.505) (-767.588) (-765.752) * (-766.024) [-767.768] (-769.178) (-771.654) -- 0:00:07
884000 -- [-765.008] (-764.893) (-766.234) (-765.811) * (-770.499) [-770.366] (-766.204) (-768.937) -- 0:00:07
884500 -- (-766.897) (-764.950) (-766.116) [-766.972] * (-764.955) [-765.958] (-766.415) (-767.698) -- 0:00:07
885000 -- (-771.482) (-764.957) [-765.445] (-768.998) * (-764.931) (-765.143) [-767.757] (-768.896) -- 0:00:07
Average standard deviation of split frequencies: 0.007945
885500 -- (-766.865) (-767.681) [-764.777] (-768.125) * [-766.465] (-767.392) (-772.460) (-765.627) -- 0:00:07
886000 -- [-767.701] (-766.238) (-766.353) (-766.541) * (-767.889) (-769.230) (-770.317) [-767.269] -- 0:00:07
886500 -- [-767.343] (-766.166) (-767.593) (-767.668) * [-766.945] (-766.274) (-770.647) (-766.831) -- 0:00:07
887000 -- (-766.527) (-766.004) [-766.849] (-765.248) * (-765.884) [-768.502] (-767.245) (-767.675) -- 0:00:07
887500 -- (-766.284) [-767.629] (-767.797) (-766.373) * (-765.650) [-766.098] (-769.636) (-769.299) -- 0:00:07
888000 -- (-765.928) [-765.357] (-765.133) (-765.227) * (-766.143) (-765.400) [-765.372] (-766.137) -- 0:00:07
888500 -- (-767.688) [-766.415] (-767.552) (-767.080) * (-768.558) (-765.877) [-766.468] (-766.800) -- 0:00:07
889000 -- [-771.091] (-770.145) (-768.422) (-769.654) * (-766.975) (-766.228) (-766.396) [-767.478] -- 0:00:07
889500 -- (-777.522) (-766.841) (-765.301) [-766.366] * [-766.374] (-769.784) (-767.831) (-767.312) -- 0:00:07
890000 -- (-777.407) [-769.909] (-765.861) (-767.214) * (-766.622) (-767.798) (-767.573) [-765.733] -- 0:00:07
Average standard deviation of split frequencies: 0.008080
890500 -- [-767.457] (-768.143) (-768.859) (-766.992) * (-769.187) (-766.130) (-767.834) [-766.252] -- 0:00:07
891000 -- (-766.956) [-768.717] (-767.675) (-765.478) * [-772.707] (-765.648) (-766.960) (-767.439) -- 0:00:07
891500 -- [-765.919] (-768.122) (-769.468) (-765.190) * (-767.561) (-767.332) [-769.964] (-765.608) -- 0:00:07
892000 -- [-766.016] (-767.599) (-766.758) (-766.634) * (-766.308) (-767.351) [-768.209] (-765.222) -- 0:00:07
892500 -- [-764.909] (-766.806) (-767.353) (-764.842) * (-766.303) (-766.455) [-767.192] (-766.424) -- 0:00:07
893000 -- (-764.920) [-765.264] (-767.550) (-766.580) * (-766.489) (-766.541) (-768.103) [-765.520] -- 0:00:07
893500 -- (-765.075) (-766.647) [-767.881] (-765.990) * (-764.925) (-765.625) (-765.765) [-765.845] -- 0:00:07
894000 -- [-765.989] (-766.565) (-766.510) (-767.022) * (-770.153) [-765.700] (-771.251) (-768.422) -- 0:00:06
894500 -- (-766.335) (-766.203) [-771.147] (-768.105) * (-767.341) (-766.790) (-768.010) [-766.185] -- 0:00:06
895000 -- (-766.924) [-764.768] (-769.050) (-765.236) * (-767.298) (-766.494) [-766.320] (-768.871) -- 0:00:06
Average standard deviation of split frequencies: 0.007646
895500 -- (-767.680) (-765.902) (-771.850) [-766.178] * (-768.468) (-766.811) [-767.366] (-770.129) -- 0:00:06
896000 -- (-765.265) (-770.147) [-765.425] (-766.174) * (-765.390) (-766.745) (-766.806) [-766.383] -- 0:00:06
896500 -- (-766.563) (-766.420) [-766.385] (-766.100) * (-765.878) (-772.056) (-767.688) [-765.063] -- 0:00:06
897000 -- (-769.506) (-766.377) [-771.346] (-766.260) * [-767.074] (-764.803) (-766.304) (-767.157) -- 0:00:06
897500 -- (-765.701) [-767.943] (-765.462) (-768.128) * (-766.868) (-766.138) (-765.725) [-766.203] -- 0:00:06
898000 -- [-766.581] (-765.259) (-766.872) (-765.395) * (-766.783) [-764.824] (-769.182) (-765.509) -- 0:00:06
898500 -- (-768.007) [-769.980] (-769.354) (-765.127) * (-766.761) (-765.508) (-768.542) [-767.931] -- 0:00:06
899000 -- (-766.842) [-767.623] (-773.011) (-765.942) * (-766.269) [-767.122] (-765.015) (-769.811) -- 0:00:06
899500 -- (-770.055) (-766.138) [-770.250] (-765.421) * (-765.328) [-766.990] (-767.476) (-768.052) -- 0:00:06
900000 -- [-765.503] (-766.744) (-769.972) (-765.952) * (-766.571) [-765.790] (-765.677) (-766.876) -- 0:00:06
Average standard deviation of split frequencies: 0.007990
900500 -- (-766.762) (-767.856) (-774.128) [-769.988] * (-767.055) [-764.773] (-766.767) (-768.223) -- 0:00:06
901000 -- [-767.038] (-765.590) (-767.087) (-770.175) * (-767.217) (-765.458) [-766.341] (-769.713) -- 0:00:06
901500 -- (-767.651) (-766.133) (-769.151) [-767.166] * [-766.143] (-765.673) (-766.235) (-771.236) -- 0:00:06
902000 -- (-765.174) (-766.527) (-766.932) [-767.146] * (-769.707) [-766.553] (-767.757) (-767.613) -- 0:00:06
902500 -- (-766.107) (-775.677) [-767.100] (-767.069) * [-765.310] (-766.206) (-767.986) (-765.756) -- 0:00:06
903000 -- (-765.006) (-766.545) [-768.513] (-765.051) * (-766.209) [-765.698] (-770.655) (-766.097) -- 0:00:06
903500 -- (-768.818) (-766.738) (-765.430) [-765.552] * [-766.494] (-767.522) (-765.530) (-766.045) -- 0:00:06
904000 -- [-765.446] (-765.941) (-765.862) (-766.072) * (-765.676) [-767.218] (-769.741) (-767.003) -- 0:00:06
904500 -- [-766.512] (-765.791) (-767.595) (-766.438) * (-765.799) [-766.354] (-764.836) (-767.084) -- 0:00:06
905000 -- (-766.207) (-766.616) (-766.314) [-766.411] * (-772.654) (-767.156) [-764.794] (-766.751) -- 0:00:06
Average standard deviation of split frequencies: 0.007978
905500 -- (-769.533) [-766.880] (-770.721) (-770.810) * (-765.895) (-765.452) (-765.099) [-769.791] -- 0:00:06
906000 -- [-768.024] (-765.486) (-769.306) (-768.379) * (-768.118) (-765.955) (-766.420) [-768.405] -- 0:00:06
906500 -- (-770.729) [-766.190] (-770.386) (-769.720) * (-768.984) [-765.882] (-767.833) (-768.350) -- 0:00:06
907000 -- (-769.013) (-769.721) (-765.738) [-766.138] * (-765.294) (-768.552) [-766.829] (-766.312) -- 0:00:06
907500 -- (-767.094) [-766.062] (-766.324) (-765.032) * [-766.054] (-765.560) (-766.418) (-766.114) -- 0:00:06
908000 -- (-766.795) (-766.241) (-765.872) [-765.301] * (-767.076) (-766.942) [-773.166] (-767.032) -- 0:00:06
908500 -- [-767.496] (-767.939) (-768.067) (-764.953) * (-766.373) (-765.789) (-766.762) [-764.947] -- 0:00:06
909000 -- (-767.577) (-772.067) [-766.180] (-766.316) * (-766.593) (-765.848) (-766.720) [-764.792] -- 0:00:06
909500 -- (-769.212) [-767.250] (-766.027) (-766.319) * (-765.252) (-765.531) [-768.083] (-765.730) -- 0:00:05
910000 -- [-767.439] (-768.832) (-764.964) (-768.127) * (-765.572) (-766.408) [-769.475] (-767.818) -- 0:00:05
Average standard deviation of split frequencies: 0.007799
910500 -- (-767.226) [-768.809] (-769.316) (-769.583) * (-773.489) [-766.406] (-766.284) (-765.948) -- 0:00:05
911000 -- (-766.153) [-768.178] (-768.051) (-766.688) * (-769.973) (-764.578) (-770.540) [-766.374] -- 0:00:05
911500 -- [-766.042] (-764.990) (-766.995) (-766.616) * (-765.966) (-768.765) (-768.890) [-766.925] -- 0:00:05
912000 -- (-765.568) (-772.359) [-766.167] (-765.150) * (-765.487) [-765.910] (-773.057) (-767.321) -- 0:00:05
912500 -- (-766.480) [-773.432] (-766.002) (-767.459) * [-765.866] (-765.339) (-767.119) (-767.040) -- 0:00:05
913000 -- [-766.627] (-765.975) (-767.940) (-766.057) * (-765.220) (-769.710) [-766.304] (-770.252) -- 0:00:05
913500 -- (-767.057) (-768.308) [-769.403] (-771.445) * (-765.168) [-765.017] (-765.760) (-771.715) -- 0:00:05
914000 -- [-765.277] (-767.604) (-768.397) (-768.356) * (-766.217) [-767.601] (-766.805) (-766.993) -- 0:00:05
914500 -- (-767.749) [-768.936] (-769.597) (-767.508) * (-766.504) (-767.110) [-764.827] (-771.610) -- 0:00:05
915000 -- (-767.428) [-767.164] (-771.385) (-768.513) * (-767.785) (-770.274) [-765.565] (-766.939) -- 0:00:05
Average standard deviation of split frequencies: 0.008063
915500 -- (-767.631) [-767.042] (-769.756) (-767.580) * (-768.219) (-774.768) (-766.220) [-765.101] -- 0:00:05
916000 -- (-767.505) (-766.756) (-766.532) [-765.508] * [-769.065] (-766.291) (-770.887) (-765.405) -- 0:00:05
916500 -- (-766.770) (-766.302) [-768.649] (-766.366) * (-767.232) (-765.195) [-773.046] (-765.385) -- 0:00:05
917000 -- (-767.966) (-766.869) (-768.860) [-766.209] * (-765.053) (-765.003) [-768.484] (-771.918) -- 0:00:05
917500 -- (-767.448) [-766.817] (-765.380) (-766.030) * (-766.627) (-765.171) (-767.101) [-767.089] -- 0:00:05
918000 -- (-768.073) (-765.483) [-768.415] (-772.489) * [-765.587] (-766.055) (-766.717) (-765.378) -- 0:00:05
918500 -- (-767.251) (-765.751) (-769.564) [-768.578] * (-765.305) (-765.551) (-767.930) [-765.686] -- 0:00:05
919000 -- [-765.278] (-765.829) (-766.648) (-766.797) * (-768.046) (-765.454) (-766.183) [-766.854] -- 0:00:05
919500 -- (-769.049) [-765.772] (-766.323) (-768.520) * (-765.989) (-766.134) [-766.293] (-765.155) -- 0:00:05
920000 -- [-766.452] (-768.889) (-765.214) (-765.779) * (-767.604) [-765.649] (-768.746) (-767.432) -- 0:00:05
