--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Jan 23 14:13:26 GMT 2020
codeml.models=0 1 2 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=MUSCLE
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=/usr/bin/
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb
tcoffee.bin=t_coffee
mrbayes.dir=/opt/mrbayes_3.2.2/src
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/data/12res/ruvC/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1       -766.15          -768.81
2       -766.14          -770.03
--------------------------------------
TOTAL     -766.15          -769.59
--------------------------------------


Model parameter summaries over the runs sampled in files
"/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.894340    0.091300    0.367878    1.498241    0.862858   1311.42   1337.80    1.000
r(A<->C){all}   0.155006    0.018303    0.000099    0.423802    0.116959    286.00    322.25    1.002
r(A<->G){all}   0.164240    0.019597    0.000178    0.448944    0.126785    158.45    245.50    1.000
r(A<->T){all}   0.171656    0.020972    0.000024    0.460678    0.133311    204.89    229.94    1.001
r(C<->G){all}   0.169406    0.021815    0.000015    0.474100    0.127922    212.42    245.36    1.002
r(C<->T){all}   0.165478    0.019470    0.000038    0.441700    0.129875    118.62    187.72    1.000
r(G<->T){all}   0.174214    0.021433    0.000159    0.469350    0.136679    153.17    228.24    1.000
pi(A){all}      0.193276    0.000268    0.160269    0.223355    0.193090   1166.98   1333.99    1.000
pi(C){all}      0.276518    0.000365    0.241365    0.315864    0.276109   1150.46   1228.06    1.000
pi(G){all}      0.340136    0.000399    0.298217    0.376861    0.339543   1044.88   1137.35    1.000
pi(T){all}      0.190070    0.000275    0.158746    0.222439    0.190179   1089.13   1197.05    1.000
alpha{1,2}      0.414877    0.216945    0.000154    1.356806    0.245208    936.08   1103.77    1.001
alpha{3}        0.469684    0.254609    0.000368    1.529902    0.298465   1186.34   1259.47    1.001
pinvar{all}     0.997311    0.000010    0.991430    0.999998    0.998358   1216.58   1304.07    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-738.022657
Model 2: PositiveSelection	-738.022646
Model 0: one-ratio	-738.022662
Model 7: beta	-738.022688
Model 8: beta&w>1	-738.022646


Model 0 vs 1	9.999999974752427E-6

Model 2 vs 1	2.199999994445534E-5

Model 8 vs 7	8.400000001529406E-5
>C1
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C2
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C3
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C4
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C5
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C6
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=6, Len=188 

C1              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C2              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C3              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C4              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C5              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C6              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
                **************************************************

C1              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C2              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C3              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C4              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C5              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C6              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
                **************************************************

C1              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C2              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C3              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C4              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C5              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C6              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
                **************************************************

C1              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C2              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C3              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C4              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C5              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C6              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
                **************************************




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	input.prot.fasta.muscle_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) input.prot.fasta.muscle_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 6 SEQUENCES  [PROTEIN]
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C1 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C2 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C3 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C4 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C5 Length  188 type PROTEIN Struct Unchecked
  Input File input.prot.fasta.muscle_rs_0_0.fasta.aln Seq C6 Length  188 type PROTEIN Struct Unchecked

	Multi Core Mode: 96 processors:

	--- Process Method/Library/Aln Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved Sinput.prot.fasta.muscle_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [5640]

Library Relaxation: Multi_proc [96]
 
Relaxation Summary: [5640]--->[5640]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.prot.fasta.muscle_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.prot.fasta.muscle_rs_0_0.fasta.score_ascii

# Command Line: t_coffee -infile input.prot.fasta.muscle_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.467 Mb, Max= 30.719 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:09 - Revision 1613 - Build 432)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/

FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_i.fasta Not Supported[FATAL:T-COFFEE]
CLUSTAL W (1.83) multiple sequence alignment

C1              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C2              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C3              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C4              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C5              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
C6              MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
                **************************************************

C1              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C2              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C3              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C4              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C5              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
C6              DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
                **************************************************

C1              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C2              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C3              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C4              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C5              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
C6              HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
                **************************************************

C1              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C2              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C3              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C4              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C5              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
C6              CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
                **************************************




FORMAT of file input.prot.fasta.muscle_rs_0_0.fasta.ipi_bs.fasta Not Supported[FATAL:T-COFFEE]
input.prot.fasta.muscle_rs_0_0.fasta.aln I:93 S:100 BS:94
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# PW_SEQ_DISTANCES 
BOT	    0    1	 100.00 C1	 C2	 100.00
TOP	    1    0	 100.00 C2	 C1	 100.00
BOT	    0    2	 100.00 C1	 C3	 100.00
TOP	    2    0	 100.00 C3	 C1	 100.00
BOT	    0    3	 100.00 C1	 C4	 100.00
TOP	    3    0	 100.00 C4	 C1	 100.00
BOT	    0    4	 100.00 C1	 C5	 100.00
TOP	    4    0	 100.00 C5	 C1	 100.00
BOT	    0    5	 100.00 C1	 C6	 100.00
TOP	    5    0	 100.00 C6	 C1	 100.00
BOT	    1    2	 100.00 C2	 C3	 100.00
TOP	    2    1	 100.00 C3	 C2	 100.00
BOT	    1    3	 100.00 C2	 C4	 100.00
TOP	    3    1	 100.00 C4	 C2	 100.00
BOT	    1    4	 100.00 C2	 C5	 100.00
TOP	    4    1	 100.00 C5	 C2	 100.00
BOT	    1    5	 100.00 C2	 C6	 100.00
TOP	    5    1	 100.00 C6	 C2	 100.00
BOT	    2    3	 100.00 C3	 C4	 100.00
TOP	    3    2	 100.00 C4	 C3	 100.00
BOT	    2    4	 100.00 C3	 C5	 100.00
TOP	    4    2	 100.00 C5	 C3	 100.00
BOT	    2    5	 100.00 C3	 C6	 100.00
TOP	    5    2	 100.00 C6	 C3	 100.00
BOT	    3    4	 100.00 C4	 C5	 100.00
TOP	    4    3	 100.00 C5	 C4	 100.00
BOT	    3    5	 100.00 C4	 C6	 100.00
TOP	    5    3	 100.00 C6	 C4	 100.00
BOT	    4    5	 100.00 C5	 C6	 100.00
TOP	    5    4	 100.00 C6	 C5	 100.00
AVG	 0	 C1	  *	 100.00
AVG	 1	 C2	  *	 100.00
AVG	 2	 C3	  *	 100.00
AVG	 3	 C4	  *	 100.00
AVG	 4	 C5	  *	 100.00
AVG	 5	 C6	  *	 100.00
TOT	 TOT	  *	 100.00
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C2              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C3              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C4              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C5              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
C6              ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
                **************************************************

C1              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C2              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C3              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C4              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C5              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
C6              CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
                **************************************************

C1              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C2              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C3              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C4              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C5              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
C6              TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
                **************************************************

C1              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C2              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C3              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C4              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C5              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
C6              GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
                **************************************************

C1              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C2              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C3              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C4              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C5              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
C6              CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
                **************************************************

C1              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C2              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C3              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C4              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C5              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
C6              AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
                **************************************************

C1              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C2              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C3              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C4              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C5              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
C6              CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
                **************************************************

C1              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C2              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C3              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C4              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C5              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
C6              CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
                **************************************************

C1              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C2              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C3              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C4              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C5              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
C6              AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
                **************************************************

C1              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C2              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C3              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C4              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C5              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
C6              TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
                **************************************************

C1              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C2              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C3              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C4              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C5              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
C6              GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
                **************************************************

C1              TTAAGGCCACCCGG
C2              TTAAGGCCACCCGG
C3              TTAAGGCCACCCGG
C4              TTAAGGCCACCCGG
C5              TTAAGGCCACCCGG
C6              TTAAGGCCACCCGG
                **************



>C1
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C2
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C3
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C4
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C5
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C6
ATGCGCGTGATGGGCGTCGATCCCGGGTTGACGCGGTGCGGGTTGTCTGT
CGTCGAAAATGGGCGCGGTAGCCAAGTTGTTGCGTTGGATGTCGATGTGG
TGCGCACACCATCGGACGCACCGGTATCCAAGCGCTTGCTGGCTGTCAGC
GATGTCGTCGAACACTGGCTGGACGCCCATCATCCGGATGTTATGGCCAT
CGAACGGGTTTTTTCTCAGCAGAATGTGTCGACGGTGATGGGTACGGCAC
AAGCCGGCGGTGTGATCGCGTTGGCCGCGGCGAGACGCGGTATCGACGTA
CATTTCCATACCCCAAGTGAGGTTAAGGCCGCAGTTACCGGCAATGGTGC
CGCCAACAAAGCGCAAGTTACCGCGATGGTGACCAGAATCCTTGCACTGC
AAGCTAAACCGACACCGGCCGATGCGGCCGACGCGTTGGCCCTGGCGATC
TGCCACTGCTGGAGAGCACCAATGATCGCGCGGATGGCAGAAGCCGAAGC
GCTGGGCGCGCGGCACCGTCAGGCCTATCGGGCCAAGGTAGCTGGCGAGG
TTAAGGCCACCCGG
>C1
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C2
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C3
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C4
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C5
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR
>C6
MRVMGVDPGLTRCGLSVVENGRGSQVVALDVDVVRTPSDAPVSKRLLAVS
DVVEHWLDAHHPDVMAIERVFSQQNVSTVMGTAQAGGVIALAAARRGIDV
HFHTPSEVKAAVTGNGAANKAQVTAMVTRILALQAKPTPADAADALALAI
CHCWRAPMIARMAEAEALGARHRQAYRAKVAGEVKATR


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 6 taxa and 564 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Taxon 6 -> C6
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1579788725
      Setting output file names to "/data/12res/ruvC/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1502241124
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 0651772583
      Seed = 472135240
      Swapseed = 1579788725
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 4 unique site patterns
      Division 2 has 4 unique site patterns
      Division 3 has 4 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1262.258964 -- -24.965149
         Chain 2 -- -1262.259037 -- -24.965149
         Chain 3 -- -1262.259037 -- -24.965149
         Chain 4 -- -1262.258964 -- -24.965149

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1262.259037 -- -24.965149
         Chain 2 -- -1262.258964 -- -24.965149
         Chain 3 -- -1262.259037 -- -24.965149
         Chain 4 -- -1262.259037 -- -24.965149


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1262.259] (-1262.259) (-1262.259) (-1262.259) * [-1262.259] (-1262.259) (-1262.259) (-1262.259) 
        500 -- (-776.983) (-779.181) [-783.343] (-778.366) * (-794.569) [-784.052] (-787.173) (-789.818) -- 0:00:00
       1000 -- [-777.378] (-784.803) (-772.631) (-780.659) * [-779.076] (-786.055) (-776.075) (-777.752) -- 0:00:00
       1500 -- (-779.397) (-787.506) [-771.799] (-779.541) * (-779.857) (-772.064) [-775.843] (-776.140) -- 0:00:00
       2000 -- (-773.901) [-777.558] (-778.861) (-778.320) * (-774.254) (-773.673) (-776.762) [-777.731] -- 0:00:00
       2500 -- (-770.132) (-775.084) [-779.664] (-778.344) * (-773.645) (-774.223) (-777.192) [-774.711] -- 0:00:00
       3000 -- [-773.141] (-780.238) (-774.179) (-778.294) * (-769.956) [-782.642] (-778.327) (-774.431) -- 0:00:00
       3500 -- [-770.430] (-774.026) (-774.590) (-775.260) * [-777.255] (-774.794) (-777.257) (-777.042) -- 0:00:00
       4000 -- (-772.070) (-785.911) (-772.128) [-773.534] * (-785.618) (-780.459) (-776.788) [-784.366] -- 0:00:00
       4500 -- (-775.360) [-776.993] (-779.014) (-773.083) * (-780.513) (-779.709) (-776.520) [-782.511] -- 0:00:00
       5000 -- [-776.822] (-783.148) (-778.180) (-787.208) * (-775.017) (-777.338) [-775.911] (-773.923) -- 0:00:00

      Average standard deviation of split frequencies: 0.067344

       5500 -- [-774.886] (-782.675) (-771.577) (-780.582) * (-777.117) (-776.013) [-777.839] (-780.154) -- 0:00:00
       6000 -- [-778.522] (-778.604) (-787.147) (-773.474) * [-770.387] (-770.976) (-777.691) (-778.734) -- 0:00:00
       6500 -- (-787.832) [-772.387] (-773.043) (-776.008) * [-776.371] (-774.996) (-783.746) (-775.552) -- 0:00:00
       7000 -- (-775.838) (-773.583) [-770.601] (-776.566) * (-784.165) (-777.317) [-771.454] (-773.403) -- 0:00:00
       7500 -- (-779.969) (-772.142) [-779.496] (-774.687) * [-774.485] (-774.566) (-777.461) (-778.755) -- 0:00:00
       8000 -- (-774.945) (-772.652) [-770.423] (-777.978) * (-774.387) (-774.880) [-779.034] (-768.032) -- 0:00:00
       8500 -- (-769.735) [-776.851] (-774.907) (-779.748) * [-770.326] (-776.736) (-784.654) (-780.568) -- 0:00:00
       9000 -- (-766.515) (-778.011) [-778.762] (-768.739) * (-785.816) [-772.841] (-777.165) (-776.907) -- 0:00:00
       9500 -- (-767.651) [-776.161] (-776.672) (-780.520) * (-776.513) (-780.752) (-772.750) [-780.775] -- 0:00:00
      10000 -- [-766.589] (-784.377) (-774.878) (-774.853) * (-772.398) (-776.320) [-773.581] (-778.881) -- 0:00:00

      Average standard deviation of split frequencies: 0.055243

      10500 -- (-767.647) (-771.216) (-778.405) [-771.390] * (-775.412) (-774.299) (-774.654) [-772.933] -- 0:00:00
      11000 -- (-766.343) (-787.009) (-773.640) [-777.698] * [-773.898] (-777.598) (-779.730) (-772.704) -- 0:00:00
      11500 -- (-769.964) [-772.913] (-782.209) (-776.356) * (-771.776) [-779.510] (-782.208) (-773.444) -- 0:00:00
      12000 -- (-768.648) (-774.612) [-779.690] (-774.553) * (-775.420) (-773.945) [-775.405] (-780.212) -- 0:00:00
      12500 -- (-766.824) (-780.528) (-781.036) [-776.863] * (-778.426) (-775.000) [-776.719] (-775.010) -- 0:00:00
      13000 -- [-766.540] (-780.884) (-782.919) (-782.568) * (-773.661) [-770.860] (-776.986) (-777.131) -- 0:00:00
      13500 -- (-767.096) (-775.322) (-773.550) [-773.327] * (-786.854) [-774.495] (-779.005) (-780.623) -- 0:00:00
      14000 -- (-767.449) (-777.454) (-769.662) [-775.560] * [-780.397] (-779.745) (-777.902) (-774.825) -- 0:00:00
      14500 -- (-765.520) (-772.517) [-771.554] (-785.886) * (-780.003) (-773.551) (-779.339) [-773.421] -- 0:01:07
      15000 -- [-765.954] (-772.254) (-782.607) (-773.905) * (-784.531) [-770.092] (-774.207) (-773.827) -- 0:01:05

      Average standard deviation of split frequencies: 0.038302

      15500 -- (-768.017) [-779.537] (-774.324) (-781.216) * [-771.345] (-782.263) (-775.732) (-775.058) -- 0:01:03
      16000 -- (-766.520) (-779.965) (-780.113) [-773.737] * (-778.172) [-774.380] (-773.755) (-777.431) -- 0:01:01
      16500 -- [-766.518] (-775.006) (-787.099) (-775.243) * (-781.009) (-776.050) (-782.396) [-773.235] -- 0:00:59
      17000 -- [-766.239] (-777.038) (-776.698) (-785.017) * (-778.984) (-771.694) (-778.515) [-768.273] -- 0:00:57
      17500 -- [-766.999] (-779.967) (-781.334) (-772.634) * (-784.978) (-771.266) (-773.608) [-771.524] -- 0:00:56
      18000 -- (-765.914) (-779.185) (-773.783) [-773.586] * [-772.019] (-774.942) (-775.856) (-772.017) -- 0:00:54
      18500 -- (-765.868) (-792.040) [-772.685] (-783.556) * [-766.540] (-771.133) (-778.381) (-783.783) -- 0:00:53
      19000 -- (-767.989) (-777.920) [-772.815] (-790.938) * (-768.393) [-778.902] (-776.256) (-782.695) -- 0:00:51
      19500 -- (-765.887) [-785.352] (-774.591) (-765.301) * (-765.041) [-774.764] (-782.488) (-772.244) -- 0:00:50
      20000 -- [-765.734] (-783.233) (-775.008) (-767.055) * [-769.317] (-774.075) (-780.846) (-772.373) -- 0:00:49

      Average standard deviation of split frequencies: 0.051322

      20500 -- (-765.777) [-773.500] (-773.203) (-771.657) * (-769.329) (-777.850) [-776.476] (-778.497) -- 0:00:47
      21000 -- (-767.802) (-766.815) (-772.963) [-768.447] * (-765.308) [-779.981] (-776.848) (-777.354) -- 0:00:46
      21500 -- [-765.353] (-766.229) (-777.306) (-770.179) * [-766.830] (-785.301) (-776.541) (-773.646) -- 0:00:45
      22000 -- (-766.858) (-768.402) (-772.287) [-765.853] * [-767.624] (-777.093) (-766.037) (-781.068) -- 0:00:44
      22500 -- (-765.869) (-767.199) (-770.746) [-769.745] * (-769.593) [-779.576] (-767.677) (-781.044) -- 0:00:43
      23000 -- [-765.157] (-766.444) (-779.634) (-765.819) * [-764.786] (-782.491) (-767.472) (-775.625) -- 0:00:42
      23500 -- (-765.275) [-768.615] (-791.685) (-765.419) * (-767.237) (-778.012) [-767.953] (-778.999) -- 0:00:41
      24000 -- [-767.062] (-765.277) (-766.056) (-766.201) * (-765.961) (-773.805) [-764.974] (-772.662) -- 0:00:40
      24500 -- (-768.013) [-765.151] (-768.195) (-768.498) * (-766.273) [-775.306] (-767.692) (-781.983) -- 0:00:39
      25000 -- [-767.197] (-766.812) (-768.463) (-768.236) * (-765.473) (-773.799) (-768.935) [-771.435] -- 0:00:39

      Average standard deviation of split frequencies: 0.035438

      25500 -- (-768.073) (-767.828) (-770.083) [-766.428] * (-765.570) [-774.327] (-767.729) (-780.549) -- 0:00:38
      26000 -- (-766.459) [-765.582] (-770.250) (-768.556) * [-767.177] (-789.155) (-767.395) (-772.702) -- 0:00:37
      26500 -- (-766.516) (-768.623) (-766.923) [-766.536] * (-766.580) [-780.709] (-766.680) (-771.741) -- 0:00:36
      27000 -- (-769.213) (-769.514) [-765.484] (-768.950) * [-765.501] (-777.230) (-765.825) (-775.964) -- 0:00:36
      27500 -- (-769.706) (-768.750) (-766.415) [-768.094] * (-769.280) (-783.405) [-767.698] (-772.125) -- 0:00:35
      28000 -- (-765.950) (-768.778) (-770.508) [-767.611] * (-767.397) (-776.859) [-765.350] (-778.033) -- 0:00:34
      28500 -- (-764.927) [-766.876] (-766.256) (-768.962) * [-767.215] (-778.495) (-766.489) (-775.166) -- 0:01:08
      29000 -- (-765.488) [-768.934] (-765.547) (-767.957) * (-768.624) (-770.826) [-765.999] (-778.812) -- 0:01:06
      29500 -- (-764.676) (-766.914) [-766.753] (-766.355) * (-768.460) [-778.190] (-765.562) (-779.706) -- 0:01:05
      30000 -- [-765.619] (-768.351) (-767.017) (-768.208) * (-770.173) (-777.480) (-765.313) [-774.010] -- 0:01:04

      Average standard deviation of split frequencies: 0.029975

      30500 -- [-769.576] (-766.579) (-764.928) (-770.896) * (-765.306) [-770.654] (-766.661) (-771.848) -- 0:01:03
      31000 -- (-766.917) (-768.400) [-765.870] (-767.294) * [-764.788] (-779.512) (-766.398) (-777.805) -- 0:01:02
      31500 -- [-765.698] (-765.640) (-766.097) (-768.429) * (-764.818) (-764.601) [-765.641] (-775.783) -- 0:01:01
      32000 -- (-765.618) (-766.403) [-765.990] (-767.857) * (-765.036) (-765.723) (-766.391) [-771.785] -- 0:01:00
      32500 -- [-766.250] (-768.300) (-767.288) (-770.511) * [-764.832] (-765.320) (-765.115) (-771.241) -- 0:00:59
      33000 -- (-765.252) (-766.820) (-765.382) [-767.788] * (-764.815) (-767.141) [-766.693] (-781.289) -- 0:00:58
      33500 -- [-765.582] (-767.876) (-765.378) (-766.209) * [-765.840] (-769.987) (-767.386) (-776.626) -- 0:00:57
      34000 -- (-767.492) (-768.757) (-765.965) [-765.605] * [-767.393] (-764.765) (-770.410) (-778.106) -- 0:00:56
      34500 -- (-766.043) (-769.031) [-765.442] (-764.971) * (-769.080) (-766.361) [-765.828] (-780.898) -- 0:00:55
      35000 -- (-766.894) (-764.934) (-765.917) [-767.230] * (-766.214) (-765.509) (-765.485) [-775.882] -- 0:00:55

      Average standard deviation of split frequencies: 0.033391

      35500 -- [-766.948] (-765.709) (-765.293) (-769.647) * (-766.844) [-765.159] (-766.523) (-776.334) -- 0:00:54
      36000 -- (-767.052) (-766.253) [-765.592] (-767.532) * (-767.608) [-764.902] (-767.611) (-780.718) -- 0:00:53
      36500 -- (-767.399) [-765.859] (-764.725) (-769.907) * (-769.210) (-767.838) (-767.214) [-773.067] -- 0:00:52
      37000 -- [-767.061] (-767.503) (-770.942) (-773.974) * (-769.267) (-769.528) [-770.800] (-778.046) -- 0:00:52
      37500 -- [-766.990] (-766.960) (-766.856) (-765.194) * (-767.293) (-766.020) (-767.614) [-772.816] -- 0:00:51
      38000 -- (-764.930) (-766.823) [-766.019] (-769.344) * (-768.026) (-766.763) [-765.731] (-781.135) -- 0:00:50
      38500 -- (-765.301) [-765.876] (-766.369) (-778.677) * (-766.406) [-768.557] (-764.834) (-778.543) -- 0:00:49
      39000 -- (-765.112) [-764.562] (-769.951) (-770.567) * (-771.929) (-765.448) [-765.505] (-782.797) -- 0:00:49
      39500 -- (-766.089) (-767.575) (-765.672) [-767.599] * (-769.892) (-767.450) [-766.018] (-779.474) -- 0:00:48
      40000 -- (-769.669) (-769.460) [-766.449] (-768.085) * (-768.500) [-768.519] (-767.371) (-766.987) -- 0:00:48

      Average standard deviation of split frequencies: 0.037826

      40500 -- (-765.248) [-767.945] (-767.085) (-767.266) * (-768.576) (-766.947) [-768.236] (-766.241) -- 0:00:47
      41000 -- (-768.074) (-767.807) [-769.098] (-767.119) * (-771.472) [-765.799] (-769.443) (-767.437) -- 0:00:46
      41500 -- (-768.716) (-772.840) (-765.648) [-767.627] * (-766.746) (-767.586) (-768.340) [-766.265] -- 0:00:46
      42000 -- (-765.817) [-770.847] (-765.944) (-766.844) * (-767.582) (-767.591) [-766.384] (-764.894) -- 0:00:45
      42500 -- [-767.976] (-768.183) (-765.728) (-769.263) * (-766.162) (-766.626) (-766.927) [-765.232] -- 0:00:45
      43000 -- (-767.190) (-765.048) [-765.106] (-771.011) * [-769.700] (-766.794) (-767.014) (-768.498) -- 0:00:44
      43500 -- [-766.467] (-767.878) (-767.500) (-766.692) * (-765.599) (-765.903) [-767.888] (-767.161) -- 0:00:43
      44000 -- [-766.913] (-765.756) (-770.654) (-766.709) * (-766.037) [-765.219] (-766.162) (-766.529) -- 0:00:43
      44500 -- (-767.149) (-765.836) [-764.643] (-768.787) * (-765.385) [-765.481] (-766.638) (-765.637) -- 0:01:04
      45000 -- (-767.739) (-768.118) [-767.457] (-771.512) * (-766.829) [-765.402] (-767.050) (-768.156) -- 0:01:03