Average standard deviation of split frequencies: 0.007510
920500 -- (-768.762) (-773.102) (-765.871) [-768.225] * (-764.938) (-765.301) (-767.608) [-766.723] -- 0:00:05
921000 -- (-766.113) (-771.740) (-768.425) [-766.168] * (-769.545) (-766.289) [-770.974] (-767.607) -- 0:00:05
921500 -- (-765.771) (-767.663) [-767.362] (-765.113) * (-765.442) (-768.631) [-766.156] (-766.272) -- 0:00:05
922000 -- [-766.748] (-768.128) (-768.886) (-764.821) * (-767.650) (-770.542) (-769.262) [-769.330] -- 0:00:05
922500 -- [-766.255] (-766.754) (-769.827) (-764.597) * (-766.358) [-766.708] (-768.510) (-766.636) -- 0:00:05
923000 -- (-768.625) (-765.531) (-768.855) [-765.996] * (-769.075) [-765.439] (-764.826) (-768.410) -- 0:00:05
923500 -- (-767.108) (-765.546) [-766.811] (-766.362) * (-765.689) (-765.436) [-765.555] (-768.657) -- 0:00:05
924000 -- [-766.092] (-770.028) (-766.635) (-766.552) * (-771.758) (-766.776) [-764.794] (-764.560) -- 0:00:05
924500 -- [-765.832] (-770.115) (-765.735) (-765.062) * (-773.079) (-765.378) (-765.561) [-766.770] -- 0:00:04
925000 -- (-766.238) (-767.601) (-765.828) [-764.859] * (-769.915) [-766.007] (-768.333) (-771.163) -- 0:00:04
Average standard deviation of split frequencies: 0.007093
925500 -- (-766.132) (-766.476) [-765.855] (-764.857) * (-768.071) (-765.071) (-767.967) [-771.711] -- 0:00:04
926000 -- (-766.130) [-768.945] (-767.095) (-765.854) * (-765.502) (-765.589) [-767.559] (-766.003) -- 0:00:04
926500 -- (-766.513) [-766.830] (-773.421) (-765.797) * (-766.070) (-765.805) [-767.564] (-768.379) -- 0:00:04
927000 -- (-767.503) [-766.311] (-766.347) (-767.982) * (-766.045) (-767.696) [-767.957] (-768.133) -- 0:00:04
927500 -- (-765.390) [-766.313] (-765.767) (-770.007) * (-767.337) (-765.706) (-769.938) [-766.057] -- 0:00:04
928000 -- (-765.375) (-765.849) [-767.475] (-767.657) * (-770.045) [-765.751] (-767.203) (-769.048) -- 0:00:04
928500 -- (-765.700) [-765.488] (-767.805) (-766.104) * [-766.655] (-766.843) (-766.757) (-771.439) -- 0:00:04
929000 -- [-768.930] (-765.505) (-768.364) (-765.867) * [-766.256] (-765.889) (-766.084) (-771.032) -- 0:00:04
929500 -- (-769.075) [-765.894] (-768.428) (-769.225) * [-766.546] (-766.357) (-765.667) (-766.311) -- 0:00:04
930000 -- (-767.455) [-766.066] (-767.319) (-770.904) * (-767.739) (-769.445) [-766.152] (-766.782) -- 0:00:04
Average standard deviation of split frequencies: 0.006720
930500 -- (-765.884) [-766.852] (-765.578) (-767.517) * (-765.358) (-772.225) (-765.886) [-767.859] -- 0:00:04
931000 -- [-766.893] (-766.892) (-765.470) (-766.083) * (-767.099) [-766.488] (-766.196) (-766.352) -- 0:00:04
931500 -- [-767.541] (-766.422) (-765.938) (-767.990) * [-767.360] (-767.020) (-766.936) (-768.376) -- 0:00:04
932000 -- (-768.335) (-766.593) [-767.795] (-765.289) * [-768.721] (-767.655) (-766.659) (-765.788) -- 0:00:04
932500 -- (-767.641) (-769.156) [-768.111] (-766.626) * (-769.451) [-769.207] (-765.412) (-767.104) -- 0:00:04
933000 -- (-765.551) (-766.650) (-766.577) [-765.418] * (-768.437) (-766.251) [-765.842] (-768.161) -- 0:00:04
933500 -- (-764.987) (-771.639) [-765.480] (-768.917) * (-768.041) (-766.190) [-769.804] (-768.480) -- 0:00:04
934000 -- (-766.423) (-766.081) (-765.537) [-770.685] * (-767.681) (-766.547) (-768.084) [-768.479] -- 0:00:04
934500 -- (-764.911) (-770.240) [-766.219] (-766.106) * (-766.003) (-765.434) (-766.125) [-765.510] -- 0:00:04
935000 -- (-766.255) (-767.590) [-764.809] (-771.943) * (-765.729) [-767.921] (-766.249) (-766.287) -- 0:00:04
Average standard deviation of split frequencies: 0.006782
935500 -- (-770.595) [-765.672] (-766.824) (-765.199) * (-769.636) (-771.579) (-768.040) [-767.021] -- 0:00:04
936000 -- (-766.218) (-765.628) [-765.056] (-767.191) * [-764.999] (-768.370) (-766.395) (-766.512) -- 0:00:04
936500 -- (-766.937) (-769.123) [-765.344] (-767.723) * (-764.946) (-766.229) [-765.142] (-769.942) -- 0:00:04
937000 -- (-765.277) (-769.150) (-767.210) [-765.651] * [-765.466] (-769.752) (-766.581) (-767.820) -- 0:00:04
937500 -- (-769.092) (-768.540) [-765.217] (-768.729) * (-768.468) (-769.571) (-766.989) [-768.212] -- 0:00:04
938000 -- (-767.427) [-766.057] (-766.650) (-767.915) * (-765.236) (-767.364) (-769.956) [-765.429] -- 0:00:04
938500 -- (-769.463) [-768.941] (-766.629) (-764.989) * (-765.511) [-771.081] (-764.589) (-767.491) -- 0:00:04
939000 -- (-765.707) (-768.250) [-768.230] (-765.697) * (-764.805) [-767.285] (-766.183) (-765.968) -- 0:00:04
939500 -- (-769.561) (-768.520) [-766.707] (-766.954) * [-764.812] (-767.322) (-767.924) (-768.503) -- 0:00:03
940000 -- (-768.050) (-767.599) (-768.173) [-768.435] * (-765.050) [-767.332] (-770.112) (-766.416) -- 0:00:03
Average standard deviation of split frequencies: 0.006949
940500 -- (-766.188) (-765.530) (-764.974) [-765.863] * (-767.368) (-766.687) (-770.808) [-766.287] -- 0:00:03
941000 -- (-767.515) [-766.200] (-766.291) (-767.123) * (-767.753) [-765.184] (-765.518) (-767.712) -- 0:00:03
941500 -- [-767.305] (-766.937) (-766.311) (-767.571) * [-764.908] (-768.451) (-765.803) (-766.133) -- 0:00:03
942000 -- (-768.241) [-765.916] (-767.404) (-767.012) * [-766.291] (-770.523) (-766.150) (-765.982) -- 0:00:03
942500 -- (-768.592) [-766.513] (-767.701) (-768.659) * (-767.319) (-771.444) (-767.053) [-767.177] -- 0:00:03
943000 -- (-765.919) (-764.894) [-767.661] (-767.377) * (-769.616) (-766.793) [-767.293] (-767.882) -- 0:00:03
943500 -- (-765.319) (-765.682) (-769.166) [-766.772] * (-767.771) [-766.880] (-766.431) (-766.363) -- 0:00:03
944000 -- [-764.651] (-766.709) (-765.549) (-768.282) * (-765.839) [-766.529] (-765.549) (-768.943) -- 0:00:03
944500 -- (-764.909) (-766.979) (-767.543) [-767.917] * (-764.698) [-765.819] (-766.554) (-765.373) -- 0:00:03
945000 -- (-765.435) (-767.863) [-765.257] (-767.687) * (-764.982) (-766.633) (-765.586) [-766.536] -- 0:00:03
Average standard deviation of split frequencies: 0.006844
945500 -- (-766.445) (-769.645) (-767.251) [-764.927] * (-776.173) (-765.418) (-769.759) [-766.424] -- 0:00:03
946000 -- (-765.131) (-769.080) [-771.569] (-767.932) * (-766.351) [-769.132] (-771.059) (-765.779) -- 0:00:03
946500 -- [-765.630] (-767.833) (-766.779) (-766.428) * [-766.204] (-766.552) (-766.584) (-766.525) -- 0:00:03
947000 -- (-769.706) (-764.756) (-766.601) [-766.180] * (-768.188) (-767.948) [-766.528] (-766.590) -- 0:00:03
947500 -- (-765.551) [-767.718] (-769.159) (-765.388) * (-764.903) [-765.866] (-769.034) (-766.621) -- 0:00:03
948000 -- (-768.527) (-772.684) (-766.446) [-767.554] * (-765.780) [-768.134] (-773.363) (-768.606) -- 0:00:03
948500 -- (-765.351) (-771.411) [-768.112] (-771.438) * [-769.077] (-770.168) (-770.317) (-766.858) -- 0:00:03
949000 -- [-765.891] (-769.848) (-767.947) (-766.007) * [-765.333] (-770.795) (-765.434) (-768.199) -- 0:00:03
949500 -- (-765.426) (-767.591) [-769.025] (-766.281) * (-766.568) [-768.019] (-766.138) (-767.393) -- 0:00:03
950000 -- [-765.792] (-766.274) (-770.914) (-765.872) * (-766.646) (-766.845) [-765.437] (-767.181) -- 0:00:03
Average standard deviation of split frequencies: 0.006744
950500 -- (-768.384) (-767.743) (-768.504) [-770.506] * [-767.681] (-766.790) (-770.162) (-772.182) -- 0:00:03
951000 -- (-769.874) (-769.043) (-767.229) [-764.934] * (-767.807) [-767.388] (-766.213) (-768.472) -- 0:00:03
951500 -- [-766.023] (-766.868) (-765.966) (-772.252) * (-766.724) (-771.018) [-765.391] (-766.365) -- 0:00:03
952000 -- [-765.567] (-768.273) (-766.033) (-766.210) * [-767.367] (-768.544) (-770.918) (-764.668) -- 0:00:03
952500 -- (-765.248) (-768.783) [-767.470] (-766.600) * (-767.470) (-766.991) (-767.149) [-765.995] -- 0:00:03
953000 -- (-766.691) [-766.020] (-768.561) (-767.230) * [-765.969] (-764.737) (-766.254) (-766.641) -- 0:00:03
953500 -- (-766.094) (-765.761) (-768.574) [-767.554] * (-766.810) (-766.101) (-770.549) [-767.241] -- 0:00:03
954000 -- [-766.133] (-766.961) (-768.349) (-767.234) * [-764.861] (-765.026) (-765.032) (-766.540) -- 0:00:03
954500 -- (-765.456) [-767.161] (-767.429) (-766.746) * (-770.487) [-765.336] (-767.171) (-767.003) -- 0:00:03
955000 -- (-767.783) (-765.945) [-765.605] (-765.354) * (-766.765) [-765.603] (-767.118) (-767.481) -- 0:00:02
Average standard deviation of split frequencies: 0.006838
955500 -- [-764.942] (-765.436) (-766.466) (-767.649) * (-766.188) (-767.229) [-766.629] (-766.740) -- 0:00:02
956000 -- [-768.824] (-765.847) (-766.645) (-765.739) * [-768.190] (-771.275) (-766.858) (-766.740) -- 0:00:02
956500 -- (-766.123) (-766.566) [-765.979] (-768.347) * (-765.157) [-768.444] (-766.369) (-768.155) -- 0:00:02