      Average standard deviation of split frequencies: 0.033818

      45500 -- (-766.608) (-767.870) (-769.225) [-766.625] * [-765.229] (-764.799) (-764.805) (-768.317) -- 0:01:02
      46000 -- (-768.760) (-768.304) [-765.760] (-765.888) * (-764.838) [-764.751] (-767.811) (-765.908) -- 0:01:02
      46500 -- (-768.919) (-766.402) [-766.773] (-765.286) * (-764.646) [-767.017] (-771.640) (-765.973) -- 0:01:01
      47000 -- (-768.423) [-765.218] (-770.616) (-766.689) * [-764.633] (-768.895) (-768.837) (-769.304) -- 0:01:00
      47500 -- (-766.739) (-767.227) [-766.840] (-764.802) * (-764.855) (-769.049) [-765.627] (-769.890) -- 0:01:00
      48000 -- (-771.716) (-767.485) [-766.467] (-766.375) * (-764.611) (-768.845) [-767.624] (-767.990) -- 0:00:59
      48500 -- (-769.709) [-768.527] (-767.093) (-765.847) * [-765.825] (-766.790) (-769.407) (-766.494) -- 0:00:58
      49000 -- (-766.036) (-765.959) [-767.021] (-765.299) * (-768.705) [-766.550] (-765.606) (-766.426) -- 0:00:58
      49500 -- (-765.818) (-766.686) [-771.865] (-768.748) * (-767.280) (-768.203) (-765.845) [-764.801] -- 0:00:57
      50000 -- (-766.784) (-769.278) [-765.311] (-765.635) * (-766.081) (-771.011) [-765.828] (-765.326) -- 0:00:57

      Average standard deviation of split frequencies: 0.035887

      50500 -- (-766.285) (-770.226) (-765.914) [-768.683] * (-767.785) (-770.060) [-766.255] (-768.307) -- 0:00:56
      51000 -- (-768.466) (-769.441) (-768.359) [-766.523] * (-770.403) (-774.759) (-767.158) [-768.549] -- 0:00:55
      51500 -- (-766.135) (-772.347) (-767.221) [-766.946] * (-766.050) (-767.057) (-768.278) [-765.327] -- 0:00:55
      52000 -- (-766.866) (-768.350) (-766.553) [-766.021] * (-767.019) (-766.803) (-767.980) [-765.327] -- 0:00:54
      52500 -- (-768.111) (-769.485) [-769.305] (-767.122) * (-766.314) (-766.148) [-767.464] (-766.134) -- 0:00:54
      53000 -- (-768.567) (-764.820) (-769.098) [-764.946] * (-765.769) (-765.886) (-767.483) [-765.945] -- 0:00:53
      53500 -- (-767.131) (-766.811) [-767.591] (-768.063) * (-767.220) (-766.835) [-767.552] (-767.060) -- 0:00:53
      54000 -- (-767.087) (-770.710) (-766.982) [-766.832] * [-764.902] (-765.394) (-769.547) (-766.734) -- 0:00:52
      54500 -- [-768.507] (-771.957) (-765.945) (-765.344) * (-767.356) (-766.003) (-769.581) [-765.847] -- 0:00:52
      55000 -- (-766.687) (-770.544) [-765.968] (-765.396) * [-767.159] (-765.628) (-774.452) (-767.969) -- 0:00:51

      Average standard deviation of split frequencies: 0.030866

      55500 -- (-765.372) (-771.453) [-765.817] (-764.436) * [-764.732] (-768.000) (-766.900) (-767.133) -- 0:00:51
      56000 -- (-766.986) [-769.171] (-768.444) (-767.340) * (-766.196) (-766.836) (-768.475) [-767.553] -- 0:00:50
      56500 -- (-766.732) [-769.171] (-765.739) (-767.159) * (-767.205) [-767.013] (-770.348) (-769.679) -- 0:00:50
      57000 -- (-768.563) [-766.491] (-766.526) (-769.663) * (-769.651) (-769.855) [-767.980] (-766.328) -- 0:00:49
      57500 -- (-769.185) [-767.790] (-768.317) (-772.472) * (-769.596) [-765.225] (-767.273) (-765.777) -- 0:00:49
      58000 -- (-768.778) (-769.220) (-771.487) [-767.803] * [-771.937] (-765.882) (-767.655) (-765.599) -- 0:00:48
      58500 -- (-771.066) [-765.179] (-766.496) (-767.411) * (-772.296) [-765.347] (-767.369) (-765.205) -- 0:00:48
      59000 -- (-769.278) [-767.202] (-766.563) (-766.359) * (-766.703) (-767.038) (-766.565) [-765.128] -- 0:00:47
      59500 -- [-767.997] (-771.264) (-766.217) (-765.718) * [-765.874] (-767.685) (-765.990) (-767.227) -- 0:00:47
      60000 -- (-770.380) [-767.517] (-769.561) (-765.984) * (-767.866) (-768.731) (-766.720) [-771.044] -- 0:01:02

      Average standard deviation of split frequencies: 0.028256

      60500 -- (-770.040) [-766.616] (-765.921) (-765.004) * (-765.085) (-766.975) [-767.494] (-770.911) -- 0:01:02
      61000 -- (-770.312) (-765.680) [-765.864] (-767.618) * (-765.597) (-767.662) (-768.213) [-765.008] -- 0:01:01
      61500 -- (-765.219) (-766.053) [-765.519] (-765.841) * (-767.103) (-770.366) [-766.699] (-766.408) -- 0:01:01
      62000 -- (-766.877) [-765.775] (-766.551) (-765.952) * (-767.435) (-767.879) (-768.503) [-765.069] -- 0:01:00
      62500 -- [-765.260] (-767.530) (-768.775) (-767.251) * [-766.422] (-766.899) (-766.639) (-765.592) -- 0:01:00
      63000 -- [-768.166] (-765.406) (-767.309) (-766.473) * (-766.067) [-767.032] (-767.924) (-766.348) -- 0:00:59
      63500 -- (-767.205) (-768.560) [-775.639] (-765.450) * [-765.981] (-773.843) (-769.141) (-767.725) -- 0:00:58
      64000 -- (-765.223) [-766.926] (-768.450) (-766.373) * [-770.249] (-764.620) (-766.600) (-770.543) -- 0:00:58
      64500 -- (-767.067) [-768.291] (-768.571) (-770.200) * (-766.320) [-765.009] (-768.476) (-767.292) -- 0:00:58
      65000 -- (-767.371) [-766.731] (-767.456) (-766.119) * (-764.651) (-768.467) (-765.763) [-767.579] -- 0:00:57

      Average standard deviation of split frequencies: 0.025154

      65500 -- [-766.870] (-767.233) (-766.044) (-765.619) * (-764.651) (-766.681) [-766.530] (-767.223) -- 0:00:57
      66000 -- (-767.789) (-765.731) [-766.747] (-766.903) * (-768.095) (-768.515) (-767.068) [-766.908] -- 0:00:56
      66500 -- (-770.475) (-766.559) [-765.516] (-770.615) * [-764.663] (-769.580) (-765.861) (-768.079) -- 0:00:56
      67000 -- (-770.380) (-769.039) [-768.451] (-766.237) * (-765.024) (-767.843) [-769.728] (-766.867) -- 0:00:55
      67500 -- [-770.376] (-770.339) (-766.476) (-766.575) * (-765.569) (-765.735) [-766.464] (-767.920) -- 0:00:55
      68000 -- (-768.333) (-769.722) [-766.501] (-766.483) * (-765.263) (-765.066) (-769.057) [-766.929] -- 0:00:54
      68500 -- (-766.546) (-768.788) (-766.705) [-767.391] * [-767.065] (-768.260) (-766.962) (-767.929) -- 0:00:54
      69000 -- (-765.745) (-768.491) [-765.408] (-768.907) * [-765.875] (-770.191) (-767.387) (-769.270) -- 0:00:53
      69500 -- (-768.034) (-769.350) (-765.911) [-766.623] * (-767.584) [-767.395] (-768.889) (-768.519) -- 0:00:53
      70000 -- (-767.724) (-768.549) [-766.297] (-767.505) * (-768.408) [-766.985] (-766.446) (-766.037) -- 0:00:53

      Average standard deviation of split frequencies: 0.027954

      70500 -- (-767.025) (-768.695) [-764.860] (-765.294) * (-768.436) [-765.674] (-765.976) (-765.841) -- 0:00:52
      71000 -- (-765.891) (-766.353) [-766.572] (-768.415) * (-775.874) (-767.817) [-765.300] (-767.920) -- 0:00:52
      71500 -- (-765.337) [-766.962] (-768.372) (-766.436) * (-773.357) (-773.451) [-766.473] (-766.873) -- 0:00:51
      72000 -- (-767.136) (-765.031) [-766.471] (-766.882) * (-771.198) (-768.446) [-769.457] (-768.548) -- 0:00:51
      72500 -- (-767.960) [-765.701] (-766.855) (-765.461) * [-773.500] (-767.397) (-766.081) (-766.539) -- 0:00:51
      73000 -- [-766.635] (-768.165) (-768.398) (-767.118) * (-767.864) [-768.818] (-768.610) (-766.298) -- 0:00:50
      73500 -- (-768.033) (-770.236) [-766.643] (-766.739) * (-765.273) (-770.266) (-767.720) [-767.364] -- 0:00:50
      74000 -- (-767.147) [-765.849] (-768.242) (-766.312) * [-768.620] (-767.350) (-765.598) (-771.802) -- 0:00:50
      74500 -- [-766.898] (-770.895) (-766.388) (-768.352) * [-769.583] (-766.015) (-768.462) (-767.773) -- 0:00:49
      75000 -- [-766.757] (-767.534) (-765.337) (-765.930) * (-770.343) (-766.652) (-767.501) [-769.138] -- 0:00:49

      Average standard deviation of split frequencies: 0.027912

      75500 -- [-765.777] (-766.115) (-767.791) (-767.483) * [-768.524] (-768.065) (-767.201) (-768.199) -- 0:00:48
      76000 -- (-768.509) [-768.079] (-765.512) (-768.728) * [-768.953] (-766.393) (-768.720) (-766.799) -- 0:00:48
      76500 -- (-768.492) (-765.844) [-764.691] (-766.950) * (-764.901) [-765.927] (-768.242) (-766.206) -- 0:01:00
      77000 -- (-764.762) (-769.534) [-765.296] (-771.679) * (-765.060) (-765.249) (-768.709) [-766.564] -- 0:00:59
      77500 -- (-766.068) (-773.476) (-766.472) [-768.200] * (-765.386) [-766.612] (-767.352) (-765.764) -- 0:00:59
      78000 -- [-765.327] (-768.525) (-766.650) (-767.345) * (-766.337) (-766.650) (-766.332) [-765.668] -- 0:00:59
      78500 -- (-765.252) (-766.488) [-764.882] (-768.745) * (-766.744) (-765.620) (-768.401) [-767.183] -- 0:00:58
      79000 -- (-768.218) (-766.083) (-766.076) [-768.637] * (-765.125) [-768.646] (-766.236) (-770.842) -- 0:00:58
      79500 -- (-769.502) [-766.918] (-764.545) (-768.576) * (-767.582) [-766.074] (-765.600) (-767.763) -- 0:00:57
      80000 -- (-766.804) (-767.303) [-764.857] (-764.973) * (-765.490) (-768.636) [-767.540] (-767.476) -- 0:00:57

      Average standard deviation of split frequencies: 0.025973

      80500 -- (-766.264) [-769.023] (-766.122) (-768.679) * [-767.661] (-768.863) (-766.556) (-768.000) -- 0:00:57
      81000 -- (-765.845) (-771.697) (-767.003) [-771.366] * (-771.591) [-767.839] (-767.106) (-765.480) -- 0:00:56
      81500 -- (-766.328) (-775.017) [-764.699] (-765.902) * (-768.099) (-765.727) (-768.626) [-765.698] -- 0:00:56
      82000 -- (-766.324) (-770.431) (-767.220) [-766.167] * (-767.169) [-764.914] (-767.953) (-769.233) -- 0:00:55
      82500 -- [-765.081] (-767.844) (-768.237) (-766.269) * [-766.810] (-767.842) (-770.128) (-765.391) -- 0:00:55
      83000 -- (-766.807) [-767.454] (-765.272) (-766.119) * (-765.084) (-770.288) (-770.644) [-768.589] -- 0:00:55
      83500 -- [-768.740] (-770.407) (-765.164) (-768.245) * (-766.496) (-768.063) [-766.677] (-767.090) -- 0:00:54
      84000 -- (-765.673) (-767.339) [-767.440] (-766.638) * (-765.327) (-765.980) [-765.589] (-768.028) -- 0:00:54
      84500 -- [-765.033] (-771.091) (-766.909) (-766.081) * [-767.323] (-766.488) (-772.723) (-766.548) -- 0:00:54
      85000 -- [-766.385] (-768.358) (-766.485) (-767.545) * (-769.257) [-768.253] (-768.164) (-767.397) -- 0:00:53

      Average standard deviation of split frequencies: 0.020830

      85500 -- [-766.894] (-769.178) (-767.787) (-768.212) * [-768.742] (-771.309) (-765.811) (-765.920) -- 0:00:53
      86000 -- (-769.822) (-765.405) [-768.735] (-767.192) * (-767.108) (-768.667) (-765.576) [-766.579] -- 0:00:53
      86500 -- (-766.028) [-765.483] (-767.346) (-767.056) * (-767.084) (-771.323) (-768.383) [-766.425] -- 0:00:52
      87000 -- [-765.986] (-765.840) (-768.092) (-766.277) * (-768.383) (-768.002) (-768.959) [-767.663] -- 0:00:52
      87500 -- (-770.488) (-766.199) [-766.331] (-765.436) * [-766.069] (-772.979) (-766.755) (-768.263) -- 0:00:52
      88000 -- (-770.264) (-765.931) (-768.821) [-765.260] * (-766.017) (-772.555) (-766.544) [-766.321] -- 0:00:51
      88500 -- (-769.186) (-766.719) (-769.860) [-765.139] * (-767.398) (-774.219) [-764.976] (-765.918) -- 0:00:51
      89000 -- (-765.290) (-768.664) [-766.925] (-765.357) * (-768.951) (-769.202) (-765.778) [-765.618] -- 0:00:51
      89500 -- (-766.062) (-767.828) [-765.154] (-767.409) * (-768.256) (-771.925) [-769.897] (-767.938) -- 0:00:50
      90000 -- [-765.503] (-767.024) (-764.515) (-766.093) * (-768.206) (-769.947) [-766.338] (-766.186) -- 0:00:50

      Average standard deviation of split frequencies: 0.022097

      90500 -- [-765.127] (-766.439) (-766.638) (-766.482) * (-765.253) (-766.855) (-768.021) [-767.631] -- 0:00:50
      91000 -- (-765.357) (-765.745) (-767.283) [-765.480] * (-764.968) (-769.321) (-765.877) [-766.173] -- 0:00:59
      91500 -- [-766.111] (-765.992) (-768.454) (-768.815) * (-766.705) (-769.522) (-765.914) [-768.188] -- 0:00:59
      92000 -- (-766.736) (-764.765) (-766.074) [-764.944] * (-766.850) (-771.712) (-766.895) [-766.281] -- 0:00:59
      92500 -- (-767.736) [-766.424] (-768.944) (-765.806) * [-765.160] (-769.095) (-766.503) (-768.877) -- 0:00:58
      93000 -- (-766.758) [-769.648] (-767.500) (-764.865) * (-766.796) (-765.576) [-766.136] (-769.271) -- 0:00:58
      93500 -- [-768.807] (-766.343) (-767.179) (-766.671) * (-766.606) (-764.953) [-765.856] (-769.429) -- 0:00:58
      94000 -- (-769.232) (-765.139) (-770.711) [-767.303] * [-767.763] (-771.076) (-768.545) (-765.693) -- 0:00:57
      94500 -- (-770.423) (-766.082) (-767.847) [-765.507] * (-769.602) (-765.563) [-766.634] (-769.020) -- 0:00:57
      95000 -- (-767.618) (-764.974) (-768.191) [-765.712] * (-766.071) (-766.473) [-765.894] (-769.386) -- 0:00:57

      Average standard deviation of split frequencies: 0.023149

      95500 -- (-766.184) (-767.711) (-767.600) [-766.389] * [-769.850] (-765.539) (-765.589) (-775.157) -- 0:00:56
      96000 -- (-765.847) (-765.558) (-766.409) [-767.460] * (-765.186) (-767.755) (-768.052) [-767.244] -- 0:00:56
      96500 -- [-766.413] (-765.730) (-768.704) (-771.051) * (-766.444) (-765.268) [-765.990] (-766.050) -- 0:00:56
      97000 -- (-766.714) [-766.831] (-766.171) (-769.333) * [-765.016] (-765.700) (-767.507) (-765.378) -- 0:00:55
      97500 -- (-766.886) [-766.764] (-771.620) (-768.233) * (-764.870) [-767.748] (-766.684) (-768.973) -- 0:00:55
      98000 -- (-769.124) [-765.630] (-765.602) (-765.568) * [-764.804] (-766.532) (-768.952) (-766.947) -- 0:00:55
      98500 -- (-767.577) (-769.666) [-765.653] (-765.484) * [-767.178] (-769.987) (-767.130) (-767.931) -- 0:00:54
      99000 -- (-765.922) (-767.806) [-766.709] (-767.470) * [-766.681] (-767.159) (-771.988) (-767.043) -- 0:00:54
      99500 -- (-765.819) (-769.413) (-772.232) [-767.877] * (-766.697) [-768.678] (-769.735) (-769.415) -- 0:00:54
      100000 -- (-765.967) (-770.030) [-765.716] (-767.376) * [-765.041] (-767.741) (-764.808) (-766.450) -- 0:00:54

      Average standard deviation of split frequencies: 0.024752

      100500 -- [-767.829] (-767.971) (-767.994) (-765.461) * (-768.391) (-766.571) [-765.753] (-770.774) -- 0:00:53
      101000 -- [-768.565] (-766.100) (-769.354) (-769.924) * (-767.113) [-766.714] (-774.155) (-766.934) -- 0:00:53
      101500 -- (-766.102) (-771.368) [-769.479] (-769.411) * (-765.707) [-767.316] (-770.246) (-768.459) -- 0:00:53
      102000 -- (-765.051) (-766.292) [-766.357] (-766.160) * (-769.109) [-766.224] (-768.285) (-768.260) -- 0:00:52
      102500 -- (-765.235) (-766.938) [-764.979] (-765.997) * (-765.771) (-766.713) [-765.611] (-765.895) -- 0:00:52
      103000 -- [-764.748] (-767.602) (-765.152) (-768.511) * [-765.711] (-766.759) (-768.007) (-765.925) -- 0:00:52
      103500 -- [-766.044] (-766.781) (-767.430) (-767.220) * (-764.971) (-766.553) [-768.582] (-765.890) -- 0:00:51
      104000 -- (-769.831) [-766.486] (-767.329) (-771.289) * [-765.757] (-765.888) (-765.176) (-766.137) -- 0:00:51
      104500 -- (-767.190) (-768.147) [-767.634] (-766.078) * (-766.782) (-768.692) (-765.735) [-765.312] -- 0:00:51
      105000 -- (-766.742) (-766.949) (-766.270) [-767.463] * (-764.988) [-765.138] (-767.751) (-767.652) -- 0:00:51

      Average standard deviation of split frequencies: 0.022236

      105500 -- [-768.096] (-768.188) (-767.649) (-767.853) * (-765.789) (-766.104) [-767.059] (-768.341) -- 0:00:50
      106000 -- (-766.647) (-768.220) (-768.162) [-765.609] * (-769.385) (-767.000) [-766.550] (-768.427) -- 0:00:59
      106500 -- (-768.333) (-771.250) [-768.148] (-767.375) * (-765.695) (-767.088) [-765.214] (-766.297) -- 0:00:58
      107000 -- (-767.250) [-766.433] (-775.607) (-770.035) * (-767.702) (-772.262) (-765.213) [-769.234] -- 0:00:58
      107500 -- (-765.845) [-765.555] (-766.508) (-772.636) * [-766.915] (-767.255) (-767.057) (-771.358) -- 0:00:58
      108000 -- (-766.467) (-765.140) (-766.255) [-769.645] * (-765.115) (-768.853) [-767.168] (-766.467) -- 0:00:57
      108500 -- (-766.960) (-766.357) [-769.596] (-766.052) * (-769.367) (-768.144) (-765.310) [-767.783] -- 0:00:57
      109000 -- (-767.673) (-766.469) (-770.510) [-769.052] * [-768.993] (-768.550) (-766.018) (-765.683) -- 0:00:57
      109500 -- (-767.413) (-765.827) [-764.634] (-764.659) * (-768.733) (-767.718) (-766.212) [-765.893] -- 0:00:56
      110000 -- [-767.347] (-766.298) (-765.997) (-766.957) * (-767.879) (-769.148) (-768.790) [-765.050] -- 0:00:56

      Average standard deviation of split frequencies: 0.022576

      110500 -- [-766.633] (-767.412) (-766.022) (-766.240) * [-764.998] (-771.183) (-769.963) (-767.177) -- 0:00:56
      111000 -- (-766.846) (-768.980) (-767.137) [-767.047] * (-764.933) (-768.672) [-767.181] (-766.942) -- 0:00:56
      111500 -- (-769.474) [-765.644] (-769.118) (-768.422) * (-768.093) [-766.107] (-766.819) (-768.954) -- 0:00:55
      112000 -- (-766.919) [-767.446] (-770.734) (-767.976) * [-768.635] (-765.561) (-765.772) (-769.213) -- 0:00:55
      112500 -- (-768.972) (-769.143) [-770.757] (-766.385) * [-765.965] (-767.380) (-766.475) (-769.374) -- 0:00:55
      113000 -- (-766.022) (-767.542) [-768.297] (-767.324) * (-767.769) (-766.341) [-766.781] (-769.035) -- 0:00:54
      113500 -- (-766.120) [-766.633] (-766.731) (-767.059) * (-766.483) (-769.405) (-766.657) [-766.642] -- 0:00:54
      114000 -- [-770.394] (-766.826) (-768.619) (-765.984) * [-765.650] (-766.630) (-770.788) (-766.598) -- 0:00:54
      114500 -- [-767.453] (-765.693) (-766.018) (-766.329) * (-764.924) [-766.900] (-768.830) (-771.144) -- 0:00:54
      115000 -- [-766.099] (-765.403) (-767.392) (-766.063) * (-769.793) (-766.059) (-769.067) [-766.823] -- 0:00:53

      Average standard deviation of split frequencies: 0.023164

      115500 -- (-767.329) (-765.572) (-765.542) [-769.037] * (-766.313) (-767.108) [-771.411] (-765.654) -- 0:00:53
      116000 -- (-767.833) (-766.151) [-769.145] (-771.809) * (-768.374) (-766.205) [-764.984] (-766.108) -- 0:00:53
      116500 -- (-766.632) [-766.091] (-767.134) (-766.609) * [-764.911] (-766.032) (-766.305) (-767.329) -- 0:00:53
      117000 -- [-766.526] (-769.538) (-765.571) (-766.310) * (-775.665) (-768.667) [-765.905] (-766.575) -- 0:00:52
      117500 -- [-769.617] (-767.658) (-766.760) (-764.720) * (-766.974) (-766.217) (-767.447) [-765.164] -- 0:00:52
      118000 -- (-769.083) (-767.274) (-765.437) [-768.293] * (-768.887) (-765.999) [-766.936] (-768.621) -- 0:00:52
      118500 -- (-766.567) (-770.864) [-765.475] (-766.194) * [-767.412] (-770.345) (-765.934) (-768.936) -- 0:00:52
      119000 -- (-765.759) [-766.960] (-767.550) (-769.460) * [-765.679] (-769.847) (-768.350) (-769.856) -- 0:00:51
      119500 -- (-767.656) [-766.583] (-767.866) (-769.062) * (-771.264) [-765.394] (-767.960) (-767.051) -- 0:00:51
      120000 -- (-766.087) (-767.339) (-765.303) [-767.047] * (-773.751) [-765.706] (-766.458) (-769.244) -- 0:00:51