957000 -- [-766.756] (-766.518) (-765.106) (-768.943) * (-767.101) (-767.307) [-765.950] (-766.825) -- 0:00:02
957500 -- [-771.314] (-765.356) (-766.576) (-766.172) * [-766.453] (-768.525) (-765.327) (-769.721) -- 0:00:02
958000 -- [-769.479] (-766.243) (-768.882) (-770.299) * (-765.368) (-772.878) [-767.576] (-765.216) -- 0:00:02
958500 -- [-764.910] (-768.834) (-767.228) (-767.395) * (-764.866) (-767.697) (-767.021) [-768.643] -- 0:00:02
959000 -- (-774.357) [-767.464] (-773.512) (-766.294) * (-769.269) (-767.049) [-769.829] (-770.327) -- 0:00:02
959500 -- (-770.222) (-766.163) [-765.256] (-766.806) * [-766.813] (-765.723) (-766.696) (-768.285) -- 0:00:02
960000 -- (-766.782) (-765.821) (-766.469) [-766.615] * [-765.329] (-768.731) (-769.726) (-777.423) -- 0:00:02
Average standard deviation of split frequencies: 0.006968
960500 -- [-765.963] (-767.250) (-765.960) (-766.606) * (-765.360) [-769.572] (-776.376) (-767.043) -- 0:00:02
961000 -- (-770.728) [-765.523] (-767.121) (-766.941) * (-774.178) (-768.191) (-774.315) [-767.835] -- 0:00:02
961500 -- (-768.598) [-765.113] (-766.958) (-768.370) * [-765.246] (-767.907) (-774.459) (-769.639) -- 0:00:02
962000 -- (-766.702) (-765.459) (-768.819) [-769.336] * (-771.115) [-767.463] (-768.896) (-767.039) -- 0:00:02
962500 -- (-767.627) [-766.757] (-768.576) (-765.821) * [-766.781] (-766.741) (-765.815) (-766.700) -- 0:00:02
963000 -- (-765.288) (-768.402) (-765.989) [-767.627] * (-766.958) (-765.511) (-765.361) [-766.295] -- 0:00:02
963500 -- (-766.741) (-766.897) [-767.052] (-770.468) * [-767.021] (-768.294) (-764.746) (-765.274) -- 0:00:02
964000 -- [-765.680] (-767.132) (-767.539) (-765.434) * (-769.322) (-766.153) [-765.120] (-766.245) -- 0:00:02
964500 -- (-767.332) (-765.356) [-767.469] (-769.012) * (-767.729) [-765.647] (-767.460) (-768.896) -- 0:00:02
965000 -- (-767.125) (-765.741) [-766.607] (-767.355) * (-767.828) (-767.217) (-772.996) [-766.029] -- 0:00:02
Average standard deviation of split frequencies: 0.007027
965500 -- (-769.095) (-768.016) (-765.785) [-766.802] * (-766.988) (-767.627) (-767.384) [-766.487] -- 0:00:02
966000 -- (-768.798) (-765.797) [-765.526] (-766.370) * [-765.833] (-767.997) (-766.428) (-765.583) -- 0:00:02
966500 -- [-765.484] (-771.785) (-765.910) (-766.131) * [-767.026] (-766.494) (-769.227) (-767.757) -- 0:00:02
967000 -- (-768.033) (-766.420) (-768.544) [-768.026] * [-765.564] (-765.246) (-766.916) (-766.710) -- 0:00:02
967500 -- (-766.204) (-766.658) [-765.910] (-766.544) * (-767.197) (-771.298) (-768.180) [-767.049] -- 0:00:02
968000 -- (-768.698) (-766.889) (-765.922) [-766.568] * (-767.004) [-765.667] (-767.458) (-766.458) -- 0:00:02
968500 -- (-767.442) [-771.159] (-766.737) (-768.125) * [-765.768] (-766.029) (-766.371) (-766.985) -- 0:00:02
969000 -- (-765.413) (-768.408) (-769.083) [-765.891] * (-770.449) (-765.494) (-770.781) [-765.914] -- 0:00:02
969500 -- (-765.285) (-767.414) (-766.139) [-767.478] * (-768.372) (-768.948) (-768.461) [-766.299] -- 0:00:02
970000 -- [-765.648] (-768.753) (-766.318) (-766.516) * (-765.132) (-765.996) (-768.958) [-765.947] -- 0:00:01
Average standard deviation of split frequencies: 0.007382
970500 -- (-765.971) (-767.862) (-767.667) [-765.583] * (-766.104) (-765.591) [-768.747] (-771.271) -- 0:00:01
971000 -- (-769.161) (-765.565) (-768.749) [-764.889] * (-765.045) (-766.547) (-765.876) [-770.303] -- 0:00:01
971500 -- (-767.612) (-767.996) (-765.652) [-765.531] * [-765.881] (-767.129) (-769.392) (-771.796) -- 0:00:01
972000 -- [-766.805] (-768.507) (-767.361) (-766.835) * (-766.048) (-769.442) (-767.468) [-767.469] -- 0:00:01
972500 -- [-769.218] (-767.630) (-765.583) (-766.346) * [-770.447] (-768.399) (-771.277) (-765.256) -- 0:00:01
973000 -- (-767.118) (-766.245) (-769.617) [-765.071] * (-770.959) [-765.898] (-767.201) (-766.830) -- 0:00:01
973500 -- (-767.162) (-768.945) [-766.276] (-767.233) * (-766.045) [-765.582] (-770.671) (-766.623) -- 0:00:01
974000 -- [-768.959] (-770.110) (-768.225) (-772.917) * (-766.245) (-765.378) (-765.971) [-766.554] -- 0:00:01
974500 -- (-767.534) (-766.801) [-766.896] (-771.531) * [-765.113] (-770.461) (-765.902) (-770.741) -- 0:00:01
975000 -- (-770.068) (-770.800) (-766.244) [-766.459] * (-765.155) (-766.222) (-765.789) [-765.497] -- 0:00:01
Average standard deviation of split frequencies: 0.007020
975500 -- (-768.837) (-769.852) [-765.159] (-767.212) * (-766.568) (-767.386) [-765.093] (-769.129) -- 0:00:01
976000 -- (-765.775) (-768.142) [-765.342] (-770.207) * (-768.340) (-765.537) [-765.202] (-766.594) -- 0:00:01
976500 -- (-766.630) [-767.240] (-765.828) (-765.551) * (-765.823) [-767.114] (-765.683) (-766.776) -- 0:00:01
977000 -- (-764.889) [-766.168] (-765.948) (-766.083) * [-764.703] (-766.540) (-765.254) (-765.598) -- 0:00:01
977500 -- (-767.148) (-770.112) [-764.662] (-766.374) * (-765.705) [-766.313] (-767.043) (-771.732) -- 0:00:01
978000 -- [-765.256] (-773.096) (-766.003) (-768.109) * [-764.884] (-767.416) (-768.847) (-766.295) -- 0:00:01
978500 -- (-766.645) (-766.561) [-765.538] (-768.069) * (-768.348) (-765.121) [-768.202] (-765.278) -- 0:00:01
979000 -- (-765.279) [-765.883] (-766.449) (-765.733) * [-765.635] (-772.254) (-768.483) (-770.454) -- 0:00:01
979500 -- (-767.735) [-765.622] (-765.820) (-765.019) * (-765.291) (-774.658) (-767.034) [-765.066] -- 0:00:01
980000 -- (-769.321) (-767.848) [-767.098] (-767.853) * (-770.680) (-767.738) [-765.386] (-765.364) -- 0:00:01
Average standard deviation of split frequencies: 0.006826
980500 -- (-765.648) [-767.399] (-766.757) (-767.869) * (-769.491) [-766.138] (-765.187) (-767.895) -- 0:00:01
981000 -- (-770.404) [-766.260] (-766.523) (-764.828) * (-765.471) (-769.673) (-766.440) [-766.546] -- 0:00:01
981500 -- (-765.556) (-768.999) [-769.812] (-768.607) * (-766.062) [-767.700] (-765.080) (-766.853) -- 0:00:01
982000 -- (-767.923) (-768.030) (-767.343) [-765.626] * (-765.896) (-773.547) [-765.054] (-767.760) -- 0:00:01
982500 -- (-767.719) (-769.156) [-766.372] (-769.402) * (-765.906) [-765.799] (-772.008) (-767.619) -- 0:00:01
983000 -- (-766.695) (-768.921) (-770.843) [-766.949] * (-769.123) [-768.986] (-766.943) (-769.822) -- 0:00:01
983500 -- (-770.527) (-775.484) [-767.662] (-765.564) * (-768.564) [-766.211] (-768.334) (-766.753) -- 0:00:01
984000 -- [-772.267] (-768.165) (-766.386) (-769.282) * (-767.130) (-765.893) [-765.168] (-767.404) -- 0:00:01
984500 -- (-765.629) [-768.132] (-769.377) (-766.971) * (-770.973) (-766.049) [-766.718] (-766.347) -- 0:00:01
985000 -- [-766.758] (-766.590) (-769.097) (-765.908) * (-768.322) (-767.536) (-764.703) [-765.901] -- 0:00:00
Average standard deviation of split frequencies: 0.006885
985500 -- [-767.192] (-765.636) (-766.827) (-765.299) * (-767.790) (-766.877) [-764.547] (-766.841) -- 0:00:00
986000 -- [-768.809] (-767.435) (-766.897) (-770.169) * (-769.346) (-766.695) [-765.011] (-767.630) -- 0:00:00
986500 -- (-768.434) (-765.492) (-767.813) [-765.819] * (-765.703) (-771.851) (-769.954) [-765.141] -- 0:00:00
987000 -- (-767.587) (-765.753) [-765.905] (-772.073) * (-766.460) (-769.962) (-766.601) [-764.843] -- 0:00:00
987500 -- (-767.625) (-768.560) [-765.865] (-766.153) * [-766.527] (-768.927) (-766.591) (-765.551) -- 0:00:00
988000 -- (-766.801) [-768.921] (-766.894) (-769.424) * [-767.962] (-766.743) (-765.804) (-765.823) -- 0:00:00
988500 -- (-768.309) [-765.154] (-769.732) (-766.782) * (-764.705) (-765.211) (-767.219) [-766.867] -- 0:00:00
989000 -- [-765.757] (-767.293) (-769.338) (-767.341) * [-767.721] (-766.370) (-766.298) (-771.643) -- 0:00:00
989500 -- (-766.911) [-765.218] (-774.001) (-767.387) * (-765.649) (-766.037) [-765.128] (-775.585) -- 0:00:00
990000 -- (-768.742) [-765.157] (-768.377) (-772.623) * (-766.405) (-767.888) [-765.919] (-769.490) -- 0:00:00
Average standard deviation of split frequencies: 0.007074
990500 -- (-768.883) [-768.280] (-765.631) (-770.174) * [-768.413] (-767.313) (-769.169) (-768.002) -- 0:00:00
991000 -- (-765.488) (-764.673) [-766.208] (-766.172) * [-768.818] (-767.073) (-770.569) (-767.963) -- 0:00:00
991500 -- [-765.585] (-765.781) (-768.850) (-767.017) * [-765.242] (-769.530) (-766.549) (-765.299) -- 0:00:00
992000 -- (-766.169) (-765.462) (-767.245) [-766.833] * (-765.746) [-765.120] (-765.868) (-764.490) -- 0:00:00
992500 -- (-768.596) (-766.182) (-770.522) [-767.866] * (-765.823) (-765.891) (-765.568) [-766.000] -- 0:00:00
993000 -- (-765.950) (-766.065) (-771.138) [-765.436] * [-769.391] (-767.319) (-765.252) (-767.245) -- 0:00:00
993500 -- (-764.842) (-765.233) [-767.134] (-765.784) * (-766.655) (-767.056) (-766.845) [-765.881] -- 0:00:00
994000 -- (-767.453) [-767.853] (-765.988) (-765.839) * [-764.769] (-768.470) (-765.485) (-769.717) -- 0:00:00
994500 -- (-767.758) [-767.918] (-778.853) (-766.242) * [-765.147] (-770.789) (-767.447) (-774.344) -- 0:00:00
995000 -- (-766.017) (-767.171) [-767.637] (-767.861) * (-766.260) (-767.204) [-768.099] (-779.252) -- 0:00:00
Average standard deviation of split frequencies: 0.007257
995500 -- (-767.628) (-765.095) [-772.370] (-769.463) * [-765.111] (-769.021) (-767.231) (-766.059) -- 0:00:00
996000 -- (-767.043) (-769.980) (-768.844) [-769.237] * (-765.104) [-765.370] (-766.477) (-766.675) -- 0:00:00
996500 -- (-765.661) (-769.427) (-766.558) [-766.960] * (-765.505) (-767.748) [-767.760] (-766.890) -- 0:00:00
997000 -- [-765.313] (-766.030) (-770.061) (-766.317) * (-767.294) (-764.621) [-764.964] (-770.686) -- 0:00:00
997500 -- [-766.187] (-765.791) (-767.502) (-767.446) * (-767.186) [-767.066] (-766.584) (-773.263) -- 0:00:00
998000 -- (-764.811) [-765.912] (-766.017) (-772.109) * (-768.311) (-764.848) [-767.575] (-766.396) -- 0:00:00
998500 -- [-766.011] (-764.679) (-764.787) (-770.954) * (-766.269) (-765.111) [-768.995] (-766.293) -- 0:00:00
999000 -- (-766.634) [-765.308] (-764.646) (-768.614) * (-767.839) (-766.089) (-765.892) [-765.025] -- 0:00:00
999500 -- (-765.091) [-768.684] (-765.971) (-767.330) * (-768.002) [-766.090] (-771.001) (-768.796) -- 0:00:00
1000000 -- (-765.126) (-767.673) (-766.923) [-765.564] * (-768.970) [-766.177] (-766.819) (-767.605) -- 0:00:00
Average standard deviation of split frequencies: 0.007380
Analysis completed in 1 mins 6 seconds
Analysis used 65.48 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -764.44
Likelihood of best state for "cold" chain of run 2 was -764.44
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
75.1 % ( 64 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.9 % ( 32 %) Dirichlet(Pi{all})
31.8 % ( 24 %) Slider(Pi{all})
79.1 % ( 60 %) Multiplier(Alpha{1,2})
78.3 % ( 52 %) Multiplier(Alpha{3})
22.4 % ( 25 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.3 % ( 75 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.4 % ( 89 %) ParsSPR(Tau{all},V{all})
28.2 % ( 29 %) Multiplier(V{all})
97.5 % ( 97 %) Nodeslider(V{all})
30.5 % ( 25 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
74.4 % ( 73 %) Dirichlet(Revmat{all})
100.0 % (100 %) Slider(Revmat{all})
29.3 % ( 22 %) Dirichlet(Pi{all})
31.7 % ( 27 %) Slider(Pi{all})
78.5 % ( 60 %) Multiplier(Alpha{1,2})
78.2 % ( 49 %) Multiplier(Alpha{3})
22.9 % ( 18 %) Slider(Pinvar{all})
98.6 % (100 %) ExtSPR(Tau{all},V{all})
70.2 % ( 68 %) ExtTBR(Tau{all},V{all})
100.0 % (100 %) NNI(Tau{all},V{all})
89.3 % ( 86 %) ParsSPR(Tau{all},V{all})
28.1 % ( 27 %) Multiplier(V{all})
97.4 % ( 93 %) Nodeslider(V{all})
30.7 % ( 22 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166718 0.82 0.67
3 | 166546 166525 0.84
4 | 166543 167321 166347
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.81 0.64 0.50
2 | 166664 0.82 0.67
3 | 166882 166239 0.84
4 | 166824 166933 166458
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -765.87
| 2 |
| |
| 2 1 |
| 2 2 |
|1 2 1 1 2 |
| 1 1 1 1 2 1 2 2|
| 1 2 *1 1 1 * 2 11 |
| 2 1 2 221 * 1 222 111 |
| 1 221 2 2 1 1211 2 * 1 22 1|
|2 2 * 22 1 1 22 1 1 |
| 11 ** 1 1 1 21 1 1 2 1 11 2* 2 12 |
| 1 2 2 1 2 |
| 2 1 2 2 2 2 2 2 2 |
| 1 2 2 1 |
| 2 2 1 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -767.67
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.15 -768.81
2 -766.14 -770.03
--------------------------------------
TOTAL -766.15 -769.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894340 0.091300 0.367878 1.498241 0.862858 1311.42 1337.80 1.000
r(A<->C){all} 0.155006 0.018303 0.000099 0.423802 0.116959 286.00 322.25 1.002
r(A<->G){all} 0.164240 0.019597 0.000178 0.448944 0.126785 158.45 245.50 1.000
r(A<->T){all} 0.171656 0.020972 0.000024 0.460678 0.133311 204.89 229.94 1.001
r(C<->G){all} 0.169406 0.021815 0.000015 0.474100 0.127922 212.42 245.36 1.002
r(C<->T){all} 0.165478 0.019470 0.000038 0.441700 0.129875 118.62 187.72 1.000
r(G<->T){all} 0.174214 0.021433 0.000159 0.469350 0.136679 153.17 228.24 1.000
pi(A){all} 0.193276 0.000268 0.160269 0.223355 0.193090 1166.98 1333.99 1.000
pi(C){all} 0.276518 0.000365 0.241365 0.315864 0.276109 1150.46 1228.06 1.000
pi(G){all} 0.340136 0.000399 0.298217 0.376861 0.339543 1044.88 1137.35 1.000
pi(T){all} 0.190070 0.000275 0.158746 0.222439 0.190179 1089.13 1197.05 1.000
alpha{1,2} 0.414877 0.216945 0.000154 1.356806 0.245208 936.08 1103.77 1.001
alpha{3} 0.469684 0.254609 0.000368 1.529902 0.298465 1186.34 1259.47 1.001
pinvar{all} 0.997311 0.000010 0.991430 0.999998 0.998358 1216.58 1304.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
Key to taxon bipartitions (saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
------------
1 -- .*****
2 -- .*....
3 -- ..*...
4 -- ...*..
5 -- ....*.
6 -- .....*
7 -- ...*.*
8 -- .*..*.
9 -- .***.*
10 -- ..**..
11 -- .*.***
12 -- ....**
13 -- .****.
14 -- .**.**
15 -- ..*..*
16 -- .*.*..
17 -- ..****
18 -- .*...*
19 -- ..*.*.
20 -- .**...
21 -- ...**.
------------
Summary statistics for informative taxon bipartitions
(saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
7 473 0.157562 0.007066 0.152565 0.162558 2
8 463 0.154231 0.018373 0.141239 0.167222 2
9 455 0.151566 0.008951 0.145237 0.157895 2
10 452 0.150566 0.010364 0.143238 0.157895 2
11 448 0.149234 0.003769 0.146569 0.151899 2
12 431 0.143571 0.006124 0.139241 0.147901 2
13 422 0.140573 0.000942 0.139907 0.141239 2
14 421 0.140240 0.001413 0.139241 0.141239 2
15 418 0.139241 0.016017 0.127915 0.150566 2
16 418 0.139241 0.002827 0.137242 0.141239 2
17 418 0.139241 0.001884 0.137908 0.140573 2
18 412 0.137242 0.010364 0.129913 0.144570 2
19 403 0.134244 0.007066 0.129247 0.139241 2
20 400 0.133245 0.015075 0.122585 0.143904 2
21 383 0.127582 0.000471 0.127249 0.127915 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.096716 0.009508 0.000022 0.282813 0.067880 1.000 2
length{all}[2] 0.100513 0.010450 0.000060 0.307625 0.069150 1.001 2
length{all}[3] 0.100978 0.010202 0.000084 0.308977 0.070490 1.000 2
length{all}[4] 0.099058 0.009893 0.000002 0.306139 0.066894 1.000 2
length{all}[5] 0.097163 0.009100 0.000026 0.286224 0.067504 1.000 2
length{all}[6] 0.100881 0.010917 0.000017 0.304397 0.070283 1.000 2
length{all}[7] 0.097979 0.010997 0.000109 0.291360 0.065899 1.007 2
length{all}[8] 0.101375 0.012258 0.000594 0.324479 0.068935 1.001 2
length{all}[9] 0.103361 0.009996 0.000334 0.288917 0.074145 0.998 2
length{all}[10] 0.101918 0.011245 0.000057 0.340762 0.067647 1.000 2
length{all}[11] 0.095871 0.008737 0.000035 0.284955 0.068622 1.000 2
length{all}[12] 0.092445 0.008882 0.000137 0.268722 0.061659 0.998 2
length{all}[13] 0.088519 0.009146 0.000792 0.258307 0.059869 1.006 2
length{all}[14] 0.109401 0.010987 0.000154 0.321069 0.073502 1.000 2
length{all}[15] 0.100613 0.010251 0.000083 0.318912 0.069626 0.999 2
length{all}[16] 0.103758 0.010463 0.000020 0.301364 0.072296 1.000 2
length{all}[17] 0.102868 0.009268 0.000177 0.304551 0.075948 0.999 2
length{all}[18] 0.106488 0.011347 0.000477 0.321055 0.071521 0.999 2
length{all}[19] 0.094122 0.007554 0.000252 0.255439 0.069134 1.000 2
length{all}[20] 0.096768 0.008101 0.000052 0.264798 0.073161 1.000 2
length{all}[21] 0.097973 0.009047 0.000041 0.273607 0.067996 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007380
Maximum standard deviation of split frequencies = 0.018373
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.007
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
|------------------------------------------------------------------------ C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|------------------------------------------------------------------------ C4 (4)
|
|------------------------------------------------------------------------ C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
Phylogram (based on average branch lengths):
/--------------------------------------------------------------------- C1 (1)
|
|----------------------------------------------------------------------- C2 (2)
|
|------------------------------------------------------------------------ C3 (3)
+
|-------------------------------------------------------------------- C4 (4)
|
|--------------------------------------------------------------------- C5 (5)
|
\------------------------------------------------------------------------ C6 (6)
|---------| 0.010 expected changes per site
Calculating tree probabilities...