      Average standard deviation of split frequencies: 0.024026

      120500 -- (-766.555) [-766.727] (-767.119) (-765.947) * (-766.393) (-767.235) [-768.247] (-766.628) -- 0:00:51
      121000 -- (-766.955) [-765.743] (-768.472) (-769.508) * (-768.769) (-766.916) [-765.623] (-770.942) -- 0:00:58
      121500 -- (-767.945) [-766.230] (-768.814) (-770.503) * [-765.264] (-768.152) (-766.853) (-765.248) -- 0:00:57
      122000 -- [-764.994] (-765.651) (-765.316) (-772.200) * (-766.689) (-767.278) (-766.377) [-764.969] -- 0:00:57
      122500 -- [-764.863] (-764.995) (-766.355) (-765.651) * (-767.155) (-769.098) [-768.255] (-768.127) -- 0:00:57
      123000 -- (-764.919) [-767.663] (-768.267) (-770.684) * (-768.989) [-767.083] (-767.820) (-769.856) -- 0:00:57
      123500 -- (-765.763) (-766.312) [-767.117] (-767.034) * (-768.914) [-768.174] (-766.120) (-768.165) -- 0:00:56
      124000 -- [-764.913] (-765.250) (-765.890) (-766.139) * [-765.254] (-765.769) (-768.695) (-767.458) -- 0:00:56
      124500 -- [-766.842] (-766.697) (-765.367) (-765.039) * (-768.503) (-765.613) (-767.904) [-766.673] -- 0:00:56
      125000 -- (-766.023) (-768.336) (-767.382) [-765.450] * (-765.151) (-769.357) (-765.387) [-766.333] -- 0:00:56

      Average standard deviation of split frequencies: 0.024999

      125500 -- (-770.944) [-765.042] (-765.989) (-767.603) * (-765.244) (-767.481) [-766.693] (-768.734) -- 0:00:55
      126000 -- [-769.565] (-764.542) (-764.995) (-768.619) * (-765.477) [-766.308] (-770.490) (-765.644) -- 0:00:55
      126500 -- (-766.846) (-765.618) [-765.323] (-766.220) * (-765.550) (-767.469) [-767.304] (-765.512) -- 0:00:55
      127000 -- [-765.590] (-765.605) (-766.873) (-768.607) * (-764.896) (-769.023) (-765.988) [-769.071] -- 0:00:54
      127500 -- [-764.885] (-766.959) (-768.110) (-767.344) * (-765.662) (-767.767) (-767.846) [-766.941] -- 0:00:54
      128000 -- [-765.848] (-767.070) (-769.511) (-767.639) * (-765.205) (-767.849) (-765.567) [-765.236] -- 0:00:54
      128500 -- (-765.995) [-765.966] (-766.756) (-767.383) * [-764.911] (-769.396) (-764.887) (-765.265) -- 0:00:54
      129000 -- (-766.798) [-766.834] (-767.256) (-765.936) * (-766.262) (-768.505) [-765.172] (-766.607) -- 0:00:54
      129500 -- (-766.817) (-766.936) [-765.550] (-768.948) * (-769.374) (-765.642) [-766.828] (-765.787) -- 0:00:53
      130000 -- [-767.600] (-768.411) (-766.061) (-767.101) * (-766.568) (-766.531) [-766.089] (-766.108) -- 0:00:53

      Average standard deviation of split frequencies: 0.023536

      130500 -- (-770.212) (-766.687) [-764.820] (-768.867) * (-767.033) [-765.667] (-766.239) (-765.513) -- 0:00:53
      131000 -- (-768.334) (-767.409) [-765.722] (-768.294) * (-765.476) (-765.147) [-767.384] (-767.371) -- 0:00:53
      131500 -- (-766.323) (-765.972) (-767.397) [-765.231] * (-765.749) (-765.731) (-766.702) [-766.520] -- 0:00:52
      132000 -- (-768.865) (-770.671) (-768.971) [-767.086] * (-766.352) (-769.739) (-765.752) [-767.784] -- 0:00:52
      132500 -- (-769.286) [-765.978] (-768.671) (-765.225) * [-767.039] (-770.128) (-766.768) (-769.731) -- 0:00:52
      133000 -- (-770.403) (-765.073) [-768.522] (-770.642) * [-765.199] (-769.918) (-765.654) (-766.695) -- 0:00:52
      133500 -- (-768.209) (-765.553) [-768.138] (-765.369) * (-765.018) (-766.211) (-768.996) [-771.246] -- 0:00:51
      134000 -- (-766.068) [-766.650] (-770.695) (-765.923) * (-766.801) (-770.038) (-766.392) [-766.183] -- 0:00:51
      134500 -- (-766.982) (-766.054) [-768.674] (-766.306) * (-774.833) [-769.693] (-767.553) (-765.616) -- 0:00:51
      135000 -- (-766.892) (-767.696) (-768.017) [-767.238] * (-770.024) [-772.458] (-770.403) (-768.878) -- 0:00:51

      Average standard deviation of split frequencies: 0.022943

      135500 -- [-769.540] (-766.404) (-764.787) (-766.142) * [-769.457] (-765.322) (-767.257) (-769.123) -- 0:00:57
      136000 -- (-774.826) (-765.528) [-765.543] (-765.392) * (-765.662) (-766.539) [-767.190] (-771.578) -- 0:00:57
      136500 -- (-771.628) [-767.138] (-766.005) (-764.716) * (-765.679) (-765.029) [-766.582] (-775.635) -- 0:00:56
      137000 -- (-771.797) [-766.800] (-765.558) (-766.221) * (-766.688) (-770.188) [-766.621] (-779.017) -- 0:00:56
      137500 -- (-767.476) (-768.313) [-766.309] (-766.196) * (-767.694) (-768.224) (-768.055) [-769.924] -- 0:00:56
      138000 -- [-766.718] (-770.332) (-765.954) (-765.147) * (-768.282) [-766.224] (-766.930) (-772.881) -- 0:00:56
      138500 -- (-768.240) [-765.724] (-769.948) (-769.163) * (-770.442) (-771.165) (-768.005) [-767.902] -- 0:00:55
      139000 -- (-768.330) (-766.410) [-769.438] (-766.682) * [-767.780] (-770.774) (-765.651) (-765.824) -- 0:00:55
      139500 -- [-765.957] (-770.910) (-766.200) (-767.651) * (-767.100) (-771.996) (-767.194) [-765.027] -- 0:00:55
      140000 -- (-770.399) (-770.438) [-764.813] (-766.441) * (-768.625) (-768.352) (-767.239) [-766.175] -- 0:00:55

      Average standard deviation of split frequencies: 0.022453

      140500 -- [-765.769] (-768.620) (-765.219) (-771.559) * (-771.791) (-766.309) (-767.640) [-765.200] -- 0:00:55
      141000 -- [-765.911] (-767.775) (-766.145) (-772.112) * (-767.269) [-765.359] (-767.627) (-769.414) -- 0:00:54
      141500 -- [-766.828] (-767.584) (-766.830) (-765.061) * (-768.534) (-766.230) [-767.229] (-768.563) -- 0:00:54
      142000 -- (-769.486) (-765.387) [-767.418] (-766.207) * [-766.410] (-768.117) (-766.728) (-765.981) -- 0:00:54
      142500 -- (-768.985) [-765.105] (-768.873) (-766.465) * (-767.378) [-765.727] (-770.186) (-765.521) -- 0:00:54
      143000 -- (-764.817) [-765.511] (-768.026) (-767.926) * (-768.958) [-765.472] (-766.090) (-768.767) -- 0:00:53
      143500 -- (-766.534) (-769.294) [-767.620] (-766.807) * [-764.919] (-764.973) (-767.298) (-767.895) -- 0:00:53
      144000 -- (-767.502) [-765.913] (-767.457) (-767.011) * [-766.021] (-770.962) (-767.457) (-768.207) -- 0:00:53
      144500 -- [-768.637] (-766.571) (-768.125) (-767.279) * (-765.843) (-767.120) [-766.870] (-767.534) -- 0:00:53
      145000 -- (-766.019) (-766.322) (-766.789) [-767.015] * [-766.306] (-766.365) (-767.616) (-771.023) -- 0:00:53

      Average standard deviation of split frequencies: 0.022140

      145500 -- (-767.043) (-768.621) [-767.993] (-765.428) * (-766.493) [-765.362] (-767.106) (-767.694) -- 0:00:52
      146000 -- [-769.473] (-767.975) (-768.609) (-765.080) * [-769.348] (-765.667) (-777.643) (-766.014) -- 0:00:52
      146500 -- (-768.970) (-766.203) [-765.836] (-764.983) * (-767.818) (-765.500) (-766.978) [-765.975] -- 0:00:52
      147000 -- (-768.334) (-767.478) [-766.065] (-766.043) * (-767.689) [-766.969] (-768.740) (-766.721) -- 0:00:52
      147500 -- [-765.619] (-766.546) (-769.983) (-767.315) * (-767.470) [-766.603] (-765.559) (-767.297) -- 0:00:52
      148000 -- (-766.017) [-767.981] (-771.910) (-765.233) * (-771.515) (-768.590) [-765.268] (-765.698) -- 0:00:51
      148500 -- [-766.942] (-765.395) (-771.784) (-766.432) * (-767.194) [-765.849] (-767.685) (-766.185) -- 0:00:51
      149000 -- (-766.768) (-766.980) [-767.614] (-765.662) * (-765.841) [-765.280] (-765.499) (-767.874) -- 0:00:51
      149500 -- (-766.856) [-766.644] (-765.587) (-765.930) * (-765.681) (-765.172) (-769.942) [-765.648] -- 0:00:56
      150000 -- [-768.485] (-765.773) (-765.201) (-769.106) * (-769.463) [-766.374] (-774.404) (-766.665) -- 0:00:56

      Average standard deviation of split frequencies: 0.019711

      150500 -- [-766.969] (-771.734) (-765.422) (-765.910) * (-769.264) (-767.282) [-767.329] (-765.592) -- 0:00:56
      151000 -- (-767.506) (-767.873) [-768.313] (-767.941) * (-769.446) (-765.739) [-768.647] (-765.806) -- 0:00:56
      151500 -- [-766.251] (-764.766) (-766.811) (-766.382) * (-766.792) (-764.655) (-769.747) [-765.876] -- 0:00:56
      152000 -- [-765.142] (-766.694) (-767.006) (-767.316) * (-765.873) [-766.196] (-767.490) (-765.500) -- 0:00:55
      152500 -- (-767.121) (-766.823) (-765.499) [-770.220] * (-769.438) (-766.624) (-767.318) [-765.965] -- 0:00:55
      153000 -- (-769.166) [-769.566] (-767.638) (-766.714) * (-766.759) (-767.568) [-766.261] (-765.684) -- 0:00:55
      153500 -- (-768.662) (-764.643) (-765.774) [-767.657] * (-765.496) (-768.776) (-765.120) [-765.753] -- 0:00:55
      154000 -- (-766.297) (-766.045) [-766.634] (-771.460) * (-765.491) (-772.288) [-767.293] (-767.037) -- 0:00:54
      154500 -- (-767.897) (-764.973) [-765.400] (-766.920) * (-768.067) (-768.540) [-771.184] (-768.447) -- 0:00:54
      155000 -- [-766.506] (-766.643) (-766.995) (-765.870) * (-766.978) (-771.118) (-772.171) [-768.131] -- 0:00:54

      Average standard deviation of split frequencies: 0.020145

      155500 -- (-770.673) (-765.451) [-768.546] (-765.840) * (-768.231) [-765.760] (-769.615) (-773.212) -- 0:00:54
      156000 -- (-767.785) (-765.722) [-765.503] (-765.384) * (-767.427) (-765.453) [-766.413] (-768.314) -- 0:00:54
      156500 -- (-765.785) (-766.253) [-765.416] (-770.126) * [-770.236] (-765.561) (-766.913) (-769.260) -- 0:00:53
      157000 -- (-765.354) (-768.236) (-766.936) [-765.851] * (-765.882) [-767.957] (-769.218) (-768.378) -- 0:00:53
      157500 -- (-767.203) (-767.566) (-766.244) [-765.748] * (-765.150) (-766.417) (-766.403) [-770.123] -- 0:00:53
      158000 -- (-765.817) (-767.725) (-766.309) [-767.618] * (-765.763) (-769.126) [-765.288] (-767.923) -- 0:00:53
      158500 -- [-767.393] (-766.465) (-768.991) (-768.235) * (-768.805) [-767.267] (-765.134) (-766.731) -- 0:00:53
      159000 -- [-765.642] (-766.948) (-768.197) (-769.747) * (-765.646) [-767.972] (-765.258) (-768.548) -- 0:00:52
      159500 -- (-766.864) (-765.662) (-766.798) [-769.106] * (-770.901) (-766.706) [-767.287] (-766.683) -- 0:00:52
      160000 -- (-766.988) (-769.507) [-769.064] (-774.490) * (-766.615) [-769.914] (-768.098) (-766.604) -- 0:00:52

      Average standard deviation of split frequencies: 0.020375

      160500 -- (-768.842) [-772.535] (-766.375) (-767.510) * (-765.769) (-766.940) (-767.946) [-767.048] -- 0:00:52
      161000 -- (-768.251) (-767.980) [-768.958] (-767.941) * (-766.960) (-770.783) (-766.793) [-767.043] -- 0:00:52
      161500 -- (-767.200) (-766.409) [-766.265] (-767.115) * [-769.793] (-765.952) (-770.427) (-769.585) -- 0:00:51
      162000 -- (-770.350) [-768.928] (-765.316) (-767.624) * (-768.839) [-766.838] (-768.100) (-768.526) -- 0:00:51
      162500 -- (-767.739) (-766.831) (-765.718) [-766.720] * [-766.244] (-772.015) (-766.727) (-773.314) -- 0:00:51
      163000 -- (-768.032) (-765.250) [-769.578] (-765.247) * (-766.408) (-767.966) (-766.434) [-767.020] -- 0:00:51
      163500 -- (-769.563) (-766.245) (-766.627) [-768.679] * (-769.420) (-766.247) (-765.198) [-765.790] -- 0:00:51
      164000 -- (-765.920) (-768.912) (-768.861) [-770.453] * (-766.526) (-768.461) (-766.730) [-765.541] -- 0:00:56
      164500 -- [-768.445] (-768.659) (-765.870) (-767.643) * (-765.652) (-766.873) (-764.797) [-768.651] -- 0:00:55
      165000 -- [-769.496] (-770.737) (-769.874) (-768.682) * (-765.450) (-767.615) [-765.838] (-768.761) -- 0:00:55

      Average standard deviation of split frequencies: 0.018743

      165500 -- (-766.842) (-765.396) (-770.190) [-767.558] * (-765.251) (-765.311) (-765.555) [-767.679] -- 0:00:55
      166000 -- (-766.222) [-767.988] (-767.863) (-767.032) * (-765.296) (-766.892) (-768.340) [-765.469] -- 0:00:55
      166500 -- (-766.174) (-768.259) (-768.897) [-765.503] * (-767.204) (-767.149) (-768.311) [-766.383] -- 0:00:55
      167000 -- (-766.768) [-768.040] (-773.205) (-770.442) * (-766.197) [-766.569] (-766.664) (-766.766) -- 0:00:54
      167500 -- (-765.503) (-770.036) [-769.069] (-766.080) * [-767.008] (-766.179) (-764.725) (-767.969) -- 0:00:54
      168000 -- (-765.911) (-769.961) (-765.387) [-767.492] * (-766.394) (-765.072) [-764.749] (-767.052) -- 0:00:54
      168500 -- (-766.733) [-767.797] (-770.328) (-767.284) * (-767.925) (-771.428) [-765.158] (-765.760) -- 0:00:54
      169000 -- (-766.959) (-765.948) (-766.049) [-765.339] * (-766.179) (-770.966) [-765.515] (-764.804) -- 0:00:54
      169500 -- (-769.736) (-767.210) (-766.606) [-768.731] * [-768.055] (-765.296) (-766.463) (-769.345) -- 0:00:53
      170000 -- (-769.562) (-765.618) (-766.057) [-769.093] * (-767.218) [-771.032] (-765.480) (-775.998) -- 0:00:53

      Average standard deviation of split frequencies: 0.016704

      170500 -- (-767.229) [-767.112] (-773.606) (-767.893) * (-768.313) (-771.439) (-766.544) [-768.195] -- 0:00:53
      171000 -- (-768.001) (-769.237) (-770.366) [-768.859] * [-767.938] (-768.232) (-765.118) (-767.075) -- 0:00:53
      171500 -- (-766.156) (-770.234) (-768.850) [-765.211] * (-766.314) [-765.366] (-767.547) (-765.665) -- 0:00:53
      172000 -- (-766.875) (-767.898) (-769.729) [-764.794] * (-765.922) (-768.403) (-771.561) [-767.159] -- 0:00:52
      172500 -- (-768.923) [-766.862] (-768.025) (-765.726) * (-765.966) (-767.994) [-767.032] (-767.784) -- 0:00:52
      173000 -- (-766.197) (-767.261) (-766.970) [-767.878] * (-767.664) (-765.521) (-765.284) [-768.893] -- 0:00:52
      173500 -- [-768.346] (-766.676) (-767.166) (-768.266) * [-766.663] (-769.201) (-767.859) (-769.166) -- 0:00:52
      174000 -- (-767.065) (-767.394) [-766.656] (-768.243) * [-770.472] (-770.632) (-767.354) (-765.465) -- 0:00:52
      174500 -- [-764.745] (-766.814) (-767.786) (-767.847) * (-767.422) (-766.264) (-765.283) [-769.558] -- 0:00:52
      175000 -- [-766.814] (-765.062) (-767.215) (-766.303) * (-767.174) (-766.789) [-767.520] (-769.288) -- 0:00:51

      Average standard deviation of split frequencies: 0.015930

      175500 -- (-768.604) (-766.306) (-765.414) [-768.577] * [-764.936] (-766.424) (-768.998) (-768.012) -- 0:00:51
      176000 -- (-770.507) (-767.844) [-766.124] (-766.245) * [-764.946] (-769.754) (-766.029) (-768.842) -- 0:00:51
      176500 -- (-769.347) (-768.725) (-766.636) [-766.830] * [-765.617] (-770.793) (-766.096) (-768.860) -- 0:00:51
      177000 -- [-767.376] (-767.344) (-765.332) (-765.023) * [-767.808] (-767.759) (-767.616) (-768.724) -- 0:00:51
      177500 -- (-766.323) (-769.730) (-766.548) [-765.373] * (-765.450) (-771.051) (-765.154) [-769.714] -- 0:00:50
      178000 -- (-765.537) [-771.597] (-764.700) (-770.611) * [-765.543] (-768.768) (-765.810) (-767.709) -- 0:00:50
      178500 -- [-766.629] (-770.085) (-766.262) (-769.026) * [-768.091] (-767.666) (-768.014) (-766.191) -- 0:00:55
      179000 -- (-766.752) (-771.722) (-765.487) [-769.112] * (-766.323) (-767.986) [-766.601] (-767.475) -- 0:00:55
      179500 -- (-766.088) [-766.413] (-765.543) (-772.142) * (-768.580) (-768.417) (-766.651) [-766.228] -- 0:00:54
      180000 -- (-765.383) [-766.178] (-765.319) (-767.818) * (-765.961) (-766.338) (-765.948) [-764.934] -- 0:00:54

      Average standard deviation of split frequencies: 0.015518

      180500 -- (-766.430) [-766.208] (-768.982) (-768.147) * (-767.198) (-767.900) (-767.999) [-766.835] -- 0:00:54
      181000 -- [-766.414] (-765.401) (-767.470) (-768.972) * (-769.357) (-769.360) (-768.539) [-767.302] -- 0:00:54
      181500 -- (-778.700) (-764.829) (-765.292) [-771.279] * (-766.122) (-769.391) (-768.673) [-767.840] -- 0:00:54
      182000 -- [-767.397] (-774.153) (-765.811) (-769.287) * (-764.705) (-765.068) (-767.951) [-770.514] -- 0:00:53
      182500 -- [-766.188] (-765.739) (-769.200) (-767.330) * (-766.108) (-769.404) (-765.577) [-767.856] -- 0:00:53
      183000 -- [-772.075] (-769.226) (-766.383) (-766.164) * (-766.925) (-766.323) (-771.532) [-765.813] -- 0:00:53
      183500 -- (-767.571) [-766.333] (-765.613) (-769.443) * [-768.388] (-766.769) (-767.274) (-766.312) -- 0:00:53
      184000 -- (-765.875) (-765.568) [-766.007] (-766.091) * (-768.388) (-767.681) (-767.658) [-768.245] -- 0:00:53
      184500 -- (-765.859) (-771.582) [-766.701] (-766.922) * (-765.497) (-768.665) [-766.484] (-773.866) -- 0:00:53
      185000 -- [-765.312] (-769.295) (-768.039) (-767.827) * (-764.694) (-767.682) [-765.883] (-766.132) -- 0:00:52

      Average standard deviation of split frequencies: 0.017017

      185500 -- [-764.984] (-770.653) (-768.029) (-769.211) * [-765.374] (-767.174) (-765.552) (-767.923) -- 0:00:52
      186000 -- [-770.294] (-768.407) (-765.945) (-770.975) * [-765.052] (-767.081) (-765.285) (-767.036) -- 0:00:52
      186500 -- [-771.058] (-770.365) (-765.039) (-765.094) * [-766.396] (-769.180) (-766.920) (-765.816) -- 0:00:52
      187000 -- (-769.027) (-764.971) [-767.042] (-767.060) * (-765.509) (-769.439) (-768.060) [-766.111] -- 0:00:52
      187500 -- [-768.118] (-764.995) (-765.279) (-766.141) * (-766.475) (-766.660) [-767.708] (-768.634) -- 0:00:52
      188000 -- (-765.472) (-764.743) [-768.435] (-770.717) * (-772.379) (-765.347) (-767.957) [-765.514] -- 0:00:51
      188500 -- (-765.359) (-766.774) [-765.632] (-769.894) * [-767.286] (-766.076) (-766.029) (-764.831) -- 0:00:51
      189000 -- [-766.695] (-765.276) (-767.382) (-765.864) * (-769.851) (-764.898) [-766.600] (-767.609) -- 0:00:51
      189500 -- (-765.571) [-766.268] (-767.864) (-766.628) * (-769.493) (-766.177) [-766.725] (-765.318) -- 0:00:51
      190000 -- (-766.637) [-767.338] (-768.588) (-766.350) * (-764.662) (-767.517) [-768.425] (-764.937) -- 0:00:51

      Average standard deviation of split frequencies: 0.018131

      190500 -- (-766.307) [-769.362] (-768.778) (-768.629) * (-769.033) (-765.824) (-766.409) [-764.731] -- 0:00:50
      191000 -- (-766.336) (-769.991) [-766.336] (-766.071) * [-767.650] (-771.317) (-766.838) (-766.565) -- 0:00:50
      191500 -- (-768.057) (-767.973) [-766.080] (-766.693) * (-766.873) [-766.557] (-767.062) (-765.650) -- 0:00:50
      192000 -- [-768.765] (-767.534) (-766.308) (-765.900) * [-766.229] (-764.756) (-768.244) (-768.515) -- 0:00:50
      192500 -- [-766.997] (-766.521) (-768.590) (-765.069) * [-765.566] (-767.972) (-765.799) (-768.888) -- 0:00:50
      193000 -- [-765.897] (-768.887) (-768.823) (-770.767) * (-766.151) (-766.564) [-766.015] (-767.493) -- 0:00:54
      193500 -- [-766.479] (-767.356) (-771.187) (-769.075) * (-766.468) (-768.236) (-766.765) [-765.622] -- 0:00:54
      194000 -- [-769.174] (-768.539) (-766.049) (-766.700) * (-765.207) (-766.622) [-766.920] (-765.779) -- 0:00:54
      194500 -- (-767.604) (-766.356) (-768.494) [-767.952] * [-765.374] (-765.608) (-770.427) (-764.963) -- 0:00:53
      195000 -- (-770.176) [-766.326] (-765.645) (-764.890) * (-765.373) (-768.624) (-770.188) [-765.050] -- 0:00:53

      Average standard deviation of split frequencies: 0.017055

      195500 -- (-769.195) (-766.622) (-767.340) [-765.181] * (-766.338) (-767.639) [-765.456] (-765.797) -- 0:00:53
      196000 -- (-766.052) (-766.746) (-765.909) [-768.410] * [-768.941] (-772.826) (-765.354) (-768.714) -- 0:00:53
      196500 -- (-768.112) [-765.790] (-765.742) (-767.058) * (-769.198) (-769.657) (-767.843) [-764.485] -- 0:00:53
      197000 -- (-770.992) (-765.562) (-766.638) [-765.695] * (-769.704) (-771.460) [-765.672] (-767.544) -- 0:00:52
      197500 -- (-768.030) (-765.947) (-766.954) [-766.841] * (-767.987) [-765.778] (-766.763) (-766.710) -- 0:00:52
      198000 -- (-766.444) [-769.392] (-766.707) (-766.325) * [-768.177] (-770.346) (-767.752) (-765.376) -- 0:00:52
      198500 -- [-766.790] (-767.112) (-766.743) (-766.453) * (-769.364) (-769.144) (-768.454) [-766.833] -- 0:00:52
      199000 -- (-766.600) [-766.443] (-766.280) (-767.429) * [-765.525] (-769.167) (-770.198) (-766.630) -- 0:00:52
      199500 -- (-767.825) [-769.742] (-767.471) (-766.067) * (-770.338) (-767.053) [-766.459] (-768.642) -- 0:00:52
      200000 -- (-765.735) (-765.192) (-765.872) [-764.749] * (-771.879) (-767.114) [-767.045] (-767.425) -- 0:00:51