Credible sets of trees (105 trees sampled):
50 % credible set contains 45 trees
90 % credible set contains 91 trees
95 % credible set contains 97 trees
99 % credible set contains 103 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.9h, March 2018
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 7 8
seq file is not paml/phylip format. Trying nexus format.ns = 6 ls = 564
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Sequences read..
Counting site patterns.. 0:00
Compressing, 48 patterns at 188 / 188 sites (100.0%), 0:00
Collecting fpatt[] & pose[], 48 patterns at 188 / 188 sites (100.0%), 0:00
Counting codons..
120 bytes for distance
46848 bytes for conP
4224 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.039961 0.013024 0.081864 0.058681 0.030235 0.032729 0.300000 1.300000
ntime & nrate & np: 6 2 8
Bounds (np=8):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 8
lnL0 = -785.369132
Iterating by ming2
Initial: fx= 785.369132
x= 0.03996 0.01302 0.08186 0.05868 0.03024 0.03273 0.30000 1.30000
1 h-m-p 0.0000 0.0001 450.8802 ++ 771.051429 m 0.0001 13 | 1/8
2 h-m-p 0.0005 0.0050 61.1031 -----------.. | 1/8
3 h-m-p 0.0000 0.0001 412.1337 ++ 755.181393 m 0.0001 44 | 2/8
4 h-m-p 0.0007 0.0067 46.7179 -----------.. | 2/8
5 h-m-p 0.0000 0.0000 369.4863 ++ 753.335022 m 0.0000 75 | 3/8
6 h-m-p 0.0001 0.0089 35.5380 ----------.. | 3/8
7 h-m-p 0.0000 0.0000 319.7226 ++ 749.317778 m 0.0000 105 | 4/8
8 h-m-p 0.0004 0.0115 27.3381 ----------.. | 4/8
9 h-m-p 0.0000 0.0001 260.9102 ++ 742.362066 m 0.0001 135 | 5/8
10 h-m-p 0.0011 0.0179 17.7798 -----------.. | 5/8
11 h-m-p 0.0000 0.0001 184.7353 ++ 738.022665 m 0.0001 166 | 6/8
12 h-m-p 1.6000 8.0000 0.0000 ++ 738.022665 m 8.0000 177 | 6/8
13 h-m-p 0.2610 8.0000 0.0001 +++ 738.022665 m 8.0000 191 | 6/8
14 h-m-p 0.0160 8.0000 0.0829 ------C 738.022665 0 0.0000 210 | 6/8
15 h-m-p 0.0160 8.0000 0.0000 -C 738.022665 0 0.0010 224 | 6/8
16 h-m-p 0.0160 8.0000 0.0000 C 738.022665 0 0.0160 237 | 6/8
17 h-m-p 0.0160 8.0000 0.0000 Y 738.022665 0 0.0066 250 | 6/8
18 h-m-p 0.0160 8.0000 0.0005 --Y 738.022665 0 0.0003 265 | 6/8
19 h-m-p 0.0160 8.0000 0.0001 -------------.. | 6/8
20 h-m-p 0.0160 8.0000 0.0000 +++++ 738.022665 m 8.0000 305 | 6/8
21 h-m-p 0.0025 1.2277 3.0654 ---------C 738.022665 0 0.0000 327 | 6/8
22 h-m-p 0.0160 8.0000 0.0127 +++++ 738.022662 m 8.0000 341 | 6/8
23 h-m-p 0.0354 1.1972 2.8684 -----------Y 738.022662 0 0.0000 365 | 6/8
24 h-m-p 0.0286 8.0000 0.0000 C 738.022662 0 0.0071 376 | 6/8
25 h-m-p 0.0216 8.0000 0.0000 Y 738.022662 0 0.0216 389
Out..
lnL = -738.022662
390 lfun, 390 eigenQcodon, 2340 P(t)
Time used: 0:01
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.059418 0.093059 0.086651 0.086461 0.061200 0.057419 0.206394 0.747281 0.371204
ntime & nrate & np: 6 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 11.497853
np = 9
lnL0 = -818.226850
Iterating by ming2
Initial: fx= 818.226850
x= 0.05942 0.09306 0.08665 0.08646 0.06120 0.05742 0.20639 0.74728 0.37120
1 h-m-p 0.0000 0.0003 430.3028 +++ 756.674710 m 0.0003 15 | 1/9
2 h-m-p 0.0000 0.0001 203.5329 ++ 754.810945 m 0.0001 27 | 2/9
3 h-m-p 0.0000 0.0001 449.5935 ++ 752.250306 m 0.0001 39 | 3/9
4 h-m-p 0.0000 0.0000 3417.7211 ++ 738.321322 m 0.0000 51 | 4/9
5 h-m-p 0.0000 0.0000 252.0949 ++ 738.307961 m 0.0000 63 | 5/9
6 h-m-p 0.0000 0.0005 406.2424 +++ 738.170561 m 0.0005 76 | 5/9
7 h-m-p 0.0000 0.0000 1193.8450
h-m-p: 1.83611651e-22 9.18058256e-22 1.19384501e+03 738.170561
.. | 5/9
8 h-m-p 0.0000 0.0000 185.7855 ++ 738.022674 m 0.0000 97 | 6/9
9 h-m-p 0.0160 8.0000 0.0000 +++++ 738.022674 m 8.0000 112 | 6/9
10 h-m-p 0.1747 8.0000 0.0002 +++ 738.022674 m 8.0000 128 | 6/9
11 h-m-p 0.0143 7.1556 0.1800 +++C 738.022673 0 1.3390 146 | 6/9
12 h-m-p 1.6000 8.0000 0.0249 C 738.022673 0 1.3586 161 | 6/9
13 h-m-p 1.6000 8.0000 0.0023 Y 738.022673 0 0.8778 176 | 6/9
14 h-m-p 1.6000 8.0000 0.0002 +Y 738.022673 0 6.4000 192 | 6/9
15 h-m-p 1.6000 8.0000 0.0002 ++ 738.022673 m 8.0000 207 | 6/9
16 h-m-p 0.2046 8.0000 0.0085 ++Y 738.022673 0 2.3406 224 | 6/9
17 h-m-p 1.6000 8.0000 0.0017 ++ 738.022673 m 8.0000 239 | 6/9
18 h-m-p 0.1337 2.0987 0.1000 --------Y 738.022673 0 0.0000 262 | 6/9
19 h-m-p 0.0047 2.3399 0.2406 +++++ 738.022667 m 2.3399 280 | 6/9
20 h-m-p 0.3090 1.5451 0.6514 ------------C 738.022667 0 0.0000 307 | 6/9
21 h-m-p 0.0160 8.0000 0.0053 -------------.. | 6/9
22 h-m-p 0.0160 8.0000 0.0001 +++++ 738.022667 m 8.0000 351 | 6/9
23 h-m-p 0.0000 0.0002 157.9821 +++ 738.022665 m 0.0002 367 | 7/9
24 h-m-p 0.1278 6.6893 0.0949 +++ 738.022657 m 6.6893 380 | 8/9
25 h-m-p 1.6000 8.0000 0.0000 Y 738.022657 0 1.6000 394
Out..