      Average standard deviation of split frequencies: 0.017063

      200500 -- (-764.878) (-769.030) (-768.280) [-765.148] * (-769.558) (-769.175) (-767.698) [-765.770] -- 0:00:51
      201000 -- (-766.906) (-766.817) [-765.700] (-769.900) * (-767.693) (-765.985) [-766.515] (-771.081) -- 0:00:51
      201500 -- [-767.028] (-771.845) (-766.720) (-767.188) * (-768.262) (-768.038) [-765.355] (-765.945) -- 0:00:51
      202000 -- (-766.000) (-769.122) [-768.536] (-766.120) * (-766.352) (-771.086) [-768.293] (-767.209) -- 0:00:51
      202500 -- (-767.168) (-766.435) [-767.737] (-766.969) * (-765.977) (-766.698) (-766.672) [-766.313] -- 0:00:51
      203000 -- (-767.934) (-768.350) (-765.265) [-766.462] * [-769.323] (-767.373) (-765.653) (-766.583) -- 0:00:51
      203500 -- (-768.879) (-766.274) [-764.597] (-766.193) * [-766.170] (-767.420) (-764.553) (-778.279) -- 0:00:50
      204000 -- (-765.723) [-765.637] (-770.079) (-765.667) * [-766.269] (-769.101) (-765.904) (-772.573) -- 0:00:50
      204500 -- (-765.743) (-765.743) [-767.159] (-772.075) * (-766.869) (-768.807) (-765.949) [-769.614] -- 0:00:50
      205000 -- (-765.704) (-767.548) [-767.659] (-773.501) * (-765.146) (-768.155) [-767.527] (-767.642) -- 0:00:50

      Average standard deviation of split frequencies: 0.016563

      205500 -- [-766.089] (-767.819) (-766.472) (-774.237) * (-767.034) (-769.061) [-768.672] (-769.372) -- 0:00:50
      206000 -- [-766.291] (-766.602) (-769.774) (-774.081) * (-766.766) [-765.085] (-766.157) (-767.687) -- 0:00:50
      206500 -- [-766.533] (-765.072) (-766.915) (-767.903) * (-767.264) [-766.323] (-767.134) (-768.537) -- 0:00:49
      207000 -- (-765.005) [-764.507] (-767.945) (-766.242) * (-766.068) [-765.611] (-766.482) (-773.039) -- 0:00:49
      207500 -- (-765.693) [-766.856] (-767.544) (-768.058) * (-768.557) (-775.267) [-768.873] (-766.368) -- 0:00:53
      208000 -- (-764.942) (-765.249) [-767.455] (-766.446) * [-767.171] (-773.114) (-767.633) (-766.865) -- 0:00:53
      208500 -- [-767.495] (-765.274) (-765.263) (-767.607) * (-769.882) [-767.676] (-766.742) (-766.536) -- 0:00:53
      209000 -- (-767.458) (-766.606) (-764.912) [-767.830] * (-769.994) (-766.551) [-767.575] (-766.309) -- 0:00:52
      209500 -- (-766.269) (-765.731) (-766.226) [-767.966] * (-770.109) (-766.340) (-767.501) [-765.670] -- 0:00:52
      210000 -- [-767.140] (-766.530) (-765.667) (-767.148) * (-765.704) (-766.690) (-766.326) [-769.664] -- 0:00:52

      Average standard deviation of split frequencies: 0.015776

      210500 -- (-766.375) [-767.902] (-768.602) (-767.562) * (-766.559) (-768.366) (-768.907) [-766.110] -- 0:00:52
      211000 -- (-765.870) [-767.239] (-767.089) (-770.016) * (-769.245) [-765.867] (-766.916) (-767.445) -- 0:00:52
      211500 -- [-765.948] (-767.919) (-768.058) (-767.800) * (-770.761) (-766.144) [-767.367] (-769.853) -- 0:00:52
      212000 -- (-766.942) (-769.351) [-767.730] (-765.861) * (-771.342) (-766.198) [-769.194] (-769.688) -- 0:00:52
      212500 -- (-767.661) (-771.594) (-765.207) [-770.946] * (-771.224) (-767.186) (-769.960) [-766.157] -- 0:00:51
      213000 -- (-768.503) [-769.283] (-770.446) (-768.127) * (-767.056) (-767.739) (-768.669) [-765.061] -- 0:00:51
      213500 -- [-767.760] (-771.417) (-764.869) (-768.584) * (-771.937) (-770.893) [-766.672] (-765.871) -- 0:00:51
      214000 -- (-766.184) (-768.549) (-766.509) [-764.814] * (-765.511) (-766.992) [-769.096] (-764.907) -- 0:00:51
      214500 -- [-767.051] (-767.719) (-766.362) (-766.538) * [-766.417] (-765.997) (-765.578) (-766.757) -- 0:00:51
      215000 -- (-765.726) (-768.497) (-766.772) [-765.252] * [-765.748] (-768.800) (-768.810) (-766.583) -- 0:00:51

      Average standard deviation of split frequencies: 0.016041

      215500 -- [-766.120] (-765.682) (-766.153) (-765.161) * (-765.500) (-768.830) [-766.363] (-767.073) -- 0:00:50
      216000 -- (-768.425) [-766.024] (-766.335) (-766.956) * (-766.046) (-766.857) (-765.943) [-766.273] -- 0:00:50
      216500 -- (-768.212) (-766.396) (-765.320) [-767.041] * (-765.929) [-766.281] (-764.935) (-765.237) -- 0:00:50
      217000 -- (-766.009) [-766.398] (-767.352) (-765.144) * (-769.544) (-766.158) [-765.304] (-765.992) -- 0:00:50
      217500 -- (-767.512) (-765.846) [-768.972] (-766.168) * (-766.566) [-766.226] (-766.952) (-767.616) -- 0:00:50
      218000 -- (-768.309) [-765.227] (-768.590) (-767.955) * (-766.891) (-765.011) (-766.188) [-766.616] -- 0:00:50
      218500 -- (-772.587) [-765.209] (-766.705) (-770.467) * (-768.451) (-765.507) [-765.621] (-765.568) -- 0:00:50
      219000 -- (-769.810) (-767.742) (-766.820) [-767.461] * (-767.511) [-766.550] (-765.926) (-767.923) -- 0:00:49
      219500 -- (-772.214) (-768.556) [-767.617] (-768.233) * (-766.681) (-767.824) [-765.111] (-769.732) -- 0:00:49
      220000 -- (-766.182) (-766.884) (-768.921) [-768.240] * [-766.179] (-765.481) (-766.616) (-777.282) -- 0:00:49

      Average standard deviation of split frequencies: 0.016449

      220500 -- (-764.909) [-767.020] (-766.520) (-766.745) * [-766.550] (-765.158) (-766.925) (-770.120) -- 0:00:49
      221000 -- [-765.599] (-767.970) (-765.723) (-768.805) * (-771.349) (-767.299) [-766.569] (-765.385) -- 0:00:49
      221500 -- [-765.467] (-769.144) (-765.206) (-768.201) * (-765.322) (-765.245) (-767.565) [-767.010] -- 0:00:49
      222000 -- (-767.201) (-770.628) (-766.595) [-766.108] * (-767.976) (-765.303) [-769.232] (-766.905) -- 0:00:49
      222500 -- [-765.823] (-768.886) (-766.020) (-765.785) * (-765.867) (-766.341) (-764.828) [-767.932] -- 0:00:52
      223000 -- (-766.354) [-771.964] (-769.492) (-767.054) * (-766.740) (-767.312) [-766.137] (-768.915) -- 0:00:52
      223500 -- [-764.987] (-768.297) (-770.055) (-765.056) * (-767.961) (-765.066) [-766.618] (-767.268) -- 0:00:52
      224000 -- (-766.679) (-768.866) [-766.036] (-764.917) * (-765.923) (-765.285) (-770.588) [-768.571] -- 0:00:51
      224500 -- (-768.122) [-766.535] (-770.050) (-765.862) * (-767.224) [-765.526] (-770.907) (-771.610) -- 0:00:51
      225000 -- (-765.091) [-766.162] (-771.316) (-765.905) * [-767.302] (-767.697) (-769.372) (-771.868) -- 0:00:51

      Average standard deviation of split frequencies: 0.016091

      225500 -- (-765.306) (-766.082) [-768.663] (-765.313) * [-765.962] (-767.239) (-766.132) (-767.025) -- 0:00:51
      226000 -- (-767.399) (-770.602) (-765.434) [-765.880] * [-766.429] (-767.390) (-765.517) (-770.289) -- 0:00:51
      226500 -- (-768.398) (-771.131) (-765.987) [-766.768] * (-766.571) [-766.944] (-770.366) (-768.869) -- 0:00:51
      227000 -- (-769.136) [-766.818] (-764.936) (-767.357) * (-766.159) (-767.366) (-769.981) [-766.687] -- 0:00:51
      227500 -- (-767.493) (-767.258) (-766.348) [-769.426] * (-765.060) (-765.454) [-769.717] (-769.614) -- 0:00:50
      228000 -- (-765.797) (-765.246) [-765.420] (-765.515) * (-765.823) (-766.282) [-765.463] (-771.096) -- 0:00:50
      228500 -- (-767.399) (-767.302) (-766.271) [-765.581] * (-767.835) (-765.559) [-767.520] (-769.777) -- 0:00:50
      229000 -- (-766.229) (-765.356) [-764.844] (-765.923) * (-767.321) (-767.123) (-771.219) [-767.824] -- 0:00:50
      229500 -- (-769.589) [-765.361] (-766.841) (-766.081) * [-765.433] (-767.733) (-768.223) (-765.001) -- 0:00:50
      230000 -- [-767.218] (-765.772) (-768.189) (-766.087) * [-765.302] (-768.086) (-767.615) (-766.743) -- 0:00:50

      Average standard deviation of split frequencies: 0.015596

      230500 -- (-772.250) (-765.659) [-765.812] (-769.253) * [-765.393] (-773.285) (-766.544) (-766.212) -- 0:00:50
      231000 -- (-771.505) (-768.604) [-766.381] (-766.629) * (-767.094) (-767.253) (-771.073) [-765.286] -- 0:00:49
      231500 -- (-769.774) [-768.337] (-767.898) (-769.508) * (-767.513) (-767.305) (-767.640) [-766.243] -- 0:00:49
      232000 -- [-771.831] (-766.282) (-765.588) (-770.368) * (-770.138) [-766.817] (-769.629) (-765.287) -- 0:00:49
      232500 -- (-767.209) (-765.790) (-768.754) [-765.392] * (-765.938) (-766.718) (-768.118) [-764.898] -- 0:00:49
      233000 -- [-768.440] (-764.921) (-766.037) (-765.549) * (-767.672) (-766.231) [-768.301] (-766.176) -- 0:00:49
      233500 -- (-772.174) (-767.201) [-766.105] (-767.372) * (-765.970) (-766.525) [-765.970] (-769.068) -- 0:00:49
      234000 -- (-766.487) (-766.033) [-765.722] (-766.078) * (-768.040) [-767.223] (-771.811) (-770.561) -- 0:00:49
      234500 -- (-769.328) (-766.612) (-766.113) [-767.845] * [-766.916] (-766.666) (-772.132) (-766.630) -- 0:00:48
      235000 -- (-768.197) (-767.508) (-769.618) [-768.561] * (-766.237) (-767.580) [-764.997] (-766.573) -- 0:00:48

      Average standard deviation of split frequencies: 0.016926

      235500 -- (-768.258) (-765.367) [-767.788] (-766.800) * (-766.287) (-766.947) (-767.487) [-767.896] -- 0:00:48
      236000 -- (-767.154) (-766.959) [-766.127] (-769.683) * (-768.063) [-765.669] (-770.058) (-766.496) -- 0:00:48
      236500 -- (-770.561) (-765.233) [-765.211] (-766.635) * (-765.819) (-766.877) [-766.250] (-769.834) -- 0:00:48
      237000 -- (-767.420) (-767.574) (-767.572) [-764.932] * (-770.242) [-765.395] (-768.792) (-768.745) -- 0:00:48
      237500 -- (-769.416) [-766.461] (-767.973) (-765.323) * (-773.448) (-770.101) (-769.677) [-768.837] -- 0:00:48
      238000 -- (-767.288) (-766.838) [-765.859] (-767.661) * (-765.244) [-766.367] (-767.702) (-765.918) -- 0:00:51
      238500 -- (-765.318) [-768.192] (-766.273) (-765.957) * [-766.661] (-766.481) (-766.420) (-765.036) -- 0:00:51
      239000 -- [-766.043] (-766.820) (-767.923) (-768.235) * [-764.927] (-766.897) (-768.932) (-766.305) -- 0:00:50
      239500 -- (-765.975) (-767.694) [-765.656] (-768.328) * [-765.535] (-770.665) (-773.316) (-765.320) -- 0:00:50
      240000 -- (-767.893) [-768.655] (-765.189) (-765.950) * [-765.608] (-766.331) (-766.776) (-765.211) -- 0:00:50

      Average standard deviation of split frequencies: 0.017010

      240500 -- [-765.807] (-766.286) (-767.925) (-767.354) * [-764.664] (-767.645) (-767.414) (-767.987) -- 0:00:50
      241000 -- (-766.584) (-765.870) (-764.726) [-764.944] * (-766.460) [-764.952] (-765.879) (-770.874) -- 0:00:50
      241500 -- (-769.874) (-765.205) (-768.881) [-765.622] * [-766.517] (-765.908) (-765.743) (-770.398) -- 0:00:50
      242000 -- (-774.103) (-765.529) [-766.520] (-767.471) * [-766.031] (-769.046) (-767.846) (-765.872) -- 0:00:50
      242500 -- (-766.980) [-764.828] (-770.794) (-768.231) * [-767.610] (-769.381) (-768.171) (-769.355) -- 0:00:49
      243000 -- (-766.038) [-765.562] (-766.969) (-769.726) * (-767.211) [-765.915] (-766.825) (-771.117) -- 0:00:49
      243500 -- [-766.183] (-765.410) (-769.009) (-768.922) * (-768.073) (-766.035) (-766.863) [-766.735] -- 0:00:49
      244000 -- [-768.387] (-765.391) (-765.254) (-765.622) * (-767.713) (-766.227) (-767.442) [-766.962] -- 0:00:49
      244500 -- (-766.128) [-767.950] (-766.140) (-765.481) * (-767.270) (-765.715) (-768.962) [-767.848] -- 0:00:49
      245000 -- (-769.738) (-767.045) [-766.567] (-766.907) * (-772.370) (-765.843) (-767.088) [-765.740] -- 0:00:49

      Average standard deviation of split frequencies: 0.015330

      245500 -- (-765.505) [-766.728] (-766.433) (-768.048) * (-771.594) (-765.345) (-766.609) [-767.895] -- 0:00:49
      246000 -- [-766.809] (-764.858) (-766.265) (-766.858) * (-767.267) [-766.224] (-766.662) (-768.634) -- 0:00:49
      246500 -- [-768.531] (-767.301) (-766.156) (-766.194) * (-766.158) (-766.300) [-765.483] (-765.898) -- 0:00:48
      247000 -- (-766.593) (-766.071) (-768.088) [-764.889] * (-767.415) [-765.123] (-770.122) (-769.439) -- 0:00:48
      247500 -- (-766.373) [-768.799] (-768.193) (-764.767) * [-765.305] (-769.647) (-771.456) (-767.414) -- 0:00:48
      248000 -- (-766.085) (-768.836) (-767.626) [-764.649] * [-766.147] (-768.510) (-768.457) (-766.727) -- 0:00:48
      248500 -- [-768.411] (-766.151) (-765.403) (-768.003) * (-766.209) (-766.672) [-765.722] (-767.771) -- 0:00:48
      249000 -- (-767.355) (-764.926) [-766.523] (-771.480) * (-769.352) (-771.924) [-766.249] (-767.968) -- 0:00:48
      249500 -- [-766.409] (-766.105) (-766.364) (-767.385) * (-767.720) (-767.843) [-767.136] (-767.114) -- 0:00:48
      250000 -- (-766.550) (-767.528) (-766.738) [-765.992] * [-765.349] (-766.836) (-767.741) (-765.569) -- 0:00:48

      Average standard deviation of split frequencies: 0.015243

      250500 -- [-766.444] (-764.817) (-767.450) (-764.799) * (-765.615) [-768.132] (-767.578) (-767.189) -- 0:00:47
      251000 -- [-766.706] (-764.954) (-769.848) (-768.965) * (-766.253) (-767.343) [-768.061] (-769.018) -- 0:00:47
      251500 -- (-767.442) (-765.409) (-765.285) [-770.401] * [-771.518] (-771.099) (-769.901) (-765.751) -- 0:00:50
      252000 -- [-769.169] (-766.642) (-769.104) (-765.658) * (-766.984) (-767.895) [-767.316] (-767.119) -- 0:00:50
      252500 -- [-769.016] (-771.396) (-765.375) (-769.477) * (-767.984) (-768.129) [-766.190] (-767.315) -- 0:00:50
      253000 -- (-766.135) (-770.028) [-765.391] (-765.857) * [-769.276] (-769.184) (-765.803) (-768.942) -- 0:00:50
      253500 -- (-768.158) (-765.743) (-765.982) [-766.263] * [-768.276] (-768.236) (-765.886) (-767.190) -- 0:00:50
      254000 -- (-766.336) (-766.657) [-765.797] (-766.265) * [-769.490] (-767.793) (-765.115) (-765.216) -- 0:00:49
      254500 -- (-766.288) (-766.307) (-769.333) [-764.890] * (-769.189) [-767.300] (-765.482) (-771.905) -- 0:00:49
      255000 -- (-765.207) (-767.809) (-765.661) [-766.362] * (-766.103) (-765.994) [-765.298] (-771.022) -- 0:00:49

      Average standard deviation of split frequencies: 0.014406

      255500 -- (-765.153) (-765.305) [-764.996] (-768.063) * (-766.169) [-766.212] (-765.018) (-765.651) -- 0:00:49
      256000 -- (-765.142) (-765.815) [-765.468] (-769.368) * [-769.161] (-769.979) (-765.042) (-766.045) -- 0:00:49
      256500 -- (-768.758) [-765.286] (-767.187) (-766.903) * (-769.669) (-766.453) [-766.120] (-765.897) -- 0:00:49
      257000 -- [-766.413] (-768.370) (-766.661) (-767.966) * (-768.505) [-767.841] (-765.071) (-765.109) -- 0:00:49
      257500 -- (-769.022) (-769.050) (-767.803) [-766.785] * (-768.814) (-768.256) [-766.057] (-765.733) -- 0:00:49
      258000 -- (-772.954) (-765.634) [-766.128] (-766.913) * (-765.517) (-768.474) [-765.577] (-765.533) -- 0:00:48
      258500 -- (-765.645) [-765.863] (-766.205) (-765.735) * (-765.907) (-765.518) (-771.692) [-764.943] -- 0:00:48
      259000 -- (-772.842) (-767.088) (-767.069) [-765.377] * [-765.558] (-765.755) (-765.630) (-764.950) -- 0:00:48
      259500 -- (-768.642) [-769.715] (-765.937) (-766.092) * (-765.929) (-767.427) (-770.338) [-765.785] -- 0:00:48
      260000 -- [-764.864] (-766.527) (-769.142) (-766.737) * (-767.827) (-766.231) (-765.241) [-765.550] -- 0:00:48

      Average standard deviation of split frequencies: 0.015146

      260500 -- [-765.900] (-767.275) (-767.169) (-768.838) * [-765.445] (-767.988) (-766.022) (-765.256) -- 0:00:48
      261000 -- [-766.006] (-766.079) (-768.100) (-771.394) * (-765.474) (-765.697) (-767.620) [-765.504] -- 0:00:48
      261500 -- [-764.850] (-766.957) (-769.398) (-773.085) * (-766.660) (-770.015) [-767.572] (-766.108) -- 0:00:48
      262000 -- [-766.293] (-766.603) (-770.452) (-770.910) * (-767.127) (-767.137) (-768.543) [-766.541] -- 0:00:47
      262500 -- (-766.835) [-765.074] (-765.835) (-767.604) * [-766.816] (-765.441) (-767.402) (-767.659) -- 0:00:47
      263000 -- (-767.120) (-765.598) [-769.977] (-767.835) * (-769.568) [-766.499] (-764.748) (-767.803) -- 0:00:47
      263500 -- (-767.350) (-768.413) (-767.552) [-766.540] * (-765.141) [-765.943] (-767.657) (-768.702) -- 0:00:47
      264000 -- (-764.946) [-767.401] (-772.088) (-767.257) * (-767.931) (-765.587) [-768.739] (-768.156) -- 0:00:47
      264500 -- (-764.750) [-765.840] (-770.778) (-765.577) * (-770.470) (-765.900) [-766.000] (-766.177) -- 0:00:50
      265000 -- (-765.861) (-768.677) (-777.642) [-766.090] * (-769.444) [-766.624] (-766.028) (-766.543) -- 0:00:49

      Average standard deviation of split frequencies: 0.014073

      265500 -- (-765.580) [-765.457] (-765.926) (-767.774) * [-765.352] (-766.207) (-768.979) (-764.716) -- 0:00:49
      266000 -- (-767.886) (-769.245) [-765.585] (-771.564) * (-765.030) (-766.067) (-768.524) [-766.627] -- 0:00:49
      266500 -- (-766.320) [-766.035] (-767.108) (-767.499) * (-767.084) (-766.626) [-765.728] (-768.196) -- 0:00:49
      267000 -- (-766.476) (-766.928) (-767.587) [-765.778] * (-766.960) (-766.141) [-767.387] (-766.080) -- 0:00:49
      267500 -- (-770.375) [-771.615] (-765.009) (-767.089) * [-766.656] (-765.436) (-769.078) (-768.820) -- 0:00:49
      268000 -- (-766.686) [-768.798] (-767.009) (-767.338) * (-767.544) [-764.835] (-767.954) (-766.964) -- 0:00:49
      268500 -- (-767.376) (-764.932) (-765.865) [-765.940] * [-767.740] (-772.268) (-764.696) (-769.335) -- 0:00:49
      269000 -- (-767.967) (-767.666) (-767.573) [-767.840] * (-767.712) (-769.586) (-764.607) [-768.529] -- 0:00:48
      269500 -- [-768.553] (-765.277) (-765.509) (-766.814) * [-765.653] (-766.030) (-765.321) (-765.514) -- 0:00:48
      270000 -- [-766.236] (-766.343) (-766.631) (-769.496) * (-765.287) (-766.292) (-765.329) [-765.654] -- 0:00:48

      Average standard deviation of split frequencies: 0.012482

      270500 -- (-767.654) (-766.196) (-767.068) [-768.509] * [-768.666] (-766.353) (-765.382) (-766.811) -- 0:00:48
      271000 -- (-767.054) (-767.801) [-767.036] (-766.510) * (-770.052) (-767.323) (-772.299) [-770.009] -- 0:00:48
      271500 -- (-766.342) [-770.620] (-770.772) (-765.121) * (-768.473) [-768.739] (-773.366) (-766.432) -- 0:00:48
      272000 -- [-766.165] (-768.068) (-768.537) (-765.497) * (-773.892) (-768.081) [-775.513] (-766.767) -- 0:00:48
      272500 -- [-767.666] (-766.879) (-765.624) (-766.004) * (-769.939) (-766.920) [-768.316] (-768.118) -- 0:00:48
      273000 -- [-767.493] (-767.725) (-765.954) (-767.273) * (-765.435) (-766.783) [-767.127] (-766.604) -- 0:00:47
      273500 -- (-767.344) (-765.207) (-765.836) [-765.898] * [-766.267] (-766.740) (-766.026) (-765.269) -- 0:00:47
      274000 -- (-765.554) [-765.433] (-767.238) (-774.217) * (-766.708) [-765.525] (-765.059) (-765.663) -- 0:00:47
      274500 -- (-766.289) (-768.603) [-766.171] (-768.337) * (-765.616) (-765.593) [-768.666] (-767.729) -- 0:00:47
      275000 -- [-766.617] (-765.359) (-765.186) (-766.809) * [-773.190] (-766.168) (-767.014) (-768.063) -- 0:00:47

      Average standard deviation of split frequencies: 0.012051

      275500 -- (-768.138) (-766.876) (-764.948) [-768.420] * [-765.689] (-768.370) (-767.322) (-765.022) -- 0:00:47
      276000 -- [-765.566] (-765.845) (-768.474) (-766.662) * (-765.406) [-766.337] (-765.940) (-767.181) -- 0:00:47
      276500 -- (-768.483) (-766.737) (-770.215) [-767.148] * (-766.233) (-765.760) [-766.045] (-766.467) -- 0:00:47
      277000 -- (-768.456) [-765.535] (-768.518) (-766.354) * [-766.580] (-766.479) (-767.150) (-765.562) -- 0:00:46
      277500 -- [-766.433] (-766.839) (-765.835) (-766.624) * (-766.454) (-766.703) [-765.163] (-768.171) -- 0:00:46
      278000 -- [-768.441] (-766.460) (-765.730) (-767.381) * (-770.094) [-766.302] (-764.977) (-766.984) -- 0:00:46
      278500 -- [-767.279] (-770.967) (-766.363) (-764.710) * (-766.740) (-769.040) (-765.832) [-764.985] -- 0:00:46
      279000 -- (-766.951) [-767.432] (-767.500) (-767.517) * (-765.360) [-770.518] (-768.667) (-765.797) -- 0:00:46
      279500 -- (-766.397) (-766.743) [-767.119] (-765.288) * (-765.368) (-768.209) (-764.993) [-765.669] -- 0:00:46
      280000 -- (-766.910) (-766.579) (-766.386) [-769.533] * (-767.406) (-765.737) (-767.728) [-765.794] -- 0:00:46

      Average standard deviation of split frequencies: 0.011934

      280500 -- (-766.222) (-766.539) [-770.431] (-771.476) * [-768.975] (-768.926) (-766.170) (-765.296) -- 0:00:48
      281000 -- [-765.170] (-767.492) (-765.656) (-771.074) * (-773.010) (-765.169) (-766.453) [-768.169] -- 0:00:48
      281500 -- (-768.309) (-767.399) [-765.391] (-767.521) * (-770.982) (-766.893) (-766.038) [-766.071] -- 0:00:48
      282000 -- (-764.672) (-766.541) (-767.672) [-766.813] * (-767.757) (-766.766) (-765.757) [-765.618] -- 0:00:48
      282500 -- (-764.738) (-767.143) (-764.947) [-767.190] * (-769.535) (-766.323) [-770.021] (-764.959) -- 0:00:48
      283000 -- (-766.063) (-769.115) (-766.412) [-766.155] * (-769.457) [-766.529] (-766.653) (-764.833) -- 0:00:48
      283500 -- (-766.576) [-767.006] (-765.200) (-768.715) * (-765.764) (-766.366) [-767.142] (-765.032) -- 0:00:48
      284000 -- [-765.497] (-766.261) (-765.925) (-768.317) * (-775.318) [-765.773] (-767.636) (-765.033) -- 0:00:47
      284500 -- (-768.702) (-772.466) [-765.880] (-767.883) * (-767.720) (-767.398) [-766.491] (-765.340) -- 0:00:47
      285000 -- (-768.096) [-768.219] (-766.644) (-769.183) * (-767.003) (-765.852) (-767.501) [-765.170] -- 0:00:47

      Average standard deviation of split frequencies: 0.011355

      285500 -- (-772.169) (-765.596) [-765.241] (-770.101) * (-768.958) (-767.623) [-767.799] (-768.407) -- 0:00:47
      286000 -- (-765.782) (-767.040) (-765.010) [-770.021] * (-768.319) (-766.568) (-767.971) [-768.136] -- 0:00:47
      286500 -- (-767.135) (-768.269) (-765.010) [-767.730] * [-766.393] (-765.689) (-765.036) (-766.567) -- 0:00:47
      287000 -- [-766.764] (-765.982) (-765.202) (-769.126) * (-766.817) (-768.275) (-765.472) [-766.332] -- 0:00:47
      287500 -- (-766.762) (-768.455) [-765.647] (-767.873) * [-767.369] (-769.251) (-765.631) (-766.716) -- 0:00:47
      288000 -- (-766.783) (-767.466) (-767.846) [-766.283] * (-767.525) (-766.340) (-765.911) [-768.767] -- 0:00:46
      288500 -- [-767.690] (-765.481) (-768.472) (-766.435) * (-768.291) [-765.065] (-768.233) (-767.650) -- 0:00:46
      289000 -- [-768.811] (-765.221) (-767.244) (-766.745) * (-767.577) (-765.068) [-768.258] (-765.558) -- 0:00:46
      289500 -- [-766.521] (-771.121) (-765.052) (-764.929) * (-764.770) (-764.954) (-768.753) [-768.596] -- 0:00:46
      290000 -- (-765.386) (-768.195) (-766.942) [-765.357] * [-765.123] (-766.012) (-765.272) (-768.967) -- 0:00:46

      Average standard deviation of split frequencies: 0.012254

      290500 -- (-764.701) (-767.088) (-766.469) [-765.205] * (-765.558) (-765.880) [-767.641] (-768.895) -- 0:00:46
      291000 -- [-768.179] (-766.697) (-765.382) (-769.534) * [-765.556] (-768.333) (-769.437) (-768.216) -- 0:00:46
      291500 -- (-768.499) (-767.811) [-765.510] (-767.319) * [-764.956] (-767.185) (-767.199) (-766.524) -- 0:00:46
      292000 -- [-768.055] (-769.568) (-766.953) (-771.056) * (-769.511) (-768.948) (-767.485) [-767.102] -- 0:00:46
      292500 -- [-765.531] (-766.692) (-764.680) (-767.980) * (-768.581) (-766.415) [-767.125] (-765.392) -- 0:00:45
      293000 -- (-766.583) [-765.757] (-767.792) (-767.127) * (-769.135) (-767.711) [-766.824] (-765.380) -- 0:00:45
      293500 -- [-767.721] (-769.526) (-765.212) (-767.251) * (-768.890) (-770.654) (-768.364) [-766.420] -- 0:00:45
      294000 -- (-765.036) (-767.397) (-766.500) [-769.244] * (-770.134) (-770.299) [-767.054] (-767.883) -- 0:00:45
      294500 -- (-764.842) (-767.895) (-768.272) [-765.090] * [-767.805] (-765.500) (-766.137) (-767.332) -- 0:00:45
      295000 -- [-766.898] (-769.604) (-768.632) (-765.451) * [-771.677] (-765.995) (-766.673) (-765.702) -- 0:00:45

      Average standard deviation of split frequencies: 0.013714

      295500 -- (-766.017) (-769.869) (-768.127) [-765.099] * (-768.975) (-766.658) [-766.949] (-765.388) -- 0:00:47
      296000 -- (-766.103) (-766.786) (-765.647) [-764.556] * [-773.789] (-766.215) (-768.746) (-765.653) -- 0:00:47
      296500 -- [-765.390] (-767.174) (-769.892) (-767.887) * (-771.110) (-766.136) (-765.429) [-765.466] -- 0:00:47
      297000 -- [-765.260] (-765.568) (-767.581) (-768.345) * (-773.583) (-765.038) (-765.642) [-770.554] -- 0:00:47
      297500 -- (-765.391) [-766.012] (-765.305) (-768.646) * [-770.462] (-765.344) (-766.723) (-767.081) -- 0:00:47
      298000 -- (-770.270) [-766.953] (-766.237) (-766.179) * [-767.381] (-767.892) (-768.693) (-765.026) -- 0:00:47
      298500 -- [-767.640] (-766.215) (-768.648) (-765.872) * (-767.637) (-768.052) (-767.406) [-767.478] -- 0:00:47
      299000 -- (-765.523) (-766.921) [-771.423] (-767.834) * (-767.858) (-765.964) [-765.757] (-765.997) -- 0:00:46
      299500 -- (-768.398) (-768.843) [-767.504] (-767.994) * (-765.438) (-766.377) [-766.470] (-766.453) -- 0:00:46
      300000 -- (-769.047) (-766.348) [-766.283] (-766.216) * (-769.534) (-766.406) (-766.419) [-771.576] -- 0:00:46

      Average standard deviation of split frequencies: 0.013937

      300500 -- (-766.588) (-767.040) [-768.331] (-765.487) * (-769.087) [-765.322] (-765.813) (-770.349) -- 0:00:46
      301000 -- (-768.310) (-766.804) (-766.108) [-766.352] * (-767.574) [-765.477] (-766.070) (-770.046) -- 0:00:46
      301500 -- (-769.697) [-765.486] (-768.133) (-767.864) * (-768.622) (-766.517) (-767.001) [-766.225] -- 0:00:46
      302000 -- (-767.588) (-768.040) [-765.990] (-768.138) * (-768.650) (-766.682) [-764.899] (-766.849) -- 0:00:46
      302500 -- [-767.740] (-766.657) (-765.799) (-766.974) * (-772.503) (-765.715) (-766.792) [-766.996] -- 0:00:46
      303000 -- (-767.268) [-765.765] (-765.051) (-766.657) * (-766.872) [-765.276] (-768.888) (-766.553) -- 0:00:46
      303500 -- (-767.338) (-765.688) (-766.941) [-766.336] * [-765.414] (-766.262) (-767.513) (-765.442) -- 0:00:45
      304000 -- (-766.982) [-767.051] (-768.965) (-766.841) * [-769.277] (-765.165) (-766.123) (-765.068) -- 0:00:45
      304500 -- [-767.018] (-766.468) (-767.985) (-765.936) * (-767.788) (-765.994) (-765.741) [-768.445] -- 0:00:45
      305000 -- (-768.982) [-766.294] (-769.783) (-768.305) * (-766.793) [-765.975] (-768.538) (-766.105) -- 0:00:45

      Average standard deviation of split frequencies: 0.013865

      305500 -- (-770.268) (-766.188) [-765.817] (-767.360) * (-765.022) (-765.263) (-767.903) [-765.215] -- 0:00:45
      306000 -- (-767.254) (-765.921) (-765.513) [-765.511] * (-765.997) [-765.266] (-766.344) (-765.817) -- 0:00:45
      306500 -- (-767.203) [-765.717] (-766.134) (-767.755) * [-767.076] (-767.082) (-766.606) (-768.500) -- 0:00:45
      307000 -- (-765.371) (-765.705) (-765.259) [-766.655] * (-768.396) (-768.076) [-765.307] (-767.232) -- 0:00:45
      307500 -- (-770.014) [-765.989] (-766.660) (-774.515) * (-773.660) (-769.556) (-766.216) [-770.107] -- 0:00:45
      308000 -- (-766.787) (-766.157) (-766.778) [-764.868] * (-767.567) (-769.209) [-766.864] (-768.990) -- 0:00:44
      308500 -- (-766.310) (-767.961) [-767.332] (-769.369) * (-767.920) [-767.549] (-767.311) (-766.013) -- 0:00:44
      309000 -- (-767.793) (-767.795) (-767.299) [-766.695] * (-766.335) [-768.039] (-765.781) (-765.877) -- 0:00:44
      309500 -- (-766.187) (-767.816) (-766.020) [-765.999] * (-767.422) [-767.305] (-766.890) (-767.815) -- 0:00:44
      310000 -- [-766.743] (-769.413) (-764.724) (-768.598) * (-768.516) (-769.503) (-769.409) [-765.224] -- 0:00:44

      Average standard deviation of split frequencies: 0.014584

      310500 -- (-768.000) (-765.206) [-765.083] (-768.626) * (-768.251) (-767.062) (-768.489) [-766.798] -- 0:00:46
      311000 -- (-766.971) (-765.356) (-765.233) [-769.841] * [-765.593] (-766.905) (-765.760) (-768.163) -- 0:00:46
      311500 -- (-767.447) (-768.981) (-765.547) [-767.007] * (-771.191) [-764.895] (-766.495) (-765.790) -- 0:00:46
      312000 -- (-767.061) (-766.587) [-766.286] (-767.558) * (-767.317) (-767.664) (-770.778) [-768.147] -- 0:00:46
      312500 -- [-768.834] (-765.293) (-766.932) (-767.425) * (-765.122) (-766.842) (-767.635) [-766.174] -- 0:00:46
      313000 -- [-766.326] (-768.868) (-769.162) (-768.001) * [-765.157] (-766.177) (-768.151) (-765.690) -- 0:00:46
      313500 -- (-767.167) (-766.692) [-768.450] (-769.333) * [-766.212] (-767.758) (-767.639) (-765.426) -- 0:00:45
      314000 -- (-767.551) (-766.352) (-766.015) [-766.727] * [-765.731] (-770.018) (-768.261) (-766.531) -- 0:00:45
      314500 -- (-764.744) [-767.667] (-771.195) (-767.404) * (-766.045) [-767.450] (-767.231) (-765.937) -- 0:00:45
      315000 -- (-765.295) (-767.749) [-768.606] (-767.513) * (-769.037) [-766.795] (-767.896) (-765.167) -- 0:00:45

      Average standard deviation of split frequencies: 0.013758

      315500 -- (-766.393) (-766.760) [-765.853] (-767.082) * [-766.987] (-767.013) (-769.056) (-767.190) -- 0:00:45
      316000 -- (-767.831) [-765.458] (-767.109) (-771.969) * (-765.075) (-765.569) (-767.458) [-765.741] -- 0:00:45
      316500 -- [-769.984] (-767.649) (-766.914) (-770.355) * [-766.855] (-768.117) (-769.195) (-767.007) -- 0:00:45
      317000 -- [-767.956] (-764.876) (-768.085) (-768.041) * [-768.942] (-767.119) (-766.837) (-765.749) -- 0:00:45
      317500 -- (-765.846) (-766.467) (-765.483) [-769.695] * [-765.607] (-767.708) (-766.989) (-767.125) -- 0:00:45
      318000 -- (-765.087) (-769.274) [-765.135] (-767.668) * [-766.583] (-770.603) (-765.544) (-768.218) -- 0:00:45
      318500 -- (-764.876) (-767.742) (-766.966) [-767.009] * (-768.140) (-766.016) (-765.081) [-766.433] -- 0:00:44
      319000 -- (-766.589) [-766.431] (-773.060) (-768.577) * (-771.872) (-768.558) (-765.172) [-764.906] -- 0:00:44
      319500 -- (-766.727) (-765.931) [-770.167] (-767.416) * (-765.091) (-770.623) (-765.971) [-765.475] -- 0:00:44
      320000 -- (-766.258) (-770.025) (-765.455) [-767.164] * (-764.712) [-765.435] (-766.993) (-768.443) -- 0:00:44

      Average standard deviation of split frequencies: 0.014374

      320500 -- (-764.540) [-767.886] (-766.739) (-765.464) * [-767.062] (-766.833) (-767.407) (-769.372) -- 0:00:44
      321000 -- (-768.933) (-772.251) [-765.572] (-771.919) * (-767.944) (-766.798) [-766.686] (-765.826) -- 0:00:44
      321500 -- [-769.220] (-767.499) (-765.331) (-765.764) * [-767.148] (-765.951) (-767.702) (-767.286) -- 0:00:44
      322000 -- (-767.161) [-765.774] (-766.286) (-768.033) * [-765.533] (-767.141) (-767.487) (-769.239) -- 0:00:44
      322500 -- (-766.140) [-769.665] (-765.026) (-765.227) * (-767.061) (-768.356) [-766.815] (-768.875) -- 0:00:44
      323000 -- (-768.879) (-765.648) [-766.426] (-767.451) * (-767.815) (-768.798) (-765.588) [-769.882] -- 0:00:44
      323500 -- (-768.099) (-767.103) (-766.592) [-765.935] * [-766.874] (-768.358) (-765.609) (-773.035) -- 0:00:43
      324000 -- [-766.095] (-764.814) (-765.587) (-764.951) * (-766.822) (-773.382) (-766.620) [-770.228] -- 0:00:43
      324500 -- (-764.845) [-766.257] (-765.835) (-766.034) * (-766.883) [-767.043] (-766.733) (-769.473) -- 0:00:43
      325000 -- (-767.184) [-765.367] (-766.000) (-767.287) * (-767.285) (-767.038) (-766.419) [-764.880] -- 0:00:43

      Average standard deviation of split frequencies: 0.013657

      325500 -- [-766.183] (-767.961) (-770.997) (-765.723) * (-774.263) [-767.689] (-766.413) (-770.969) -- 0:00:45
      326000 -- (-770.580) [-769.078] (-774.255) (-768.364) * (-765.896) (-765.453) (-765.659) [-769.851] -- 0:00:45
      326500 -- [-768.554] (-765.421) (-768.574) (-765.807) * [-765.796] (-767.912) (-765.153) (-766.342) -- 0:00:45
      327000 -- (-766.021) (-768.608) (-766.497) [-766.133] * (-765.657) [-766.428] (-766.405) (-767.399) -- 0:00:45
      327500 -- [-765.844] (-767.618) (-766.551) (-766.312) * [-765.948] (-770.595) (-767.838) (-771.926) -- 0:00:45
      328000 -- (-766.384) [-768.796] (-767.647) (-765.295) * [-765.003] (-770.909) (-769.425) (-770.005) -- 0:00:45
      328500 -- [-766.849] (-769.665) (-767.629) (-766.714) * [-765.162] (-767.682) (-765.879) (-765.866) -- 0:00:44
      329000 -- [-765.989] (-766.114) (-765.399) (-767.318) * [-765.658] (-769.050) (-772.391) (-765.617) -- 0:00:44
      329500 -- [-766.232] (-771.208) (-766.130) (-765.458) * (-769.723) [-767.302] (-768.070) (-770.110) -- 0:00:44
      330000 -- (-766.547) (-767.107) (-764.915) [-765.636] * (-767.054) [-768.595] (-769.324) (-765.508) -- 0:00:44

      Average standard deviation of split frequencies: 0.012672

      330500 -- (-767.203) (-765.838) (-766.258) [-768.565] * [-767.090] (-765.950) (-766.373) (-766.538) -- 0:00:44
      331000 -- (-767.405) (-768.618) [-770.353] (-766.284) * [-768.166] (-770.116) (-768.980) (-768.854) -- 0:00:44
      331500 -- (-765.282) (-767.990) [-765.398] (-766.444) * (-767.034) [-766.198] (-770.044) (-770.081) -- 0:00:44
      332000 -- (-766.129) (-773.098) (-768.979) [-770.345] * (-768.058) [-765.693] (-765.363) (-769.169) -- 0:00:44
      332500 -- [-764.752] (-771.927) (-770.172) (-772.209) * (-769.902) (-765.381) [-765.363] (-766.854) -- 0:00:44
      333000 -- (-768.429) (-772.063) [-766.795] (-772.832) * (-765.766) (-765.186) (-772.061) [-765.769] -- 0:00:44
      333500 -- [-767.754] (-768.620) (-770.162) (-767.818) * (-766.944) (-766.588) (-766.669) [-766.264] -- 0:00:43
      334000 -- (-767.176) (-766.970) [-766.796] (-766.178) * (-765.318) (-766.417) (-769.075) [-765.906] -- 0:00:43
      334500 -- (-767.240) [-765.793] (-766.190) (-767.066) * (-767.920) (-764.759) [-770.206] (-764.754) -- 0:00:43
      335000 -- (-768.002) (-765.135) (-768.646) [-766.667] * (-765.147) (-765.050) (-770.904) [-764.821] -- 0:00:43

      Average standard deviation of split frequencies: 0.011847

      335500 -- (-770.961) (-769.535) (-766.166) [-764.832] * [-764.653] (-765.862) (-765.623) (-766.588) -- 0:00:43
      336000 -- [-767.156] (-766.332) (-767.438) (-765.249) * (-766.009) (-766.027) (-767.954) [-765.239] -- 0:00:43
      336500 -- [-766.755] (-765.999) (-770.289) (-766.684) * (-767.455) (-767.346) (-770.625) [-764.834] -- 0:00:43
      337000 -- [-766.915] (-768.184) (-768.609) (-767.459) * [-768.528] (-769.158) (-767.162) (-765.447) -- 0:00:43
      337500 -- (-767.399) (-767.259) [-766.021] (-768.771) * (-769.307) [-769.579] (-765.711) (-767.020) -- 0:00:43
      338000 -- (-764.899) (-766.793) (-765.187) [-768.710] * (-766.075) (-766.589) (-768.463) [-768.833] -- 0:00:43
      338500 -- (-765.118) (-766.292) [-769.039] (-767.087) * (-768.201) (-768.498) (-766.705) [-766.915] -- 0:00:42
      339000 -- (-768.482) [-766.968] (-765.448) (-767.576) * (-766.147) [-768.722] (-765.641) (-768.617) -- 0:00:42
      339500 -- (-767.963) (-766.800) (-765.727) [-764.722] * (-765.322) (-766.147) [-770.937] (-765.673) -- 0:00:42
      340000 -- (-765.539) (-766.343) (-765.496) [-764.545] * (-768.641) [-767.809] (-770.664) (-766.213) -- 0:00:42

      Average standard deviation of split frequencies: 0.012047

      340500 -- (-765.838) (-766.792) (-766.720) [-764.528] * [-767.272] (-768.019) (-768.251) (-765.448) -- 0:00:44
      341000 -- (-771.061) (-769.875) [-765.984] (-766.461) * (-764.705) (-771.118) (-764.892) [-765.866] -- 0:00:44
      341500 -- (-767.720) (-769.266) [-766.780] (-765.400) * (-767.043) (-767.039) [-765.134] (-765.399) -- 0:00:44
      342000 -- (-766.691) (-766.769) [-769.455] (-770.521) * (-766.699) [-764.991] (-766.011) (-766.350) -- 0:00:44
      342500 -- (-768.023) (-770.260) (-767.200) [-767.981] * (-767.498) [-770.184] (-773.780) (-769.198) -- 0:00:44
      343000 -- (-766.553) (-766.836) (-765.357) [-767.162] * (-765.301) (-766.537) [-766.568] (-767.268) -- 0:00:44
      343500 -- (-767.587) (-764.640) (-766.107) [-767.636] * [-766.030] (-766.488) (-766.509) (-767.248) -- 0:00:43
      344000 -- (-768.231) (-770.902) [-765.936] (-765.700) * (-768.568) [-766.868] (-766.743) (-770.123) -- 0:00:43
      344500 -- (-770.802) (-769.927) (-766.039) [-765.707] * [-765.584] (-766.013) (-768.171) (-767.753) -- 0:00:43
      345000 -- (-767.848) (-765.261) [-765.935] (-769.127) * [-765.832] (-768.565) (-769.319) (-764.845) -- 0:00:43

      Average standard deviation of split frequencies: 0.011354

      345500 -- (-769.316) (-770.438) [-765.597] (-765.433) * (-771.502) (-764.999) (-769.549) [-765.622] -- 0:00:43
      346000 -- (-767.004) (-768.754) (-766.282) [-767.369] * (-768.475) (-766.895) (-767.875) [-769.614] -- 0:00:43
      346500 -- (-767.500) [-769.673] (-767.816) (-765.807) * (-766.703) (-767.619) (-765.522) [-765.408] -- 0:00:43
      347000 -- (-765.256) [-766.522] (-768.607) (-767.309) * (-769.287) (-767.699) (-768.040) [-768.466] -- 0:00:43
      347500 -- [-766.852] (-766.480) (-773.992) (-766.432) * [-767.974] (-767.264) (-766.824) (-765.569) -- 0:00:43
      348000 -- (-765.687) (-768.517) (-766.520) [-767.226] * (-766.544) [-766.908] (-769.556) (-765.587) -- 0:00:43
      348500 -- [-768.846] (-765.743) (-765.455) (-765.840) * [-765.067] (-767.341) (-766.707) (-764.810) -- 0:00:42
      349000 -- (-768.566) [-766.367] (-768.773) (-768.989) * [-765.217] (-769.244) (-767.526) (-764.993) -- 0:00:42
      349500 -- (-767.378) [-768.293] (-768.813) (-768.220) * (-766.767) (-767.923) (-765.762) [-764.949] -- 0:00:42
      350000 -- [-765.977] (-769.616) (-770.049) (-768.705) * (-766.723) (-766.759) [-769.477] (-764.642) -- 0:00:42