lnL = -738.022657
395 lfun, 1185 eigenQcodon, 4740 P(t)
Time used: 0:02
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.068400 0.068574 0.060409 0.012701 0.039372 0.030938 0.000100 1.640361 0.553742 0.114809 1.365726
ntime & nrate & np: 6 3 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 13.668704
np = 11
lnL0 = -787.006856
Iterating by ming2
Initial: fx= 787.006856
x= 0.06840 0.06857 0.06041 0.01270 0.03937 0.03094 0.00011 1.64036 0.55374 0.11481 1.36573
1 h-m-p 0.0000 0.0000 404.8852 ++ 786.505008 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0005 175.1859 +++ 773.677865 m 0.0005 31 | 2/11
3 h-m-p 0.0001 0.0003 133.3812 ++ 761.775603 m 0.0003 45 | 3/11
4 h-m-p 0.0001 0.0003 56.1725 ++ 760.531121 m 0.0003 59 | 4/11
5 h-m-p 0.0001 0.0013 78.2913 ++ 754.147867 m 0.0013 73 | 5/11
6 h-m-p 0.0000 0.0001 105.9012 ++ 753.090019 m 0.0001 87 | 6/11
7 h-m-p 0.0002 0.0008 32.9975 ++ 752.282126 m 0.0008 101 | 7/11
8 h-m-p 0.0033 0.9102 5.9571 ------------.. | 7/11
9 h-m-p 0.0000 0.0005 170.6807 +++ 738.022667 m 0.0005 140 | 8/11
10 h-m-p 1.6000 8.0000 0.0000 ++ 738.022667 m 8.0000 154 | 8/11
11 h-m-p 0.0160 8.0000 0.0403 -------N 738.022667 0 0.0000 178 | 8/11
12 h-m-p 0.0160 8.0000 0.0001 +++++ 738.022667 m 8.0000 198 | 8/11
13 h-m-p 0.0160 8.0000 1.9095 ++++C 738.022656 0 4.0960 219 | 8/11
14 h-m-p 1.6000 8.0000 0.2925 ++ 738.022655 m 8.0000 233 | 8/11
15 h-m-p 0.2765 1.3827 4.3430 Y 738.022655 0 0.1550 250 | 8/11
16 h-m-p 0.4120 3.2632 1.6339 C 738.022655 0 0.1123 264 | 8/11
17 h-m-p 1.6000 8.0000 0.0880 -----Y 738.022655 0 0.0004 283 | 8/11
18 h-m-p 1.6000 8.0000 0.0000 ++ 738.022655 m 8.0000 300 | 8/11
19 h-m-p 0.0160 8.0000 0.0147 +++++ 738.022655 m 8.0000 320 | 8/11
20 h-m-p 0.0594 2.6552 1.9743 +Y 738.022655 0 0.4702 338 | 8/11
21 h-m-p 1.6000 8.0000 0.1244 --------Y 738.022655 0 0.0000 360 | 8/11
22 h-m-p 0.0160 8.0000 0.0002 +++++ 738.022655 m 8.0000 380 | 8/11
23 h-m-p 0.0160 8.0000 0.3299 +++C 738.022655 0 1.0240 400 | 8/11
24 h-m-p 1.6000 8.0000 0.0139 Y 738.022655 0 1.1811 417 | 8/11
25 h-m-p 1.6000 8.0000 0.0002 ++ 738.022655 m 8.0000 434 | 8/11
26 h-m-p 1.6000 8.0000 0.0006 ++ 738.022655 m 8.0000 451 | 8/11
27 h-m-p 0.0002 0.1141 39.7768 +Y 738.022655 0 0.0007 469 | 8/11
28 h-m-p 1.6000 8.0000 0.0167 Y 738.022655 0 2.5835 483 | 8/11
29 h-m-p 1.6000 8.0000 0.0131 ++ 738.022655 m 8.0000 500 | 8/11
30 h-m-p 1.6000 8.0000 0.0438 ++ 738.022655 m 8.0000 517 | 8/11
31 h-m-p 1.6000 8.0000 0.0713 ++ 738.022654 m 8.0000 534 | 8/11
32 h-m-p 0.0933 8.0000 6.1132 ++++ 738.022646 m 8.0000 553 | 8/11
33 h-m-p 1.6000 8.0000 1.9914 ++ 738.022646 m 8.0000 567 | 8/11
34 h-m-p 1.5949 7.9745 7.4800 ++ 738.022646 m 7.9745 581 | 8/11
35 h-m-p 0.2621 1.3105 99.5115 -------C 738.022646 0 0.0000 602 | 8/11
36 h-m-p 1.1000 5.5000 0.0001 Y 738.022646 0 0.2750 616 | 8/11
37 h-m-p 1.6000 8.0000 0.0000 --------C 738.022646 0 0.0000 641
Out..
lnL = -738.022646
642 lfun, 2568 eigenQcodon, 11556 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -738.018383 S = -738.018238 -0.000056
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:05
did 20 / 48 patterns 0:05
did 30 / 48 patterns 0:05
did 40 / 48 patterns 0:05
did 48 / 48 patterns 0:05
Time used: 0:05
Model 7: beta
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.026312 0.038265 0.061885 0.087081 0.087699 0.033764 0.000100 1.077964 1.087458
ntime & nrate & np: 6 1 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.211161
np = 9
lnL0 = -798.400853
Iterating by ming2
Initial: fx= 798.400853
x= 0.02631 0.03827 0.06189 0.08708 0.08770 0.03376 0.00011 1.07796 1.08746
1 h-m-p 0.0000 0.0000 430.3866 ++ 797.853188 m 0.0000 14 | 1/9
2 h-m-p 0.0001 0.0286 38.6002 +++++ 787.224692 m 0.0286 29 | 2/9
3 h-m-p 0.0000 0.0000 137980.7752 ++ 755.529042 m 0.0000 41 | 3/9
4 h-m-p 0.0000 0.0002 158.2059 ++ 754.644303 m 0.0002 53 | 4/9
5 h-m-p 0.0000 0.0001 309.8812 ++ 752.707846 m 0.0001 65 | 5/9
6 h-m-p 0.0001 0.0007 56.1969 ++ 752.157498 m 0.0007 77 | 6/9
7 h-m-p 0.0001 0.0005 138.4880 +
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
+ 748.342451 m 0.0005 89
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13634) = 1.239232e-160 2000 rounds
| 7/9
8 h-m-p 0.0170 8.0000 3.0750
QuantileBeta(0.15, 0.00500, 2.18630) = 1.203545e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14883) = 1.230116e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13946) = 1.236941e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13711) = 1.238659e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13653) = 1.239089e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13638) = 1.239197e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13635) = 1.239224e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13634) = 1.239230e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239232e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
-..
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13634) = 1.239232e-160 2000 rounds
| 7/9
9 h-m-p 0.0000 0.0003 175.6694
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
+ 738.022688 m 0.0003 125
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13634) = 1.239232e-160 2000 rounds
| 8/9
10 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
C 738.022688 0 1.6000 137
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13645) = 1.239144e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13621) = 1.239321e-160 2000 rounds
| 8/9
11 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
N 738.022688 0 1.6000 150
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
Out..
lnL = -738.022688
151 lfun, 1661 eigenQcodon, 9060 P(t)
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13633) = 1.239233e-160 2000 rounds
Time used: 0:08
Model 8: beta&w>1
TREE # 1
(1, 2, 3, 4, 5, 6); MP score: 0
0.074891 0.051954 0.046138 0.032753 0.044377 0.107139 0.000100 0.900000 0.420604 1.905277 1.340190
ntime & nrate & np: 6 2 11
Bounds (np=11):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 17.176723
np = 11
lnL0 = -799.574769
Iterating by ming2
Initial: fx= 799.574769
x= 0.07489 0.05195 0.04614 0.03275 0.04438 0.10714 0.00011 0.90000 0.42060 1.90528 1.34019
1 h-m-p 0.0000 0.0000 395.7261 ++ 799.292889 m 0.0000 16 | 1/11
2 h-m-p 0.0000 0.0007 252.5837 ++++ 766.817165 m 0.0007 32 | 2/11
3 h-m-p 0.0000 0.0000 2146.1030 ++ 756.447546 m 0.0000 46 | 3/11
4 h-m-p 0.0001 0.0005 34.0019 ++ 756.070223 m 0.0005 60 | 4/11
5 h-m-p 0.0000 0.0001 1248.7097 ++ 754.512973 m 0.0001 74 | 5/11
6 h-m-p 0.0000 0.0001 1057.3148 ++ 748.786060 m 0.0001 88 | 6/11
7 h-m-p 0.0000 0.0001 3684.0744 ++ 742.730532 m 0.0001 102 | 7/11
8 h-m-p 0.0115 0.0576 7.4566 -------------.. | 7/11
9 h-m-p 0.0000 0.0001 179.3155 ++ 738.022664 m 0.0001 141 | 8/11
10 h-m-p 0.9751 8.0000 0.0000 ++ 738.022664 m 8.0000 155 | 8/11
11 h-m-p 0.0160 8.0000 0.0126 +++++ 738.022662 m 8.0000 175 | 8/11
12 h-m-p 0.1141 2.4924 0.8850 +++ 738.022649 m 2.4924 193 | 9/11
13 h-m-p 1.6000 8.0000 0.3926 ++ 738.022648 m 8.0000 210 | 9/11
14 h-m-p 1.6000 8.0000 1.5454 +
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
+ 738.022646 m 8.0000 226
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239362e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
| 9/11
15 h-m-p 1.6000 8.0000 0.4975
QuantileBeta(0.15, 0.00500, 2.13425) = 1.240765e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13568) = 1.239713e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13604) = 1.239451e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13613) = 1.239385e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13615) = 1.239369e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13615) = 1.239365e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239364e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
C 738.022646 0 0.0000 251
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13628) = 1.239275e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13604) = 1.239452e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
| 9/11
16 h-m-p 1.2845 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
-
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
Y 738.022646 0 0.0201 269
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
Out..
lnL = -738.022646
270 lfun, 3240 eigenQcodon, 17820 P(t)
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal likelihood.