      Average standard deviation of split frequencies: 0.011427

      350500 -- (-765.846) (-767.275) (-765.553) [-765.759] * [-766.369] (-766.145) (-766.755) (-769.707) -- 0:00:42
      351000 -- (-765.062) (-766.709) [-765.575] (-765.681) * [-766.278] (-765.693) (-768.179) (-767.253) -- 0:00:42
      351500 -- (-768.895) [-766.489] (-764.938) (-766.983) * (-768.515) (-766.569) (-767.050) [-768.543] -- 0:00:42
      352000 -- (-767.471) (-766.708) [-766.616] (-767.252) * [-765.698] (-766.200) (-767.140) (-771.790) -- 0:00:42
      352500 -- (-766.100) (-767.222) (-766.070) [-767.381] * (-767.453) (-766.251) [-768.470] (-768.422) -- 0:00:42
      353000 -- (-766.116) (-770.257) [-767.786] (-766.466) * (-765.483) [-767.831] (-765.213) (-770.998) -- 0:00:42
      353500 -- (-769.314) (-769.268) [-767.575] (-766.381) * (-770.332) (-765.374) (-764.751) [-769.302] -- 0:00:42
      354000 -- (-770.941) (-770.703) (-770.576) [-769.035] * [-769.345] (-769.525) (-767.747) (-767.872) -- 0:00:41
      354500 -- (-770.847) (-766.874) (-765.072) [-770.267] * (-769.344) (-767.698) (-768.247) [-765.655] -- 0:00:41
      355000 -- (-766.192) [-765.037] (-765.563) (-765.672) * (-768.053) (-769.218) [-767.952] (-765.481) -- 0:00:41

      Average standard deviation of split frequencies: 0.011255

      355500 -- (-766.809) [-765.720] (-765.615) (-771.386) * (-767.991) [-767.615] (-767.984) (-772.467) -- 0:00:43
      356000 -- (-771.796) [-765.622] (-765.755) (-767.817) * (-767.188) (-768.548) [-768.054] (-767.301) -- 0:00:43
      356500 -- (-765.837) (-768.574) [-766.412] (-765.836) * (-770.882) (-766.487) (-766.938) [-767.395] -- 0:00:43
      357000 -- (-768.320) (-767.922) [-767.086] (-767.831) * (-770.359) [-767.970] (-765.223) (-765.852) -- 0:00:43
      357500 -- (-769.029) (-771.134) [-766.540] (-767.967) * (-766.028) (-767.909) (-769.194) [-766.436] -- 0:00:43
      358000 -- [-769.280] (-766.884) (-769.461) (-765.710) * [-767.302] (-769.735) (-768.550) (-767.436) -- 0:00:43
      358500 -- (-766.373) (-767.861) [-769.912] (-769.462) * (-768.431) (-766.426) (-766.309) [-765.382] -- 0:00:42
      359000 -- (-767.540) (-766.677) (-770.972) [-766.981] * (-766.282) (-765.679) (-770.965) [-764.539] -- 0:00:42
      359500 -- (-768.743) (-766.210) (-767.881) [-766.361] * (-769.295) (-766.930) [-768.414] (-764.569) -- 0:00:42
      360000 -- (-767.401) (-766.248) (-764.949) [-765.272] * [-766.106] (-770.453) (-766.161) (-768.129) -- 0:00:42

      Average standard deviation of split frequencies: 0.010674

      360500 -- (-767.887) [-766.931] (-766.864) (-765.168) * (-765.614) [-765.665] (-767.762) (-766.198) -- 0:00:42
      361000 -- [-767.531] (-767.911) (-766.373) (-765.684) * [-765.655] (-766.355) (-766.195) (-766.370) -- 0:00:42
      361500 -- (-768.273) (-766.312) [-765.878] (-767.353) * [-765.302] (-767.972) (-768.910) (-773.214) -- 0:00:42
      362000 -- (-767.107) (-769.704) [-770.128] (-768.195) * (-769.846) [-767.246] (-766.370) (-773.273) -- 0:00:42
      362500 -- (-765.866) (-769.210) [-767.213] (-766.684) * (-768.692) (-766.635) (-766.423) [-766.556] -- 0:00:42
      363000 -- (-766.005) [-770.729] (-765.303) (-772.049) * (-765.486) (-768.672) [-768.780] (-766.870) -- 0:00:42
      363500 -- (-765.943) (-767.775) (-769.181) [-770.471] * (-769.078) (-767.650) [-767.659] (-765.571) -- 0:00:42
      364000 -- (-765.329) (-766.883) (-766.371) [-769.110] * (-765.855) [-769.276] (-768.695) (-768.286) -- 0:00:41
      364500 -- (-767.400) (-767.510) [-768.764] (-771.009) * (-766.604) (-767.690) (-769.508) [-766.608] -- 0:00:41
      365000 -- (-770.638) (-766.802) [-766.785] (-767.296) * (-767.394) (-766.682) (-772.369) [-765.183] -- 0:00:41

      Average standard deviation of split frequencies: 0.010018

      365500 -- (-767.489) [-769.351] (-766.035) (-767.985) * (-768.348) (-765.976) (-766.449) [-764.911] -- 0:00:41
      366000 -- (-768.644) [-766.446] (-765.959) (-766.128) * [-765.522] (-769.294) (-766.619) (-765.773) -- 0:00:41
      366500 -- (-765.536) (-768.302) (-764.726) [-765.686] * [-771.610] (-765.970) (-765.590) (-769.209) -- 0:00:41
      367000 -- (-767.645) [-765.611] (-767.308) (-766.057) * (-769.655) [-765.566] (-764.838) (-769.610) -- 0:00:41
      367500 -- (-766.113) (-766.563) (-765.588) [-764.973] * (-769.941) (-767.070) (-766.564) [-768.142] -- 0:00:41
      368000 -- (-767.558) (-767.302) (-766.001) [-766.044] * (-767.283) (-767.217) [-767.800] (-766.107) -- 0:00:41
      368500 -- (-768.225) (-765.208) [-765.037] (-768.345) * (-770.951) (-767.933) (-768.211) [-767.925] -- 0:00:41
      369000 -- (-765.496) [-767.392] (-765.637) (-766.733) * (-772.368) (-767.668) [-768.933] (-767.024) -- 0:00:41
      369500 -- (-766.315) [-770.961] (-767.887) (-765.388) * (-765.323) (-767.474) [-767.528] (-769.219) -- 0:00:40
      370000 -- (-770.972) (-766.066) [-766.255] (-768.756) * (-765.804) [-767.627] (-766.030) (-768.553) -- 0:00:40

      Average standard deviation of split frequencies: 0.010174

      370500 -- (-767.787) (-767.407) (-767.727) [-765.795] * [-771.372] (-771.263) (-766.654) (-768.869) -- 0:00:40
      371000 -- (-766.837) (-765.379) (-765.175) [-767.072] * (-768.562) (-769.453) [-764.825] (-767.815) -- 0:00:42
      371500 -- (-769.781) (-765.585) (-767.597) [-767.168] * (-767.422) (-767.246) (-768.929) [-768.645] -- 0:00:42
      372000 -- (-768.884) (-764.990) (-767.177) [-765.143] * (-765.543) (-767.590) (-768.413) [-765.775] -- 0:00:42
      372500 -- [-766.626] (-769.056) (-766.171) (-769.140) * (-765.430) (-770.380) (-773.234) [-765.807] -- 0:00:42
      373000 -- (-768.504) (-769.078) (-767.052) [-765.727] * [-765.125] (-767.666) (-770.247) (-766.870) -- 0:00:42
      373500 -- [-768.545] (-769.338) (-766.421) (-768.691) * [-766.478] (-767.516) (-775.705) (-766.873) -- 0:00:41
      374000 -- (-766.222) (-771.615) [-766.094] (-766.529) * (-768.959) (-766.598) [-765.042] (-767.285) -- 0:00:41
      374500 -- (-771.208) (-771.286) [-765.973] (-765.720) * (-768.012) (-768.514) [-764.955] (-766.393) -- 0:00:41
      375000 -- (-765.891) (-767.026) (-765.236) [-765.049] * (-766.594) (-766.636) [-765.046] (-766.451) -- 0:00:41

      Average standard deviation of split frequencies: 0.010251

      375500 -- (-765.444) [-764.739] (-765.756) (-769.012) * (-766.626) (-766.200) (-766.398) [-766.073] -- 0:00:41
      376000 -- (-767.515) [-766.225] (-766.049) (-769.077) * (-767.973) (-765.621) [-766.224] (-768.979) -- 0:00:41
      376500 -- (-766.633) [-766.192] (-765.735) (-766.411) * (-766.754) (-764.996) [-767.450] (-767.565) -- 0:00:41
      377000 -- (-767.696) [-765.145] (-769.110) (-765.280) * (-769.377) [-770.489] (-766.657) (-766.317) -- 0:00:41
      377500 -- (-768.161) (-766.987) (-766.574) [-765.834] * (-766.763) (-768.578) [-766.501] (-765.429) -- 0:00:41
      378000 -- (-771.013) (-766.653) (-766.569) [-767.745] * (-767.182) (-770.659) (-774.251) [-766.629] -- 0:00:41
      378500 -- (-769.181) (-766.526) (-767.027) [-766.036] * (-767.837) (-769.041) (-765.430) [-766.974] -- 0:00:41
      379000 -- (-768.133) [-765.852] (-767.288) (-770.943) * (-769.395) (-767.805) [-765.080] (-767.706) -- 0:00:40
      379500 -- (-768.475) (-770.814) [-766.673] (-766.919) * (-768.261) (-770.341) [-766.041] (-768.967) -- 0:00:40
      380000 -- (-766.088) [-767.032] (-768.264) (-768.923) * (-766.279) (-769.459) [-766.315] (-766.688) -- 0:00:40

      Average standard deviation of split frequencies: 0.009834

      380500 -- (-766.880) (-768.568) (-765.029) [-765.640] * (-766.020) (-768.838) (-767.855) [-766.071] -- 0:00:40
      381000 -- (-766.783) [-767.220] (-765.296) (-765.944) * [-767.569] (-769.259) (-768.364) (-765.413) -- 0:00:40
      381500 -- (-766.707) (-767.594) [-766.806] (-765.896) * (-767.086) (-768.094) [-765.761] (-767.164) -- 0:00:40
      382000 -- [-767.089] (-770.914) (-767.062) (-768.589) * (-765.999) [-766.358] (-771.029) (-767.161) -- 0:00:40
      382500 -- (-766.403) (-769.205) [-771.547] (-767.786) * (-766.953) (-770.808) (-765.518) [-768.414] -- 0:00:40
      383000 -- [-769.778] (-766.434) (-767.421) (-766.678) * [-765.421] (-765.392) (-765.894) (-766.698) -- 0:00:40
      383500 -- [-766.186] (-767.420) (-766.193) (-766.521) * (-767.705) (-766.948) [-766.075] (-765.839) -- 0:00:40
      384000 -- (-767.124) (-772.585) (-765.467) [-764.982] * (-765.700) [-767.393] (-767.988) (-765.241) -- 0:00:40
      384500 -- (-766.316) (-771.835) [-766.237] (-766.662) * [-768.439] (-766.996) (-766.563) (-765.846) -- 0:00:40
      385000 -- (-767.982) [-765.940] (-766.004) (-770.236) * (-765.020) (-770.590) [-765.574] (-767.857) -- 0:00:39

      Average standard deviation of split frequencies: 0.009842

      385500 -- (-765.902) [-767.776] (-770.240) (-767.006) * (-770.044) (-768.879) (-764.901) [-766.664] -- 0:00:39
      386000 -- (-766.792) (-768.843) [-768.155] (-766.251) * [-765.773] (-768.607) (-765.094) (-773.514) -- 0:00:39
      386500 -- (-766.407) (-765.175) [-766.660] (-766.503) * [-766.017] (-765.573) (-767.235) (-767.958) -- 0:00:41
      387000 -- (-768.816) (-765.816) [-765.503] (-766.306) * [-767.284] (-770.283) (-768.226) (-765.855) -- 0:00:41
      387500 -- (-766.525) [-766.995] (-768.561) (-765.295) * (-771.106) (-768.912) (-765.823) [-766.570] -- 0:00:41
      388000 -- (-765.892) (-768.906) [-765.873] (-765.061) * (-764.780) (-768.170) [-764.963] (-767.141) -- 0:00:41
      388500 -- (-772.279) (-766.653) (-765.156) [-766.581] * (-764.733) (-766.310) (-765.473) [-768.647] -- 0:00:40
      389000 -- (-769.818) (-766.205) [-765.180] (-768.015) * [-765.797] (-770.084) (-767.861) (-767.347) -- 0:00:40
      389500 -- (-770.187) (-767.704) (-766.286) [-768.305] * (-767.415) [-773.941] (-765.261) (-767.211) -- 0:00:40
      390000 -- (-771.710) [-766.878] (-766.413) (-765.636) * [-769.077] (-769.562) (-766.218) (-768.962) -- 0:00:40

      Average standard deviation of split frequencies: 0.010576

      390500 -- [-767.592] (-769.311) (-769.713) (-768.119) * (-768.621) (-768.834) (-767.086) [-766.107] -- 0:00:40
      391000 -- [-766.139] (-767.270) (-768.424) (-770.198) * [-765.199] (-769.888) (-767.420) (-769.602) -- 0:00:40
      391500 -- (-766.527) [-767.237] (-765.086) (-765.384) * (-767.761) (-769.380) [-768.269] (-771.474) -- 0:00:40
      392000 -- (-766.480) (-768.766) (-765.567) [-765.449] * (-767.716) [-769.414] (-769.981) (-766.126) -- 0:00:40
      392500 -- (-769.802) [-764.707] (-769.860) (-765.851) * (-767.861) [-765.182] (-766.475) (-767.045) -- 0:00:40
      393000 -- (-768.817) [-766.962] (-766.244) (-765.789) * (-767.675) (-765.400) [-765.957] (-768.639) -- 0:00:40
      393500 -- [-766.108] (-766.391) (-766.034) (-765.810) * (-767.077) (-768.946) [-764.690] (-766.004) -- 0:00:40
      394000 -- (-767.363) (-765.827) [-765.479] (-768.773) * (-772.074) (-765.166) (-765.074) [-766.307] -- 0:00:39
      394500 -- (-766.797) (-766.910) (-766.284) [-767.279] * (-766.690) (-770.002) (-766.306) [-767.235] -- 0:00:39
      395000 -- (-768.426) (-769.709) (-772.930) [-767.353] * (-767.536) [-766.220] (-766.609) (-767.634) -- 0:00:39

      Average standard deviation of split frequencies: 0.010119

      395500 -- (-766.175) (-765.482) (-773.108) [-765.914] * (-766.911) [-765.887] (-771.286) (-766.348) -- 0:00:39
      396000 -- (-766.693) (-773.958) [-766.782] (-765.728) * (-769.393) (-766.252) [-768.307] (-768.542) -- 0:00:39
      396500 -- (-768.543) (-771.307) [-767.039] (-766.143) * (-770.232) (-767.809) [-766.386] (-764.795) -- 0:00:39
      397000 -- (-769.723) (-767.251) [-766.080] (-767.630) * (-768.683) (-765.775) (-767.795) [-764.973] -- 0:00:39
      397500 -- (-769.193) [-766.026] (-764.799) (-769.262) * (-766.706) (-766.920) [-765.651] (-764.927) -- 0:00:39
      398000 -- (-765.580) [-764.910] (-764.709) (-772.810) * [-766.855] (-766.962) (-767.518) (-764.944) -- 0:00:39
      398500 -- [-765.656] (-765.847) (-769.263) (-769.853) * (-766.847) (-766.893) [-767.649] (-764.792) -- 0:00:39
      399000 -- [-771.019] (-769.351) (-770.104) (-768.831) * (-767.943) [-768.428] (-770.287) (-766.787) -- 0:00:39
      399500 -- [-770.080] (-767.796) (-767.016) (-768.351) * (-765.923) (-768.040) [-767.586] (-765.838) -- 0:00:39
      400000 -- (-767.106) (-765.229) [-767.325] (-768.659) * (-769.881) [-765.249] (-766.988) (-765.434) -- 0:00:39

      Average standard deviation of split frequencies: 0.010589

      400500 -- [-765.646] (-766.594) (-768.717) (-765.152) * (-766.884) (-769.054) [-767.004] (-769.004) -- 0:00:38
      401000 -- [-766.663] (-767.170) (-766.141) (-765.507) * (-768.553) (-765.452) (-768.734) [-767.747] -- 0:00:38
      401500 -- (-766.368) (-767.053) [-765.801] (-766.296) * (-765.798) (-765.426) [-765.217] (-766.111) -- 0:00:40
      402000 -- [-767.119] (-767.553) (-767.258) (-767.421) * (-765.043) [-769.532] (-770.695) (-766.934) -- 0:00:40
      402500 -- (-765.267) (-767.377) [-768.747] (-767.752) * [-766.901] (-768.773) (-768.543) (-767.185) -- 0:00:40
      403000 -- (-766.803) (-767.543) (-770.051) [-765.601] * [-765.147] (-766.873) (-764.905) (-767.471) -- 0:00:39
      403500 -- (-767.734) (-767.308) [-768.784] (-766.490) * (-768.161) (-764.790) (-767.429) [-767.804] -- 0:00:39
      404000 -- (-766.094) (-766.044) (-769.679) [-767.543] * (-768.385) (-767.802) (-765.601) [-767.418] -- 0:00:39
      404500 -- (-766.993) (-768.352) [-770.656] (-770.575) * (-766.429) (-771.710) (-771.971) [-766.953] -- 0:00:39
      405000 -- (-768.482) (-771.152) (-766.857) [-767.241] * (-767.343) (-765.242) [-765.346] (-765.698) -- 0:00:39

      Average standard deviation of split frequencies: 0.009740

      405500 -- [-767.086] (-767.966) (-769.267) (-764.854) * (-771.725) (-768.192) (-766.270) [-766.848] -- 0:00:39
      406000 -- [-768.911] (-767.083) (-767.820) (-766.370) * [-766.570] (-771.009) (-766.435) (-765.159) -- 0:00:39
      406500 -- (-767.457) (-770.392) [-768.519] (-764.975) * (-767.315) [-772.090] (-766.670) (-766.406) -- 0:00:39
      407000 -- [-768.146] (-768.385) (-768.457) (-766.544) * (-766.395) (-768.382) (-766.264) [-765.400] -- 0:00:39
      407500 -- (-766.837) (-770.769) (-767.802) [-765.432] * (-768.327) (-767.117) [-765.733] (-768.920) -- 0:00:39
      408000 -- (-766.886) [-771.228] (-772.117) (-770.033) * (-770.568) [-769.258] (-767.228) (-767.026) -- 0:00:39
      408500 -- (-766.048) (-765.242) (-766.878) [-766.904] * (-768.493) [-766.308] (-765.654) (-766.796) -- 0:00:39
      409000 -- [-768.934] (-766.254) (-770.508) (-769.384) * (-767.368) (-765.638) (-765.325) [-764.616] -- 0:00:39
      409500 -- [-765.874] (-765.679) (-765.025) (-766.095) * (-766.394) (-766.032) (-765.536) [-766.823] -- 0:00:38
      410000 -- (-767.000) [-766.629] (-766.812) (-767.849) * (-766.711) (-767.925) (-767.271) [-766.384] -- 0:00:38

      Average standard deviation of split frequencies: 0.008508

      410500 -- [-769.896] (-772.181) (-771.127) (-769.455) * [-767.072] (-767.502) (-767.210) (-767.487) -- 0:00:38
      411000 -- [-766.024] (-768.711) (-766.783) (-769.385) * (-767.221) (-767.806) [-769.767] (-765.092) -- 0:00:38
      411500 -- [-766.276] (-767.768) (-765.641) (-766.863) * (-768.038) [-765.665] (-765.687) (-765.419) -- 0:00:38
      412000 -- (-767.959) (-769.999) [-765.351] (-764.596) * [-767.544] (-767.764) (-767.928) (-767.731) -- 0:00:38
      412500 -- (-765.149) (-769.711) [-765.134] (-765.175) * (-767.701) (-771.757) (-767.356) [-765.939] -- 0:00:38
      413000 -- (-767.286) [-770.724] (-771.092) (-767.456) * (-769.442) (-769.568) (-767.373) [-766.234] -- 0:00:38
      413500 -- (-766.098) [-767.634] (-765.714) (-768.294) * (-770.922) (-771.590) (-766.130) [-765.440] -- 0:00:38
      414000 -- (-768.706) [-767.503] (-767.873) (-769.591) * (-767.553) [-766.235] (-773.293) (-766.282) -- 0:00:38
      414500 -- (-767.926) [-767.967] (-768.370) (-765.265) * (-768.665) (-766.045) [-766.178] (-765.999) -- 0:00:38
      415000 -- [-766.097] (-766.442) (-767.083) (-765.923) * (-765.587) [-765.668] (-766.983) (-765.198) -- 0:00:38

      Average standard deviation of split frequencies: 0.009132

      415500 -- [-768.465] (-766.724) (-767.695) (-765.786) * (-767.313) [-766.778] (-768.024) (-765.580) -- 0:00:37
      416000 -- (-767.550) (-767.216) (-767.643) [-767.374] * (-765.975) (-768.632) [-765.464] (-769.948) -- 0:00:39
      416500 -- (-767.094) (-766.075) [-768.556] (-768.702) * (-766.367) [-768.735] (-766.799) (-768.512) -- 0:00:39
      417000 -- (-765.411) (-769.732) [-767.884] (-769.921) * (-766.754) (-771.697) (-768.277) [-772.236] -- 0:00:39
      417500 -- (-767.392) [-766.626] (-766.702) (-766.849) * (-765.927) (-768.962) (-773.961) [-767.858] -- 0:00:39
      418000 -- (-766.022) (-765.748) [-766.425] (-766.912) * (-765.895) (-766.558) (-766.186) [-767.452] -- 0:00:38
      418500 -- (-765.163) [-765.693] (-770.297) (-766.128) * (-767.250) (-769.050) [-766.506] (-766.521) -- 0:00:38
      419000 -- (-766.932) (-772.021) (-767.662) [-767.458] * (-769.813) (-766.232) (-764.986) [-769.333] -- 0:00:38
      419500 -- (-767.365) [-766.221] (-772.559) (-765.303) * (-767.360) [-767.448] (-765.019) (-769.779) -- 0:00:38
      420000 -- [-765.009] (-765.367) (-765.996) (-768.400) * (-766.969) (-765.763) [-764.806] (-765.297) -- 0:00:38

      Average standard deviation of split frequencies: 0.009031

      420500 -- [-768.212] (-766.283) (-767.747) (-766.580) * [-766.705] (-766.323) (-768.129) (-765.804) -- 0:00:38
      421000 -- (-768.245) (-769.375) (-765.655) [-767.552] * (-768.516) [-766.774] (-771.837) (-766.864) -- 0:00:38
      421500 -- [-768.991] (-768.534) (-766.675) (-765.557) * (-769.565) [-765.959] (-767.128) (-766.886) -- 0:00:38
      422000 -- (-767.093) (-767.152) (-769.908) [-766.287] * (-765.792) [-766.676] (-767.351) (-768.790) -- 0:00:38
      422500 -- (-769.645) (-766.457) [-767.952] (-768.683) * (-766.152) [-776.098] (-768.048) (-767.701) -- 0:00:38
      423000 -- [-765.224] (-766.373) (-770.177) (-773.192) * [-766.070] (-768.897) (-765.334) (-769.650) -- 0:00:38
      423500 -- [-766.101] (-766.808) (-767.411) (-769.166) * [-766.616] (-767.569) (-767.840) (-766.946) -- 0:00:38
      424000 -- (-770.429) (-769.121) [-766.876] (-765.962) * (-766.675) [-767.329] (-765.455) (-772.883) -- 0:00:38
      424500 -- [-766.334] (-770.051) (-766.542) (-765.772) * (-770.426) (-765.469) [-769.398] (-767.868) -- 0:00:37
      425000 -- (-770.880) (-764.930) (-765.283) [-766.760] * (-774.647) (-765.350) (-768.052) [-767.133] -- 0:00:37

      Average standard deviation of split frequencies: 0.009569

      425500 -- (-768.157) (-767.121) [-765.465] (-767.915) * (-771.539) (-766.491) (-766.820) [-767.787] -- 0:00:37
      426000 -- (-768.376) [-766.493] (-765.695) (-765.265) * (-768.465) (-767.423) (-769.043) [-767.874] -- 0:00:37
      426500 -- (-766.177) [-769.925] (-767.278) (-768.097) * (-766.148) (-765.543) (-766.347) [-766.224] -- 0:00:37
      427000 -- (-765.898) (-768.754) (-766.368) [-768.583] * (-766.063) [-771.396] (-765.473) (-768.166) -- 0:00:37
      427500 -- (-766.284) (-767.502) [-768.576] (-767.195) * [-768.795] (-765.778) (-775.304) (-765.255) -- 0:00:37
      428000 -- (-765.878) (-764.735) [-766.025] (-765.692) * (-773.583) [-768.301] (-769.869) (-766.378) -- 0:00:37
      428500 -- [-767.020] (-766.722) (-769.935) (-765.785) * (-765.291) (-768.332) (-766.592) [-766.585] -- 0:00:37
      429000 -- [-766.721] (-766.260) (-766.743) (-772.268) * (-769.191) [-765.862] (-767.570) (-766.596) -- 0:00:37
      429500 -- [-766.751] (-766.477) (-766.816) (-767.224) * [-768.534] (-769.151) (-765.786) (-765.642) -- 0:00:37
      430000 -- (-766.992) (-770.641) (-768.821) [-765.781] * (-768.411) (-769.434) (-766.717) [-765.763] -- 0:00:37

      Average standard deviation of split frequencies: 0.009787

      430500 -- (-767.260) (-770.242) (-768.111) [-766.758] * (-765.173) (-770.417) (-765.850) [-767.376] -- 0:00:37
      431000 -- (-765.983) (-766.017) (-767.703) [-766.520] * [-766.407] (-768.024) (-765.530) (-764.674) -- 0:00:38
      431500 -- (-767.624) [-767.172] (-766.589) (-765.779) * (-767.072) (-765.627) (-765.961) [-766.173] -- 0:00:38
      432000 -- [-766.826] (-765.547) (-767.151) (-764.947) * (-767.917) [-766.802] (-765.662) (-770.635) -- 0:00:38
      432500 -- (-765.825) (-768.295) [-768.868] (-765.944) * [-771.693] (-766.095) (-767.215) (-773.080) -- 0:00:38
      433000 -- (-765.463) (-766.475) [-766.261] (-767.073) * [-768.889] (-765.517) (-769.598) (-772.297) -- 0:00:37
      433500 -- [-768.250] (-765.841) (-766.918) (-767.846) * (-769.184) (-767.851) (-766.996) [-766.077] -- 0:00:37
      434000 -- (-767.182) [-769.660] (-765.275) (-765.835) * [-766.133] (-770.482) (-766.350) (-766.385) -- 0:00:37
      434500 -- [-767.321] (-766.273) (-765.065) (-767.504) * (-769.543) [-767.592] (-766.413) (-765.181) -- 0:00:37
      435000 -- [-769.373] (-767.173) (-765.770) (-767.104) * (-773.960) (-766.271) [-767.265] (-765.150) -- 0:00:37

      Average standard deviation of split frequencies: 0.009604

      435500 -- (-766.711) [-766.054] (-768.915) (-766.126) * (-766.805) (-768.273) (-767.467) [-766.588] -- 0:00:37
      436000 -- [-767.403] (-766.160) (-769.889) (-769.886) * [-768.100] (-766.939) (-767.880) (-766.861) -- 0:00:37
      436500 -- (-768.800) (-765.752) [-765.863] (-766.288) * (-768.907) [-769.635] (-766.556) (-767.283) -- 0:00:37
      437000 -- (-770.876) (-765.370) [-765.542] (-768.779) * (-767.902) (-766.165) (-767.613) [-766.508] -- 0:00:37
      437500 -- (-771.343) (-765.825) (-767.942) [-766.050] * [-767.769] (-773.977) (-768.181) (-766.755) -- 0:00:37
      438000 -- (-766.406) (-765.655) (-767.898) [-767.523] * (-767.722) (-766.267) (-768.381) [-766.602] -- 0:00:37
      438500 -- [-765.018] (-769.371) (-766.482) (-765.955) * (-771.012) (-768.294) [-766.040] (-767.615) -- 0:00:37
      439000 -- (-766.608) (-766.628) (-766.932) [-766.481] * [-767.117] (-767.014) (-769.040) (-768.457) -- 0:00:37
      439500 -- (-768.970) [-764.660] (-768.144) (-766.545) * (-767.632) (-767.839) [-768.721] (-768.758) -- 0:00:36
      440000 -- (-765.846) (-768.181) [-767.596] (-766.214) * (-769.967) [-766.723] (-768.326) (-768.419) -- 0:00:36

      Average standard deviation of split frequencies: 0.010194

      440500 -- (-767.600) [-767.075] (-766.902) (-768.096) * [-769.438] (-765.660) (-767.844) (-767.229) -- 0:00:36
      441000 -- (-766.016) [-767.457] (-769.158) (-767.456) * (-765.976) [-768.135] (-767.187) (-766.296) -- 0:00:36
      441500 -- (-765.054) (-766.472) (-768.193) [-767.103] * (-767.411) [-767.390] (-767.022) (-769.047) -- 0:00:36
      442000 -- (-765.493) [-766.704] (-765.252) (-770.080) * (-766.149) (-772.343) (-771.436) [-767.850] -- 0:00:36
      442500 -- (-765.815) [-765.631] (-765.017) (-766.826) * (-766.525) (-770.142) [-767.635] (-767.170) -- 0:00:36
      443000 -- (-767.443) [-764.928] (-765.251) (-766.364) * [-769.317] (-768.716) (-765.391) (-765.281) -- 0:00:36
      443500 -- (-767.241) (-765.333) [-764.926] (-767.932) * [-768.113] (-768.223) (-765.378) (-766.577) -- 0:00:36
      444000 -- [-768.111] (-768.987) (-765.928) (-767.179) * (-768.563) [-767.328] (-765.392) (-768.475) -- 0:00:36
      444500 -- [-766.286] (-766.865) (-765.473) (-767.837) * (-768.060) [-764.692] (-764.825) (-770.747) -- 0:00:36
      445000 -- (-769.037) [-765.864] (-769.379) (-766.081) * (-767.972) (-765.402) [-766.615] (-767.464) -- 0:00:36

      Average standard deviation of split frequencies: 0.009761

      445500 -- (-767.495) (-765.537) (-768.050) [-767.234] * [-765.288] (-766.183) (-766.654) (-768.463) -- 0:00:37
      446000 -- [-767.315] (-765.577) (-772.146) (-769.883) * (-768.956) (-768.337) [-768.783] (-766.734) -- 0:00:37
      446500 -- (-767.725) (-766.040) (-769.387) [-766.916] * (-768.316) (-765.754) [-767.523] (-770.117) -- 0:00:37
      447000 -- (-768.037) [-770.911] (-766.505) (-766.274) * (-767.919) (-767.751) [-766.374] (-767.502) -- 0:00:37
      447500 -- (-768.267) (-766.216) [-766.644] (-766.410) * (-766.390) (-766.225) [-766.713] (-765.937) -- 0:00:37
      448000 -- (-774.689) (-767.174) [-766.203] (-767.438) * [-767.843] (-766.522) (-767.245) (-769.744) -- 0:00:36
      448500 -- (-767.066) (-767.325) (-766.058) [-766.942] * (-766.450) [-766.201] (-771.266) (-768.361) -- 0:00:36
      449000 -- (-765.381) [-766.103] (-768.383) (-765.984) * (-766.397) [-768.649] (-776.042) (-766.803) -- 0:00:36
      449500 -- (-765.616) (-768.275) (-768.388) [-765.718] * (-765.183) (-765.921) [-766.655] (-766.596) -- 0:00:36
      450000 -- [-767.117] (-767.776) (-768.397) (-766.465) * (-767.012) [-766.930] (-768.947) (-764.937) -- 0:00:36

      Average standard deviation of split frequencies: 0.009124

      450500 -- [-767.461] (-769.336) (-768.234) (-766.078) * (-766.071) (-769.714) (-772.556) [-766.958] -- 0:00:36
      451000 -- [-766.751] (-774.061) (-770.053) (-767.081) * (-765.858) [-767.137] (-771.304) (-766.786) -- 0:00:36
      451500 -- (-766.075) (-768.448) [-766.111] (-769.283) * [-766.567] (-768.615) (-768.360) (-766.818) -- 0:00:36
      452000 -- (-766.410) [-766.201] (-764.914) (-769.050) * (-773.370) (-767.995) [-774.938] (-769.998) -- 0:00:36
      452500 -- [-767.127] (-768.677) (-766.123) (-767.833) * (-768.536) [-766.157] (-767.764) (-767.588) -- 0:00:36
      453000 -- (-767.557) [-766.709] (-768.283) (-767.530) * (-765.793) [-764.965] (-768.950) (-775.170) -- 0:00:36
      453500 -- (-765.880) (-767.314) [-766.965] (-770.931) * (-765.450) [-768.236] (-765.940) (-768.238) -- 0:00:36
      454000 -- (-766.662) (-765.067) (-766.708) [-768.156] * (-766.240) [-766.709] (-768.230) (-766.110) -- 0:00:36
      454500 -- (-766.132) [-764.847] (-766.506) (-768.997) * (-765.674) [-764.796] (-765.258) (-768.340) -- 0:00:36
      455000 -- (-770.321) [-766.412] (-768.118) (-768.894) * (-765.249) (-765.686) (-767.649) [-768.020] -- 0:00:35

      Average standard deviation of split frequencies: 0.009304

      455500 -- [-766.935] (-769.240) (-766.339) (-766.180) * [-765.150] (-765.686) (-765.976) (-768.502) -- 0:00:35
      456000 -- (-769.823) [-766.042] (-766.815) (-766.079) * [-765.073] (-765.686) (-767.677) (-766.122) -- 0:00:35
      456500 -- [-772.570] (-766.779) (-770.243) (-766.093) * (-765.980) [-767.192] (-766.247) (-769.835) -- 0:00:35
      457000 -- (-769.452) [-766.045] (-767.000) (-765.897) * (-765.402) (-765.915) [-766.241] (-771.753) -- 0:00:35
      457500 -- (-767.696) (-765.780) [-766.487] (-770.400) * (-766.566) (-766.884) [-765.259] (-768.679) -- 0:00:35
      458000 -- [-766.839] (-767.715) (-766.344) (-769.564) * (-770.538) (-767.853) [-764.727] (-765.277) -- 0:00:35
      458500 -- (-771.838) [-768.183] (-766.326) (-767.977) * [-766.802] (-767.567) (-767.782) (-765.765) -- 0:00:35
      459000 -- (-770.662) [-765.887] (-766.262) (-767.020) * (-767.388) (-771.353) (-766.296) [-766.355] -- 0:00:35
      459500 -- [-766.459] (-767.419) (-767.290) (-766.153) * [-766.509] (-767.793) (-765.733) (-768.359) -- 0:00:35
      460000 -- (-766.362) (-765.403) (-767.438) [-766.366] * (-766.994) [-765.702] (-766.430) (-765.435) -- 0:00:35

      Average standard deviation of split frequencies: 0.009210

      460500 -- (-765.646) [-766.098] (-765.193) (-765.231) * (-767.868) (-767.244) [-764.735] (-766.822) -- 0:00:36
      461000 -- (-766.349) (-773.443) (-766.068) [-768.510] * (-768.053) (-767.376) [-766.980] (-765.166) -- 0:00:36
      461500 -- (-768.726) [-766.391] (-766.055) (-765.652) * (-765.588) (-769.892) (-769.494) [-766.959] -- 0:00:36
      462000 -- [-771.605] (-766.520) (-766.051) (-766.809) * (-767.317) [-773.123] (-768.712) (-768.312) -- 0:00:36
      462500 -- (-765.753) [-765.864] (-770.506) (-769.920) * (-766.573) (-767.426) [-767.363] (-769.398) -- 0:00:36
      463000 -- (-766.979) (-767.007) (-767.253) [-768.755] * (-765.375) (-766.813) [-766.471] (-770.532) -- 0:00:35
      463500 -- (-767.679) [-770.075] (-769.545) (-765.018) * [-765.620] (-766.050) (-768.694) (-765.924) -- 0:00:35
      464000 -- (-767.398) [-767.670] (-770.606) (-767.492) * (-764.540) (-766.249) [-765.373] (-765.313) -- 0:00:35
      464500 -- [-766.422] (-766.891) (-768.796) (-767.653) * [-767.636] (-766.415) (-766.600) (-765.307) -- 0:00:35
      465000 -- (-767.967) (-765.738) (-766.725) [-765.418] * (-766.838) [-766.552] (-768.913) (-765.335) -- 0:00:35

      Average standard deviation of split frequencies: 0.008271

      465500 -- (-765.698) (-768.875) (-765.926) [-767.963] * [-764.687] (-768.928) (-765.381) (-765.335) -- 0:00:35
      466000 -- [-766.476] (-768.861) (-770.234) (-766.311) * (-766.410) [-765.988] (-765.932) (-767.858) -- 0:00:35
      466500 -- (-766.869) [-765.668] (-766.661) (-766.112) * (-766.671) [-766.172] (-765.921) (-765.536) -- 0:00:35
      467000 -- (-770.574) [-765.393] (-768.892) (-766.992) * (-765.158) [-765.717] (-769.487) (-769.010) -- 0:00:35
      467500 -- (-772.780) [-765.376] (-767.641) (-770.593) * (-768.503) (-766.826) (-768.418) [-772.074] -- 0:00:35
      468000 -- (-771.125) (-764.821) [-767.386] (-767.656) * (-765.317) [-767.376] (-765.159) (-766.722) -- 0:00:35
      468500 -- [-766.737] (-766.774) (-767.525) (-767.772) * (-767.109) (-770.497) (-765.455) [-767.974] -- 0:00:35
      469000 -- [-765.014] (-773.088) (-766.459) (-768.333) * (-768.214) (-767.212) [-765.763] (-765.708) -- 0:00:35
      469500 -- (-770.468) (-767.368) [-766.198] (-767.741) * [-766.757] (-766.628) (-766.217) (-765.200) -- 0:00:35
      470000 -- (-767.089) (-765.097) [-765.040] (-768.818) * (-766.195) (-769.707) (-766.261) [-767.128] -- 0:00:34

      Average standard deviation of split frequencies: 0.008425

      470500 -- (-766.850) (-766.514) [-766.065] (-766.375) * (-766.421) (-768.694) [-769.741] (-765.055) -- 0:00:34
      471000 -- (-771.003) [-766.862] (-772.462) (-772.140) * (-765.363) [-766.736] (-768.716) (-771.013) -- 0:00:34
      471500 -- (-771.706) (-767.133) (-770.482) [-767.542] * (-765.976) [-767.748] (-765.288) (-768.462) -- 0:00:34
      472000 -- [-765.830] (-767.341) (-770.916) (-770.197) * [-765.891] (-766.341) (-768.012) (-769.815) -- 0:00:34
      472500 -- (-768.912) [-767.068] (-765.311) (-767.328) * [-767.793] (-766.279) (-765.094) (-767.272) -- 0:00:34
      473000 -- (-768.103) [-766.487] (-765.766) (-768.730) * (-768.772) (-767.006) [-765.145] (-766.780) -- 0:00:34
      473500 -- (-768.412) (-769.187) (-768.810) [-765.903] * [-766.292] (-765.592) (-766.740) (-765.080) -- 0:00:34
      474000 -- (-768.504) (-765.901) [-765.977] (-765.201) * (-764.851) [-766.623] (-768.590) (-765.011) -- 0:00:34
      474500 -- [-768.140] (-765.778) (-768.775) (-769.234) * (-765.057) [-767.390] (-764.870) (-766.539) -- 0:00:34
      475000 -- (-766.220) (-765.527) (-766.841) [-769.329] * (-765.645) (-770.398) [-767.249] (-765.373) -- 0:00:35

      Average standard deviation of split frequencies: 0.008389

      475500 -- (-766.618) [-767.119] (-768.581) (-768.784) * (-766.711) (-768.933) (-771.998) [-766.718] -- 0:00:35
      476000 -- (-770.587) [-767.819] (-768.031) (-770.403) * [-773.302] (-768.681) (-765.596) (-767.843) -- 0:00:35
      476500 -- (-771.017) (-765.655) [-768.340] (-766.173) * (-769.029) (-766.051) (-767.174) [-765.694] -- 0:00:35
      477000 -- [-766.860] (-765.261) (-766.604) (-766.148) * (-766.769) [-767.024] (-766.221) (-766.258) -- 0:00:35
      477500 -- [-769.018] (-766.811) (-766.039) (-765.432) * (-770.695) (-769.452) [-768.077] (-764.631) -- 0:00:35
      478000 -- (-771.884) (-767.232) [-766.039] (-767.590) * (-767.622) (-768.435) [-767.521] (-767.984) -- 0:00:34
      478500 -- (-769.602) (-769.579) (-765.535) [-765.584] * (-766.759) (-767.932) [-769.814] (-765.102) -- 0:00:34
      479000 -- (-768.883) (-765.148) (-766.864) [-765.128] * [-768.707] (-767.244) (-768.722) (-766.520) -- 0:00:34
      479500 -- (-769.608) [-767.805] (-765.276) (-767.704) * [-768.373] (-767.176) (-768.315) (-768.253) -- 0:00:34
      480000 -- (-767.982) (-768.507) [-765.687] (-766.693) * (-768.644) (-765.593) [-765.698] (-771.243) -- 0:00:34

      Average standard deviation of split frequencies: 0.008250

      480500 -- (-769.078) (-769.335) [-765.081] (-765.675) * (-766.484) [-766.009] (-773.131) (-766.296) -- 0:00:34
      481000 -- (-769.293) (-766.940) [-767.035] (-768.650) * (-766.741) (-766.010) (-768.607) [-766.540] -- 0:00:34
      481500 -- (-767.376) (-766.263) (-779.134) [-767.935] * (-771.654) (-766.393) [-769.625] (-766.202) -- 0:00:34
      482000 -- [-768.438] (-766.747) (-765.635) (-766.061) * [-767.792] (-765.891) (-767.245) (-767.577) -- 0:00:34
      482500 -- (-768.931) (-767.872) (-766.660) [-766.256] * (-766.509) (-765.428) (-766.488) [-765.434] -- 0:00:34
      483000 -- (-766.026) [-765.725] (-766.669) (-768.376) * (-765.792) (-767.109) (-765.803) [-768.840] -- 0:00:34
      483500 -- (-766.967) [-765.331] (-766.824) (-764.999) * (-767.020) [-766.437] (-766.600) (-767.972) -- 0:00:34
      484000 -- (-767.664) (-767.190) (-766.757) [-766.279] * (-769.345) (-768.029) (-766.161) [-765.763] -- 0:00:34
      484500 -- (-767.121) (-766.871) [-766.027] (-766.517) * [-767.640] (-769.104) (-768.539) (-766.056) -- 0:00:34
      485000 -- (-766.408) (-767.042) [-764.850] (-766.214) * (-765.067) (-766.566) [-765.971] (-765.220) -- 0:00:33

      Average standard deviation of split frequencies: 0.007646

      485500 -- (-768.329) (-765.705) (-767.982) [-769.809] * (-767.294) [-766.293] (-765.573) (-766.319) -- 0:00:33
      486000 -- (-767.484) [-766.138] (-765.519) (-767.659) * (-767.254) (-770.494) [-766.562] (-766.128) -- 0:00:33
      486500 -- (-771.398) [-767.711] (-772.060) (-767.907) * (-767.105) (-769.058) [-769.289] (-766.147) -- 0:00:33
      487000 -- (-765.535) (-767.137) (-765.870) [-766.512] * (-767.007) (-765.642) (-767.642) [-765.334] -- 0:00:33
      487500 -- [-767.115] (-765.773) (-766.638) (-765.416) * [-769.806] (-769.665) (-769.170) (-767.998) -- 0:00:33
      488000 -- (-765.079) (-765.477) (-765.924) [-766.149] * (-766.580) (-768.002) (-766.052) [-766.301] -- 0:00:33
      488500 -- (-766.067) (-773.067) [-764.923] (-768.003) * (-768.051) (-768.413) [-765.887] (-768.957) -- 0:00:33
      489000 -- (-766.970) [-764.875] (-765.683) (-766.714) * [-766.779] (-765.391) (-771.394) (-768.784) -- 0:00:33
      489500 -- (-768.788) [-766.275] (-770.034) (-766.400) * (-767.312) (-767.220) (-765.215) [-768.321] -- 0:00:33
      490000 -- [-767.353] (-766.275) (-764.889) (-768.876) * (-768.417) (-767.411) (-764.688) [-767.797] -- 0:00:34

      Average standard deviation of split frequencies: 0.007460

      490500 -- (-766.323) (-768.255) (-769.686) [-764.806] * (-771.282) (-767.143) (-767.838) [-767.846] -- 0:00:34
      491000 -- (-767.928) (-767.194) [-766.114] (-766.603) * (-768.027) (-765.199) (-769.654) [-768.218] -- 0:00:34
      491500 -- (-768.546) (-769.309) (-768.145) [-764.924] * (-765.946) [-766.430] (-767.221) (-766.481) -- 0:00:34
      492000 -- [-767.067] (-769.513) (-771.782) (-766.340) * (-766.112) (-767.879) [-765.953] (-767.732) -- 0:00:34
      492500 -- (-765.582) [-766.628] (-765.964) (-767.591) * [-766.074] (-767.043) (-766.202) (-766.499) -- 0:00:34
      493000 -- (-765.850) (-767.854) (-768.769) [-770.726] * (-768.192) [-770.684] (-769.580) (-766.373) -- 0:00:33
      493500 -- (-767.219) [-765.378] (-766.793) (-766.379) * (-766.648) (-768.937) [-765.393] (-767.513) -- 0:00:33
      494000 -- [-766.167] (-766.395) (-767.478) (-769.659) * [-767.020] (-766.166) (-766.189) (-766.700) -- 0:00:33
      494500 -- (-767.098) (-768.746) [-767.946] (-769.066) * (-765.902) (-767.764) [-772.927] (-767.904) -- 0:00:33
      495000 -- (-768.322) (-765.613) (-766.977) [-767.195] * (-765.389) (-769.611) [-768.403] (-766.383) -- 0:00:33

      Average standard deviation of split frequencies: 0.007939

      495500 -- (-767.787) (-765.628) [-767.196] (-767.912) * (-765.300) [-768.930] (-766.810) (-768.196) -- 0:00:33
      496000 -- (-767.482) [-766.048] (-766.375) (-767.478) * [-768.872] (-765.539) (-767.415) (-767.426) -- 0:00:33
      496500 -- [-767.881] (-766.896) (-772.940) (-766.726) * (-765.676) (-766.318) (-766.828) [-765.730] -- 0:00:33
      497000 -- (-768.740) [-766.798] (-766.437) (-764.704) * (-765.918) (-768.901) (-769.180) [-765.835] -- 0:00:33
      497500 -- (-770.422) (-765.749) [-768.506] (-764.842) * (-767.641) (-766.706) [-765.902] (-772.873) -- 0:00:33
      498000 -- (-765.216) [-765.232] (-766.107) (-765.362) * (-765.344) [-767.474] (-765.614) (-765.918) -- 0:00:33
      498500 -- (-767.355) [-766.265] (-767.291) (-764.751) * (-768.238) (-765.570) (-765.686) [-766.569] -- 0:00:33
      499000 -- (-770.843) [-768.265] (-768.561) (-765.524) * (-768.757) (-766.384) (-768.191) [-764.955] -- 0:00:33
      499500 -- [-768.867] (-765.052) (-767.278) (-764.923) * (-769.084) (-766.652) (-766.887) [-767.827] -- 0:00:33
      500000 -- (-766.789) (-764.937) [-766.953] (-767.036) * (-764.924) [-766.147] (-765.164) (-766.864) -- 0:00:33

      Average standard deviation of split frequencies: 0.007062

      500500 -- [-765.376] (-767.012) (-768.381) (-767.036) * [-765.222] (-775.881) (-766.268) (-767.105) -- 0:00:32
      501000 -- (-766.044) [-765.865] (-766.124) (-764.863) * [-767.529] (-768.088) (-767.626) (-766.308) -- 0:00:32
      501500 -- (-766.686) (-765.683) (-766.587) [-764.942] * [-766.793] (-767.875) (-768.587) (-767.449) -- 0:00:32
      502000 -- (-768.457) [-767.413] (-766.606) (-765.341) * [-765.276] (-769.986) (-771.146) (-769.203) -- 0:00:32
      502500 -- (-768.131) (-775.687) (-767.922) [-765.895] * [-765.803] (-773.046) (-767.717) (-765.579) -- 0:00:32
      503000 -- [-765.030] (-766.357) (-768.832) (-765.850) * (-767.089) (-767.078) [-765.162] (-766.660) -- 0:00:32
      503500 -- (-771.293) (-768.002) [-767.247] (-765.909) * (-766.502) (-767.504) [-766.083] (-770.959) -- 0:00:32
      504000 -- (-769.619) (-769.225) [-765.706] (-766.980) * (-768.056) (-767.276) (-769.974) [-765.544] -- 0:00:32
      504500 -- (-765.153) (-768.684) (-769.794) [-766.436] * (-766.159) (-767.372) [-765.085] (-766.550) -- 0:00:33
      505000 -- (-766.674) (-773.387) (-770.619) [-765.682] * (-764.958) [-766.000] (-765.918) (-767.995) -- 0:00:33