log(fX) = -738.019027 S = -738.018310 -0.000314
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 48 patterns 0:12
did 20 / 48 patterns 0:13
did 30 / 48 patterns 0:13
did 40 / 48 patterns 0:13
did 48 / 48 patterns 0:13
QuantileBeta(0.15, 0.00500, 2.13616) = 1.239363e-160 2000 rounds
Time used: 0:13
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188
NC_011896_1_WP_010907745_1_492_MLBR_RS02355 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
NC_002677_1_NP_301421_1_293_ruvC MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
NZ_AP014567_1_WP_010907745_1_522_ruvC MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
**************************************************
NC_011896_1_WP_010907745_1_492_MLBR_RS02355 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
NC_002677_1_NP_301421_1_293_ruvC DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
NZ_AP014567_1_WP_010907745_1_522_ruvC DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
**************************************************
NC_011896_1_WP_010907745_1_492_MLBR_RS02355 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
NC_002677_1_NP_301421_1_293_ruvC HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
NZ_AP014567_1_WP_010907745_1_522_ruvC HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
**************************************************
NC_011896_1_WP_010907745_1_492_MLBR_RS02355 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
NC_002677_1_NP_301421_1_293_ruvC CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
NZ_AP014567_1_WP_010907745_1_522_ruvC CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
**************************************
>NC_011896_1_WP_010907745_1_492_MLBR_RS02355 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG >NC_002677_1_NP_301421_1_293_ruvC ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG >NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG >NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG >NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG >NZ_AP014567_1_WP_010907745_1_522_ruvC ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG TTAAGGCCACCCGG
>NC_011896_1_WP_010907745_1_492_MLBR_RS02355 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR >NC_002677_1_NP_301421_1_293_ruvC MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR >NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR >NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR >NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580 MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR >NZ_AP014567_1_WP_010907745_1_522_ruvC MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
#NEXUS
[ID: 0651772583]
begin taxa;
dimensions ntax=6;
taxlabels
NC_011896_1_WP_010907745_1_492_MLBR_RS02355
NC_002677_1_NP_301421_1_293_ruvC
NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495
NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120
NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580
NZ_AP014567_1_WP_010907745_1_522_ruvC
;
end;
begin trees;
translate
1 NC_011896_1_WP_010907745_1_492_MLBR_RS02355,
2 NC_002677_1_NP_301421_1_293_ruvC,
3 NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495,
4 NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120,
5 NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580,
6 NZ_AP014567_1_WP_010907745_1_522_ruvC
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.06787993,2:0.06915008,3:0.07048971,4:0.06689354,5:0.0675045,6:0.07028342);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.06787993,2:0.06915008,3:0.07048971,4:0.06689354,5:0.0675045,6:0.07028342);
end;
Estimated marginal likelihoods for runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -766.15 -768.81
2 -766.14 -770.03
--------------------------------------
TOTAL -766.15 -769.59
--------------------------------------
Model parameter summaries over the runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.894340 0.091300 0.367878 1.498241 0.862858 1311.42 1337.80 1.000
r(A<->C){all} 0.155006 0.018303 0.000099 0.423802 0.116959 286.00 322.25 1.002
r(A<->G){all} 0.164240 0.019597 0.000178 0.448944 0.126785 158.45 245.50 1.000
r(A<->T){all} 0.171656 0.020972 0.000024 0.460678 0.133311 204.89 229.94 1.001
r(C<->G){all} 0.169406 0.021815 0.000015 0.474100 0.127922 212.42 245.36 1.002
r(C<->T){all} 0.165478 0.019470 0.000038 0.441700 0.129875 118.62 187.72 1.000
r(G<->T){all} 0.174214 0.021433 0.000159 0.469350 0.136679 153.17 228.24 1.000
pi(A){all} 0.193276 0.000268 0.160269 0.223355 0.193090 1166.98 1333.99 1.000
pi(C){all} 0.276518 0.000365 0.241365 0.315864 0.276109 1150.46 1228.06 1.000
pi(G){all} 0.340136 0.000399 0.298217 0.376861 0.339543 1044.88 1137.35 1.000
pi(T){all} 0.190070 0.000275 0.158746 0.222439 0.190179 1089.13 1197.05 1.000
alpha{1,2} 0.414877 0.216945 0.000154 1.356806 0.245208 936.08 1103.77 1.001
alpha{3} 0.469684 0.254609 0.000368 1.529902 0.298465 1186.34 1259.47 1.001
pinvar{all} 0.997311 0.000010 0.991430 0.999998 0.998358 1216.58 1304.07 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.9h, March 2018) /data/12res/ruvC/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio,
Codon frequency model: F3x4
Site-class models:
ns = 6 ls = 188
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 1 | Ser TCT 2 2 2 2 2 2 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 1 | TCC 1 1 1 1 1 1 | TAC 0 0 0 0 0 0 | TGC 3 3 3 3 3 3
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 6 6 6 6 6 6 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 1 1 1 1 1 | Pro CCT 0 0 0 0 0 0 | His CAT 4 4 4 4 4 4 | Arg CGT 1 1 1 1 1 1
CTC 0 0 0 0 0 0 | CCC 1 1 1 1 1 1 | CAC 3 3 3 3 3 3 | CGC 5 5 5 5 5 5
CTA 0 0 0 0 0 0 | CCA 3 3 3 3 3 3 | Gln CAA 4 4 4 4 4 4 | CGA 0 0 0 0 0 0
CTG 5 5 5 5 5 5 | CCG 4 4 4 4 4 4 | CAG 3 3 3 3 3 3 | CGG 6 6 6 6 6 6
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 0 0 0 0 0 0 | Asn AAT 3 3 3 3 3 3 | Ser AGT 1 1 1 1 1 1
ATC 6 6 6 6 6 6 | ACC 5 5 5 5 5 5 | AAC 1 1 1 1 1 1 | AGC 2 2 2 2 2 2
ATA 0 0 0 0 0 0 | ACA 2 2 2 2 2 2 | Lys AAA 2 2 2 2 2 2 | Arg AGA 3 3 3 3 3 3
Met ATG 7 7 7 7 7 7 | ACG 3 3 3 3 3 3 | AAG 4 4 4 4 4 4 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 8 8 8 8 8 8 | Ala GCT 3 3 3 3 3 3 | Asp GAT 6 6 6 6 6 6 | Gly GGT 5 5 5 5 5 5
GTC 7 7 7 7 7 7 | GCC 14 14 14 14 14 14 | GAC 4 4 4 4 4 4 | GGC 5 5 5 5 5 5
GTA 3 3 3 3 3 3 | GCA 6 6 6 6 6 6 | Glu GAA 5 5 5 5 5 5 | GGA 0 0 0 0 0 0
GTG 7 7 7 7 7 7 | GCG 12 12 12 12 12 12 | GAG 2 2 2 2 2 2 | GGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: NC_011896_1_WP_010907745_1_492_MLBR_RS02355
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
#2: NC_002677_1_NP_301421_1_293_ruvC
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
#3: NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
#4: NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
#5: NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
#6: NZ_AP014567_1_WP_010907745_1_522_ruvC
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 6 | Ser S TCT 12 | Tyr Y TAT 6 | Cys C TGT 0
TTC 6 | TCC 6 | TAC 0 | TGC 18
Leu L TTA 0 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 36 | TCG 12 | TAG 0 | Trp W TGG 12
------------------------------------------------------------------------------
Leu L CTT 6 | Pro P CCT 0 | His H CAT 24 | Arg R CGT 6
CTC 0 | CCC 6 | CAC 18 | CGC 30
CTA 0 | CCA 18 | Gln Q CAA 24 | CGA 0
CTG 30 | CCG 24 | CAG 18 | CGG 36
------------------------------------------------------------------------------
Ile I ATT 0 | Thr T ACT 0 | Asn N AAT 18 | Ser S AGT 6
ATC 36 | ACC 30 | AAC 6 | AGC 12
ATA 0 | ACA 12 | Lys K AAA 12 | Arg R AGA 18
Met M ATG 42 | ACG 18 | AAG 24 | AGG 0
------------------------------------------------------------------------------
Val V GTT 48 | Ala A GCT 18 | Asp D GAT 36 | Gly G GGT 30
GTC 42 | GCC 84 | GAC 24 | GGC 30
GTA 18 | GCA 36 | Glu E GAA 30 | GGA 0
GTG 42 | GCG 72 | GAG 12 | GGG 18
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.10106 C:0.21277 A:0.20745 G:0.47872
position 2: T:0.27660 C:0.30851 A:0.22340 G:0.19149
position 3: T:0.19149 C:0.30851 A:0.14894 G:0.35106
Average T:0.18972 C:0.27660 A:0.19326 G:0.34043
Model 0: one-ratio
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 8): -738.022662 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.206394 1.340190
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907745_1_492_MLBR_RS02355: 0.000004, NC_002677_1_NP_301421_1_293_ruvC: 0.000004, NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495: 0.000004, NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120: 0.000004, NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580: 0.000004, NZ_AP014567_1_WP_010907745_1_522_ruvC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.20639
omega (dN/dS) = 1.34019
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
7..2 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
7..3 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
7..4 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
7..5 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
7..6 0.000 404.9 159.1 1.3402 0.0000 0.0000 0.0 0.0
tree length for dN: 0.0000
tree length for dS: 0.0000
Time used: 0:01
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -738.022657 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.681738 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907745_1_492_MLBR_RS02355: 0.000004, NC_002677_1_NP_301421_1_293_ruvC: 0.000004, NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495: 0.000004, NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120: 0.000004, NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580: 0.000004, NZ_AP014567_1_WP_010907745_1_522_ruvC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=2)
p: 0.68174 0.31826
w: 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 407.2 156.8 1.0000 0.0000 0.0000 0.0 0.0
Time used: 0:02
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -738.022646 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000000 0.000000 0.000001 74.267983
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907745_1_492_MLBR_RS02355: 0.000004, NC_002677_1_NP_301421_1_293_ruvC: 0.000004, NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495: 0.000004, NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120: 0.000004, NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580: 0.000004, NZ_AP014567_1_WP_010907745_1_522_ruvC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
MLEs of dN/dS (w) for site classes (K=3)
p: 0.00000 0.00000 1.00000
w: 0.00000 1.00000 74.26798
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
7..2 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
7..3 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
7..4 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
7..5 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
7..6 0.000 407.2 156.8 74.2680 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907745_1_492_MLBR_RS02355)
Pr(w>1) post mean +- SE for w
1 M 1.000** 74.268
2 R 1.000** 74.268
3 V 1.000** 74.268
4 M 1.000** 74.268
5 G 1.000** 74.268
6 V 1.000** 74.268
7 D 1.000** 74.268
8 P 1.000** 74.268
9 G 1.000** 74.268
10 L 1.000** 74.268
11 T 1.000** 74.268
12 R 1.000** 74.268
13 C 1.000** 74.268
14 G 1.000** 74.268
15 L 1.000** 74.268
16 S 1.000** 74.268
17 V 1.000** 74.268
18 V 1.000** 74.268
19 E 1.000** 74.268
20 N 1.000** 74.268
21 G 1.000** 74.268
22 R 1.000** 74.268
23 G 1.000** 74.268
24 S 1.000** 74.268
25 Q 1.000** 74.268
26 V 1.000** 74.268
27 V 1.000** 74.268
28 A 1.000** 74.268
29 L 1.000** 74.268
30 D 1.000** 74.268
31 V 1.000** 74.268
32 D 1.000** 74.268
33 V 1.000** 74.268
34 V 1.000** 74.268
35 R 1.000** 74.268
36 T 1.000** 74.268
37 P 1.000** 74.268
38 S 1.000** 74.268
39 D 1.000** 74.268
40 A 1.000** 74.268
41 P 1.000** 74.268
42 V 1.000** 74.268
43 S 1.000** 74.268
44 K 1.000** 74.268
45 R 1.000** 74.268
46 L 1.000** 74.268
47 L 1.000** 74.268
48 A 1.000** 74.268
49 V 1.000** 74.268
50 S 1.000** 74.268
51 D 1.000** 74.268
52 V 1.000** 74.268
53 V 1.000** 74.268
54 E 1.000** 74.268
55 H 1.000** 74.268
56 W 1.000** 74.268
57 L 1.000** 74.268
58 D 1.000** 74.268
59 A 1.000** 74.268
60 H 1.000** 74.268
61 H 1.000** 74.268
62 P 1.000** 74.268
63 D 1.000** 74.268
64 V 1.000** 74.268
65 M 1.000** 74.268
66 A 1.000** 74.268
67 I 1.000** 74.268
68 E 1.000** 74.268
69 R 1.000** 74.268
70 V 1.000** 74.268
71 F 1.000** 74.268
72 S 1.000** 74.268
73 Q 1.000** 74.268
74 Q 1.000** 74.268
75 N 1.000** 74.268
76 V 1.000** 74.268
77 S 1.000** 74.268
78 T 1.000** 74.268
79 V 1.000** 74.268
80 M 1.000** 74.268
81 G 1.000** 74.268
82 T 1.000** 74.268
83 A 1.000** 74.268
84 Q 1.000** 74.268
85 A 1.000** 74.268
86 G 1.000** 74.268
87 G 1.000** 74.268
88 V 1.000** 74.268
89 I 1.000** 74.268
90 A 1.000** 74.268
91 L 1.000** 74.268
92 A 1.000** 74.268
93 A 1.000** 74.268
94 A 1.000** 74.268
95 R 1.000** 74.268
96 R 1.000** 74.268
97 G 1.000** 74.268
98 I 1.000** 74.268
99 D 1.000** 74.268
100 V 1.000** 74.268
101 H 1.000** 74.268
102 F 1.000** 74.268
103 H 1.000** 74.268
104 T 1.000** 74.268
105 P 1.000** 74.268
106 S 1.000** 74.268
107 E 1.000** 74.268
108 V 1.000** 74.268
109 K 1.000** 74.268
110 A 1.000** 74.268
111 A 1.000** 74.268
112 V 1.000** 74.268
113 T 1.000** 74.268
114 G 1.000** 74.268
115 N 1.000** 74.268
116 G 1.000** 74.268
117 A 1.000** 74.268
118 A 1.000** 74.268
119 N 1.000** 74.268
120 K 1.000** 74.268
121 A 1.000** 74.268
122 Q 1.000** 74.268
123 V 1.000** 74.268
124 T 1.000** 74.268
125 A 1.000** 74.268
126 M 1.000** 74.268
127 V 1.000** 74.268
128 T 1.000** 74.268
129 R 1.000** 74.268
130 I 1.000** 74.268
131 L 1.000** 74.268
132 A 1.000** 74.268
133 L 1.000** 74.268
134 Q 1.000** 74.268
135 A 1.000** 74.268
136 K 1.000** 74.268
137 P 1.000** 74.268
138 T 1.000** 74.268
139 P 1.000** 74.268
140 A 1.000** 74.268
141 D 1.000** 74.268
142 A 1.000** 74.268
143 A 1.000** 74.268
144 D 1.000** 74.268
145 A 1.000** 74.268
146 L 1.000** 74.268
147 A 1.000** 74.268
148 L 1.000** 74.268
149 A 1.000** 74.268
150 I 1.000** 74.268
151 C 1.000** 74.268
152 H 1.000** 74.268
153 C 1.000** 74.268
154 W 1.000** 74.268
155 R 1.000** 74.268
156 A 1.000** 74.268
157 P 1.000** 74.268
158 M 1.000** 74.268
159 I 1.000** 74.268
160 A 1.000** 74.268
161 R 1.000** 74.268
162 M 1.000** 74.268
163 A 1.000** 74.268
164 E 1.000** 74.268
165 A 1.000** 74.268
166 E 1.000** 74.268
167 A 1.000** 74.268
168 L 1.000** 74.268
169 G 1.000** 74.268
170 A 1.000** 74.268
171 R 1.000** 74.268
172 H 1.000** 74.268
173 R 1.000** 74.268
174 Q 1.000** 74.268
175 A 1.000** 74.268
176 Y 1.000** 74.268
177 R 1.000** 74.268
178 A 1.000** 74.268
179 K 1.000** 74.268
180 V 1.000** 74.268
181 A 1.000** 74.268
182 G 1.000** 74.268
183 E 1.000** 74.268
184 V 1.000** 74.268
185 K 1.000** 74.268
186 A 1.000** 74.268
187 T 1.000** 74.268
188 R 1.000** 74.268
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907745_1_492_MLBR_RS02355)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
w2: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Posterior for p0-p1 (see the ternary graph) (YWN2015, fig. 1)
0.010
0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010 0.010
sum of density on p0-p1 = 1.000000
Time used: 0:05
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 9): -738.022688 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 2.136334
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907745_1_492_MLBR_RS02355: 0.000004, NC_002677_1_NP_301421_1_293_ruvC: 0.000004, NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495: 0.000004, NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120: 0.000004, NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580: 0.000004, NZ_AP014567_1_WP_010907745_1_522_ruvC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M7 (beta):
p = 0.00500 q = 2.13633
MLEs of dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
7..2 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
7..3 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
7..4 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
7..5 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
7..6 0.000 407.2 156.8 0.0000 0.0000 0.0000 0.0 0.0
Time used: 0:08
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, 4, 5, 6); MP score: 0
lnL(ntime: 6 np: 11): -738.022646 +0.000000
7..1 7..2 7..3 7..4 7..5 7..6
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 2.136157 19.390912
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.000024
(1: 0.000004, 2: 0.000004, 3: 0.000004, 4: 0.000004, 5: 0.000004, 6: 0.000004);
(NC_011896_1_WP_010907745_1_492_MLBR_RS02355: 0.000004, NC_002677_1_NP_301421_1_293_ruvC: 0.000004, NZ_LVXE01000021_1_WP_010907745_1_931_A3216_RS07495: 0.000004, NZ_LYPH01000055_1_WP_010907745_1_2117_A8144_RS10120: 0.000004, NZ_CP029543_1_WP_010907745_1_504_DIJ64_RS02580: 0.000004, NZ_AP014567_1_WP_010907745_1_522_ruvC: 0.000004);
Detailed output identifying parameters
kappa (ts/tv) = 0.00010
Parameters in M8 (beta&w>1):
p0 = 0.00001 p = 0.00500 q = 2.13616
(p1 = 0.99999) w = 19.39091
MLEs of dN/dS (w) for site classes (K=11)
p: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.99999
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 19.39091
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
7..1 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
7..2 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
7..3 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
7..4 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
7..5 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
7..6 0.000 407.2 156.8 19.3907 0.0000 0.0000 0.0 0.0
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907745_1_492_MLBR_RS02355)
Pr(w>1) post mean +- SE for w
1 M 1.000** 19.391
2 R 1.000** 19.391
3 V 1.000** 19.391
4 M 1.000** 19.391
5 G 1.000** 19.391
6 V 1.000** 19.391
7 D 1.000** 19.391
8 P 1.000** 19.391
9 G 1.000** 19.391
10 L 1.000** 19.391
11 T 1.000** 19.391
12 R 1.000** 19.391
13 C 1.000** 19.391
14 G 1.000** 19.391
15 L 1.000** 19.391
16 S 1.000** 19.391
17 V 1.000** 19.391
18 V 1.000** 19.391
19 E 1.000** 19.391
20 N 1.000** 19.391
21 G 1.000** 19.391
22 R 1.000** 19.391
23 G 1.000** 19.391
24 S 1.000** 19.391
25 Q 1.000** 19.391
26 V 1.000** 19.391
27 V 1.000** 19.391
28 A 1.000** 19.391
29 L 1.000** 19.391
30 D 1.000** 19.391
31 V 1.000** 19.391
32 D 1.000** 19.391
33 V 1.000** 19.391
34 V 1.000** 19.391
35 R 1.000** 19.391
36 T 1.000** 19.391
37 P 1.000** 19.391
38 S 1.000** 19.391
39 D 1.000** 19.391
40 A 1.000** 19.391
41 P 1.000** 19.391
42 V 1.000** 19.391
43 S 1.000** 19.391
44 K 1.000** 19.391
45 R 1.000** 19.391
46 L 1.000** 19.391
47 L 1.000** 19.391
48 A 1.000** 19.391
49 V 1.000** 19.391
50 S 1.000** 19.391
51 D 1.000** 19.391
52 V 1.000** 19.391
53 V 1.000** 19.391
54 E 1.000** 19.391
55 H 1.000** 19.391
56 W 1.000** 19.391
57 L 1.000** 19.391
58 D 1.000** 19.391
59 A 1.000** 19.391
60 H 1.000** 19.391
61 H 1.000** 19.391
62 P 1.000** 19.391
63 D 1.000** 19.391
64 V 1.000** 19.391
65 M 1.000** 19.391
66 A 1.000** 19.391
67 I 1.000** 19.391
68 E 1.000** 19.391
69 R 1.000** 19.391
70 V 1.000** 19.391
71 F 1.000** 19.391
72 S 1.000** 19.391
73 Q 1.000** 19.391
74 Q 1.000** 19.391
75 N 1.000** 19.391
76 V 1.000** 19.391
77 S 1.000** 19.391
78 T 1.000** 19.391
79 V 1.000** 19.391
80 M 1.000** 19.391
81 G 1.000** 19.391
82 T 1.000** 19.391
83 A 1.000** 19.391
84 Q 1.000** 19.391
85 A 1.000** 19.391
86 G 1.000** 19.391
87 G 1.000** 19.391
88 V 1.000** 19.391
89 I 1.000** 19.391
90 A 1.000** 19.391
91 L 1.000** 19.391
92 A 1.000** 19.391
93 A 1.000** 19.391
94 A 1.000** 19.391
95 R 1.000** 19.391
96 R 1.000** 19.391
97 G 1.000** 19.391
98 I 1.000** 19.391
99 D 1.000** 19.391
100 V 1.000** 19.391
101 H 1.000** 19.391
102 F 1.000** 19.391
103 H 1.000** 19.391
104 T 1.000** 19.391
105 P 1.000** 19.391
106 S 1.000** 19.391
107 E 1.000** 19.391
108 V 1.000** 19.391
109 K 1.000** 19.391
110 A 1.000** 19.391
111 A 1.000** 19.391
112 V 1.000** 19.391
113 T 1.000** 19.391
114 G 1.000** 19.391
115 N 1.000** 19.391
116 G 1.000** 19.391
117 A 1.000** 19.391
118 A 1.000** 19.391
119 N 1.000** 19.391
120 K 1.000** 19.391
121 A 1.000** 19.391
122 Q 1.000** 19.391
123 V 1.000** 19.391
124 T 1.000** 19.391
125 A 1.000** 19.391
126 M 1.000** 19.391
127 V 1.000** 19.391
128 T 1.000** 19.391
129 R 1.000** 19.391
130 I 1.000** 19.391
131 L 1.000** 19.391
132 A 1.000** 19.391
133 L 1.000** 19.391
134 Q 1.000** 19.391
135 A 1.000** 19.391
136 K 1.000** 19.391
137 P 1.000** 19.391
138 T 1.000** 19.391
139 P 1.000** 19.391
140 A 1.000** 19.391
141 D 1.000** 19.391
142 A 1.000** 19.391
143 A 1.000** 19.391
144 D 1.000** 19.391
145 A 1.000** 19.391
146 L 1.000** 19.391
147 A 1.000** 19.391
148 L 1.000** 19.391
149 A 1.000** 19.391
150 I 1.000** 19.391
151 C 1.000** 19.391
152 H 1.000** 19.391
153 C 1.000** 19.391
154 W 1.000** 19.391
155 R 1.000** 19.391
156 A 1.000** 19.391
157 P 1.000** 19.391
158 M 1.000** 19.391
159 I 1.000** 19.391
160 A 1.000** 19.391
161 R 1.000** 19.391
162 M 1.000** 19.391
163 A 1.000** 19.391
164 E 1.000** 19.391
165 A 1.000** 19.391
166 E 1.000** 19.391
167 A 1.000** 19.391
168 L 1.000** 19.391
169 G 1.000** 19.391
170 A 1.000** 19.391
171 R 1.000** 19.391
172 H 1.000** 19.391
173 R 1.000** 19.391
174 Q 1.000** 19.391
175 A 1.000** 19.391
176 Y 1.000** 19.391
177 R 1.000** 19.391
178 A 1.000** 19.391
179 K 1.000** 19.391
180 V 1.000** 19.391
181 A 1.000** 19.391
182 G 1.000** 19.391
183 E 1.000** 19.391
184 V 1.000** 19.391
185 K 1.000** 19.391
186 A 1.000** 19.391
187 T 1.000** 19.391
188 R 1.000** 19.391
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: NC_011896_1_WP_010907745_1_492_MLBR_RS02355)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
p : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
q : 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
ws: 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100 0.100
Time used: 0:13
Model 1: NearlyNeutral -738.022657 Model 2: PositiveSelection -738.022646 Model 0: one-ratio -738.022662 Model 7: beta -738.022688 Model 8: beta&w>1 -738.022646 Model 0 vs 1 9.999999974752427E-6 Model 2 vs 1 2.199999994445534E-5 Model 8 vs 7 8.400000001529406E-5
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