      Average standard deviation of split frequencies: 0.007220

      505500 -- (-768.392) [-769.351] (-766.751) (-766.332) * [-767.458] (-766.552) (-769.686) (-769.609) -- 0:00:33
      506000 -- (-768.218) (-770.541) [-771.880] (-767.907) * (-766.230) (-767.397) (-765.955) [-767.566] -- 0:00:33
      506500 -- (-769.984) (-767.594) [-767.353] (-766.371) * (-767.239) (-767.316) [-766.253] (-767.157) -- 0:00:33
      507000 -- (-765.839) (-766.779) (-768.001) [-766.850] * (-766.288) (-769.353) [-765.101] (-767.962) -- 0:00:33
      507500 -- [-764.972] (-768.423) (-771.099) (-766.767) * (-766.154) (-772.120) [-765.167] (-769.358) -- 0:00:32
      508000 -- [-765.144] (-765.559) (-766.940) (-765.230) * (-766.681) [-766.396] (-765.587) (-767.519) -- 0:00:32
      508500 -- (-765.705) (-767.549) [-768.862] (-768.112) * (-767.623) [-766.504] (-765.613) (-767.660) -- 0:00:32
      509000 -- (-765.842) (-767.797) [-765.872] (-765.667) * (-770.659) [-765.096] (-767.257) (-765.560) -- 0:00:32
      509500 -- (-768.495) (-767.229) [-768.464] (-765.240) * (-773.286) (-765.804) [-765.410] (-767.124) -- 0:00:32
      510000 -- (-768.776) (-768.455) (-766.370) [-767.864] * (-767.965) [-769.014] (-764.994) (-768.215) -- 0:00:32

      Average standard deviation of split frequencies: 0.007731

      510500 -- (-767.117) (-768.275) [-765.478] (-769.544) * (-766.363) [-768.233] (-766.814) (-765.870) -- 0:00:32
      511000 -- (-768.057) (-766.206) [-768.354] (-767.281) * (-767.066) (-765.589) (-767.962) [-768.186] -- 0:00:32
      511500 -- (-768.330) [-770.912] (-769.120) (-771.594) * (-766.415) (-766.371) [-764.644] (-766.849) -- 0:00:32
      512000 -- (-768.889) [-771.561] (-766.143) (-768.071) * (-767.618) (-767.892) [-764.948] (-767.216) -- 0:00:32
      512500 -- [-766.193] (-772.332) (-766.047) (-770.052) * (-767.962) (-766.480) (-766.661) [-766.015] -- 0:00:32
      513000 -- [-765.094] (-768.795) (-767.981) (-766.987) * (-770.327) [-767.422] (-766.556) (-766.816) -- 0:00:32
      513500 -- (-766.360) (-770.768) [-765.999] (-765.742) * (-769.685) (-766.860) (-768.491) [-766.845] -- 0:00:32
      514000 -- [-767.187] (-769.776) (-766.722) (-766.370) * (-768.314) [-767.584] (-768.689) (-765.360) -- 0:00:32
      514500 -- (-767.786) (-768.634) (-765.229) [-766.915] * (-765.796) [-767.259] (-766.281) (-768.408) -- 0:00:32
      515000 -- (-766.476) (-768.828) [-766.938] (-765.347) * (-769.136) (-768.578) (-766.342) [-769.963] -- 0:00:32

      Average standard deviation of split frequencies: 0.008383

      515500 -- [-766.252] (-770.302) (-766.752) (-765.536) * (-765.811) (-765.503) [-767.146] (-766.702) -- 0:00:31
      516000 -- (-766.237) [-766.472] (-765.081) (-766.101) * (-767.879) (-767.463) [-766.391] (-764.904) -- 0:00:31
      516500 -- (-765.953) [-765.755] (-771.969) (-766.259) * (-766.645) (-768.789) (-765.951) [-765.979] -- 0:00:31
      517000 -- [-765.615] (-765.191) (-768.931) (-767.891) * (-770.249) [-765.422] (-764.798) (-766.665) -- 0:00:31
      517500 -- (-766.110) [-768.260] (-766.777) (-765.773) * [-765.276] (-768.000) (-768.183) (-768.221) -- 0:00:31
      518000 -- [-765.548] (-765.703) (-766.725) (-767.014) * (-766.849) (-769.759) (-766.545) [-765.632] -- 0:00:31
      518500 -- (-769.150) [-767.076] (-768.542) (-767.129) * (-764.952) (-769.073) (-767.125) [-765.097] -- 0:00:31
      519000 -- (-769.194) (-766.852) [-765.944] (-765.965) * (-766.540) (-768.989) [-767.425] (-766.650) -- 0:00:31
      519500 -- [-767.360] (-766.913) (-766.431) (-766.975) * (-768.498) (-767.734) (-769.586) [-768.657] -- 0:00:31
      520000 -- (-767.000) [-767.664] (-765.424) (-768.679) * [-767.252] (-767.839) (-769.406) (-768.859) -- 0:00:31

      Average standard deviation of split frequencies: 0.008601

      520500 -- (-765.896) (-767.327) (-770.199) [-768.465] * (-768.206) (-766.294) (-767.111) [-764.966] -- 0:00:32
      521000 -- (-767.320) (-766.644) [-767.234] (-766.811) * (-766.782) (-766.372) [-770.188] (-766.225) -- 0:00:32
      521500 -- (-767.875) [-765.942] (-771.002) (-765.348) * (-767.525) (-766.203) [-768.453] (-767.985) -- 0:00:32
      522000 -- (-768.339) (-766.371) (-766.675) [-766.666] * (-766.254) [-769.200] (-765.508) (-767.127) -- 0:00:32
      522500 -- (-770.730) (-767.253) (-766.759) [-766.658] * (-766.215) (-768.383) [-765.249] (-766.596) -- 0:00:31
      523000 -- (-768.909) [-767.044] (-767.871) (-766.776) * (-766.102) [-767.538] (-768.596) (-767.787) -- 0:00:31
      523500 -- (-765.655) (-766.058) [-772.624] (-768.180) * (-766.501) (-772.898) (-767.746) [-765.527] -- 0:00:31
      524000 -- (-765.818) (-765.020) (-767.424) [-766.068] * [-766.676] (-771.193) (-766.790) (-765.157) -- 0:00:31
      524500 -- (-765.585) (-769.169) [-771.045] (-765.329) * (-770.493) (-772.763) [-765.741] (-768.202) -- 0:00:31
      525000 -- [-766.094] (-766.707) (-766.197) (-765.406) * (-767.717) (-766.085) [-766.766] (-775.371) -- 0:00:31

      Average standard deviation of split frequencies: 0.007898

      525500 -- (-769.247) (-768.508) [-765.960] (-765.372) * [-767.667] (-768.693) (-766.569) (-768.467) -- 0:00:31
      526000 -- (-766.865) (-766.303) [-765.807] (-765.967) * (-766.585) (-767.926) [-767.655] (-770.733) -- 0:00:31
      526500 -- (-767.220) (-768.669) [-765.244] (-766.563) * (-768.321) (-767.763) (-765.058) [-766.995] -- 0:00:31
      527000 -- (-768.015) (-767.241) (-765.311) [-766.098] * (-768.221) (-766.056) [-764.901] (-767.339) -- 0:00:31
      527500 -- (-770.000) [-765.217] (-765.550) (-767.148) * (-771.384) (-766.402) [-764.633] (-768.540) -- 0:00:31
      528000 -- (-766.527) (-767.290) [-767.206] (-770.237) * [-770.259] (-766.758) (-772.177) (-769.384) -- 0:00:31
      528500 -- [-767.180] (-767.190) (-766.975) (-767.984) * [-770.257] (-766.101) (-766.412) (-769.965) -- 0:00:31
      529000 -- (-767.072) [-766.412] (-769.041) (-768.333) * [-768.490] (-766.400) (-766.083) (-767.023) -- 0:00:31
      529500 -- [-766.621] (-767.130) (-766.208) (-769.614) * [-766.087] (-765.060) (-773.074) (-765.752) -- 0:00:31
      530000 -- [-766.561] (-768.037) (-768.492) (-766.739) * [-766.478] (-766.066) (-769.497) (-765.895) -- 0:00:31

      Average standard deviation of split frequencies: 0.008439

      530500 -- (-770.056) (-773.470) [-767.629] (-768.047) * (-765.234) (-766.155) [-766.949] (-770.277) -- 0:00:30
      531000 -- [-765.593] (-765.559) (-766.349) (-767.058) * (-766.711) (-767.188) (-769.379) [-768.394] -- 0:00:30
      531500 -- (-765.907) (-766.093) (-768.836) [-765.118] * (-767.509) [-768.253] (-768.736) (-766.984) -- 0:00:30
      532000 -- (-764.988) (-768.117) (-767.179) [-765.364] * (-767.009) (-768.835) (-768.541) [-766.757] -- 0:00:30
      532500 -- [-765.790] (-772.734) (-765.420) (-766.351) * (-765.782) [-766.201] (-769.644) (-767.073) -- 0:00:30
      533000 -- (-768.873) (-766.671) [-764.855] (-768.304) * (-766.246) (-767.473) [-765.953] (-767.595) -- 0:00:30
      533500 -- (-767.739) [-766.749] (-765.342) (-769.298) * [-766.603] (-765.422) (-765.758) (-767.929) -- 0:00:30
      534000 -- (-771.509) (-765.507) [-766.977] (-769.746) * (-764.961) (-768.330) [-768.906] (-768.629) -- 0:00:30
      534500 -- (-773.715) [-769.722] (-766.206) (-767.331) * (-768.283) (-766.021) (-766.745) [-766.118] -- 0:00:30
      535000 -- (-766.635) (-766.752) [-766.331] (-766.020) * (-766.967) (-766.580) [-768.494] (-769.856) -- 0:00:30

      Average standard deviation of split frequencies: 0.008190

      535500 -- [-766.344] (-766.872) (-766.788) (-768.321) * (-766.701) [-765.720] (-768.593) (-765.506) -- 0:00:30
      536000 -- [-765.291] (-765.710) (-769.317) (-770.190) * [-768.006] (-765.440) (-767.050) (-765.807) -- 0:00:30
      536500 -- (-765.129) [-764.994] (-767.660) (-766.855) * (-765.974) (-767.263) (-765.723) [-766.120] -- 0:00:31
      537000 -- (-764.926) (-765.480) (-768.144) [-764.874] * (-765.534) (-769.702) (-765.708) [-765.967] -- 0:00:31
      537500 -- (-765.018) (-765.242) (-771.147) [-764.844] * [-766.580] (-768.294) (-766.109) (-768.192) -- 0:00:30
      538000 -- (-766.604) (-766.898) (-768.767) [-768.009] * (-768.889) [-765.212] (-768.973) (-765.967) -- 0:00:30
      538500 -- (-766.054) [-766.783] (-767.187) (-769.300) * (-769.124) (-768.561) [-766.767] (-765.847) -- 0:00:30
      539000 -- (-767.418) (-766.328) (-766.888) [-768.137] * [-767.508] (-765.845) (-769.266) (-767.644) -- 0:00:30
      539500 -- (-766.576) [-769.747] (-766.536) (-768.601) * [-767.606] (-765.322) (-768.124) (-764.501) -- 0:00:30
      540000 -- (-765.287) (-773.036) [-768.545] (-769.105) * (-768.527) (-768.890) (-770.975) [-766.369] -- 0:00:30

      Average standard deviation of split frequencies: 0.007357

      540500 -- (-764.730) (-769.430) (-766.576) [-765.571] * (-766.621) (-766.904) [-771.195] (-768.670) -- 0:00:30
      541000 -- (-765.230) (-767.676) [-766.655] (-766.153) * (-766.351) (-766.983) [-766.734] (-765.607) -- 0:00:30
      541500 -- [-764.899] (-767.561) (-765.076) (-766.912) * (-765.320) [-765.324] (-765.752) (-766.457) -- 0:00:30
      542000 -- (-767.624) (-770.186) (-766.239) [-764.943] * (-766.044) (-764.956) (-768.620) [-766.851] -- 0:00:30
      542500 -- (-768.176) (-770.041) [-766.885] (-765.042) * (-767.831) (-765.604) [-771.337] (-766.128) -- 0:00:30
      543000 -- (-767.794) [-767.977] (-768.942) (-765.514) * [-765.825] (-766.410) (-769.929) (-766.877) -- 0:00:30
      543500 -- (-768.202) [-765.682] (-766.096) (-766.017) * (-765.927) (-765.914) [-767.248] (-772.494) -- 0:00:30
      544000 -- [-766.329] (-768.164) (-767.434) (-767.784) * [-765.802] (-767.173) (-765.720) (-768.444) -- 0:00:30
      544500 -- (-769.171) (-768.113) [-766.802] (-767.487) * (-766.395) (-765.902) (-767.113) [-765.559] -- 0:00:30
      545000 -- (-766.210) (-771.096) [-770.380] (-766.115) * (-766.901) (-768.146) (-768.745) [-765.681] -- 0:00:30

      Average standard deviation of split frequencies: 0.007824

      545500 -- (-766.772) (-770.507) [-766.808] (-766.525) * (-766.076) [-767.131] (-771.193) (-765.192) -- 0:00:29
      546000 -- [-766.868] (-766.660) (-765.539) (-765.537) * [-766.542] (-769.036) (-767.756) (-765.352) -- 0:00:29
      546500 -- (-766.216) [-765.597] (-766.680) (-765.647) * (-769.698) (-771.244) (-769.004) [-766.530] -- 0:00:29
      547000 -- (-767.515) (-768.931) [-766.903] (-768.619) * (-770.963) [-766.372] (-766.189) (-766.783) -- 0:00:29
      547500 -- (-765.116) [-766.981] (-765.867) (-769.939) * (-769.286) [-765.898] (-765.613) (-765.637) -- 0:00:29
      548000 -- (-765.250) [-766.034] (-767.356) (-771.468) * (-771.445) (-766.071) [-765.684] (-766.013) -- 0:00:29
      548500 -- [-766.901] (-767.388) (-767.095) (-767.807) * (-767.827) (-768.615) [-765.622] (-773.523) -- 0:00:29
      549000 -- (-765.776) (-766.256) [-767.933] (-766.812) * (-771.749) (-768.732) [-764.901] (-769.562) -- 0:00:29
      549500 -- (-765.505) (-766.022) [-771.320] (-769.381) * [-769.112] (-766.626) (-765.283) (-767.936) -- 0:00:29
      550000 -- (-766.218) [-766.133] (-773.259) (-766.721) * (-766.653) (-765.763) [-766.371] (-768.225) -- 0:00:29

      Average standard deviation of split frequencies: 0.008400

      550500 -- (-767.918) (-766.838) [-768.981] (-765.801) * (-764.985) [-767.554] (-766.811) (-769.376) -- 0:00:29
      551000 -- (-767.105) [-768.588] (-767.116) (-765.749) * [-766.400] (-766.089) (-765.510) (-766.549) -- 0:00:29
      551500 -- (-769.103) (-768.623) [-767.941] (-765.249) * (-766.773) (-767.278) (-769.884) [-767.364] -- 0:00:30
      552000 -- (-765.605) [-768.681] (-766.646) (-765.399) * [-766.006] (-767.795) (-767.347) (-765.840) -- 0:00:30
      552500 -- [-766.881] (-768.596) (-767.234) (-769.574) * [-769.940] (-766.851) (-767.477) (-765.680) -- 0:00:29
      553000 -- (-765.422) [-768.061] (-766.277) (-765.442) * (-766.508) [-767.279] (-769.446) (-765.899) -- 0:00:29
      553500 -- (-766.949) [-767.768] (-765.008) (-767.016) * (-766.068) (-767.997) [-768.453] (-765.576) -- 0:00:29
      554000 -- (-767.180) [-766.053] (-772.031) (-769.739) * [-766.698] (-765.639) (-768.199) (-765.387) -- 0:00:29
      554500 -- (-769.687) (-767.065) (-767.828) [-767.444] * (-765.044) (-766.611) [-766.613] (-770.025) -- 0:00:29
      555000 -- (-773.493) [-768.308] (-767.068) (-766.018) * (-766.657) [-764.570] (-766.044) (-766.460) -- 0:00:29

      Average standard deviation of split frequencies: 0.007896

      555500 -- (-767.801) [-765.886] (-765.918) (-765.117) * (-768.900) (-766.464) (-765.624) [-765.885] -- 0:00:29
      556000 -- (-767.219) (-769.292) (-768.877) [-766.039] * [-774.450] (-768.479) (-766.161) (-765.639) -- 0:00:29
      556500 -- [-770.874] (-764.886) (-767.203) (-767.911) * (-769.189) (-769.306) (-770.950) [-765.001] -- 0:00:29
      557000 -- (-765.436) (-764.899) (-766.625) [-767.782] * (-765.801) (-767.466) [-767.202] (-765.155) -- 0:00:29
      557500 -- (-768.220) (-768.795) [-766.975] (-767.526) * (-766.523) (-767.115) (-768.060) [-765.363] -- 0:00:29
      558000 -- (-766.737) (-769.069) (-767.100) [-768.255] * (-766.532) (-766.520) [-766.847] (-768.583) -- 0:00:29
      558500 -- [-769.030] (-766.673) (-771.059) (-767.941) * (-769.677) (-765.858) (-766.945) [-765.380] -- 0:00:29
      559000 -- (-769.229) [-766.351] (-772.094) (-768.065) * (-765.406) [-765.904] (-766.877) (-766.266) -- 0:00:29
      559500 -- (-766.553) (-768.978) [-770.080] (-766.370) * (-765.215) [-766.518] (-765.320) (-766.541) -- 0:00:29
      560000 -- (-767.879) [-768.363] (-765.315) (-765.810) * (-766.457) (-768.017) (-765.320) [-769.428] -- 0:00:29

      Average standard deviation of split frequencies: 0.008460

      560500 -- (-767.454) (-771.998) (-768.443) [-766.340] * (-764.975) [-766.662] (-765.553) (-766.264) -- 0:00:29
      561000 -- (-771.169) (-765.346) [-768.796] (-769.842) * (-765.226) (-767.111) [-768.735] (-765.956) -- 0:00:28
      561500 -- [-767.463] (-767.392) (-766.573) (-770.059) * (-766.485) [-768.133] (-765.612) (-768.172) -- 0:00:28
      562000 -- [-764.758] (-766.508) (-766.597) (-767.068) * (-767.896) (-767.006) (-766.824) [-767.597] -- 0:00:28
      562500 -- (-765.440) (-765.110) (-765.777) [-767.420] * (-765.975) (-767.920) (-766.745) [-768.268] -- 0:00:28
      563000 -- (-766.892) (-766.558) [-767.099] (-769.311) * (-769.872) (-766.743) (-767.036) [-765.344] -- 0:00:28
      563500 -- (-766.806) [-765.862] (-766.050) (-768.784) * [-767.544] (-766.981) (-765.843) (-765.571) -- 0:00:28
      564000 -- (-767.467) (-771.287) (-765.694) [-766.165] * (-765.810) (-771.611) (-765.107) [-769.417] -- 0:00:28
      564500 -- [-765.395] (-768.375) (-767.846) (-769.101) * (-765.880) (-772.395) [-765.533] (-767.241) -- 0:00:28
      565000 -- (-766.078) (-768.841) (-767.207) [-768.105] * (-764.589) (-767.678) [-767.968] (-770.907) -- 0:00:28

      Average standard deviation of split frequencies: 0.008770

      565500 -- (-767.107) (-766.093) (-766.245) [-766.624] * (-767.941) (-765.170) (-766.116) [-768.040] -- 0:00:28
      566000 -- (-772.354) (-770.487) (-766.891) [-766.728] * [-766.101] (-765.806) (-766.355) (-765.904) -- 0:00:28
      566500 -- (-767.167) (-765.920) (-767.458) [-766.149] * (-765.036) (-766.113) (-764.992) [-768.905] -- 0:00:28
      567000 -- [-768.432] (-766.828) (-766.680) (-766.375) * [-765.281] (-767.336) (-767.591) (-767.915) -- 0:00:29
      567500 -- (-771.403) (-770.106) [-766.169] (-770.114) * [-765.724] (-767.773) (-767.534) (-768.377) -- 0:00:28
      568000 -- [-773.418] (-768.039) (-766.755) (-766.097) * (-768.077) [-767.163] (-769.200) (-771.217) -- 0:00:28
      568500 -- (-769.465) [-767.739] (-768.206) (-770.334) * (-767.985) (-769.195) [-766.308] (-766.685) -- 0:00:28
      569000 -- (-768.658) (-766.689) [-767.452] (-769.565) * (-767.928) (-770.363) [-765.905] (-767.229) -- 0:00:28
      569500 -- (-768.576) [-766.544] (-767.881) (-768.089) * (-770.184) [-768.543] (-765.809) (-767.716) -- 0:00:28
      570000 -- (-766.316) (-765.690) (-767.275) [-765.364] * (-768.462) [-768.137] (-765.700) (-766.755) -- 0:00:28

      Average standard deviation of split frequencies: 0.008892

      570500 -- [-766.870] (-765.488) (-767.384) (-767.013) * (-767.276) [-769.351] (-768.461) (-766.816) -- 0:00:28
      571000 -- [-765.683] (-767.011) (-766.902) (-766.035) * [-768.631] (-766.149) (-766.186) (-764.957) -- 0:00:28
      571500 -- [-767.453] (-770.634) (-767.157) (-765.334) * [-765.603] (-773.850) (-766.702) (-768.329) -- 0:00:28
      572000 -- (-768.767) [-768.846] (-768.030) (-764.618) * [-768.247] (-768.007) (-768.983) (-768.277) -- 0:00:28
      572500 -- (-771.271) (-766.670) [-767.045] (-764.497) * (-767.389) [-766.052] (-772.083) (-767.149) -- 0:00:28
      573000 -- (-768.492) (-766.346) [-769.254] (-766.067) * (-765.443) (-769.016) [-764.529] (-767.829) -- 0:00:28
      573500 -- [-766.348] (-767.364) (-766.730) (-766.406) * [-770.108] (-769.518) (-765.282) (-766.312) -- 0:00:28
      574000 -- [-767.909] (-765.740) (-766.750) (-769.511) * [-769.973] (-766.181) (-765.922) (-766.890) -- 0:00:28
      574500 -- (-766.628) (-766.201) [-765.725] (-768.650) * (-768.390) [-766.433] (-769.168) (-770.325) -- 0:00:28
      575000 -- (-766.686) [-764.937] (-765.683) (-766.268) * (-766.805) [-765.894] (-764.758) (-768.742) -- 0:00:28

      Average standard deviation of split frequencies: 0.008858

      575500 -- (-765.081) [-766.498] (-765.514) (-766.535) * (-766.274) [-766.615] (-767.424) (-767.680) -- 0:00:28
      576000 -- (-768.387) [-768.278] (-769.216) (-767.450) * (-766.676) (-768.208) (-771.148) [-768.019] -- 0:00:27
      576500 -- (-767.993) (-765.658) (-768.115) [-767.702] * (-767.297) (-768.275) [-768.031] (-765.953) -- 0:00:27
      577000 -- (-769.062) (-767.064) [-766.564] (-767.982) * [-768.044] (-765.800) (-771.001) (-767.152) -- 0:00:27
      577500 -- (-765.140) (-772.051) [-765.697] (-767.295) * (-768.063) (-765.908) (-767.384) [-770.048] -- 0:00:27
      578000 -- (-765.715) [-768.823] (-766.452) (-767.842) * (-766.312) [-766.529] (-767.214) (-768.656) -- 0:00:27
      578500 -- [-765.436] (-768.737) (-765.105) (-768.016) * [-764.620] (-765.574) (-769.802) (-767.234) -- 0:00:27
      579000 -- (-765.833) (-766.779) (-765.728) [-771.764] * (-765.183) [-765.168] (-776.866) (-767.793) -- 0:00:27
      579500 -- [-765.831] (-766.511) (-768.860) (-769.297) * (-767.235) (-764.991) [-767.171] (-765.806) -- 0:00:27
      580000 -- [-766.029] (-768.448) (-766.904) (-772.361) * (-765.505) (-766.187) (-767.171) [-765.860] -- 0:00:27

      Average standard deviation of split frequencies: 0.008727

      580500 -- [-768.848] (-765.956) (-764.910) (-767.609) * (-765.505) (-770.523) (-766.374) [-767.409] -- 0:00:27
      581000 -- (-767.537) (-768.610) (-770.492) [-768.473] * (-768.214) (-768.472) [-766.147] (-767.934) -- 0:00:27
      581500 -- (-766.565) [-764.721] (-771.536) (-767.862) * [-767.052] (-767.330) (-765.787) (-768.434) -- 0:00:27
      582000 -- (-765.066) [-765.459] (-766.001) (-767.542) * (-767.504) [-766.625] (-764.580) (-766.152) -- 0:00:28
      582500 -- (-766.643) (-766.878) (-768.792) [-767.732] * [-766.137] (-774.654) (-764.891) (-771.390) -- 0:00:27
      583000 -- (-766.448) [-765.684] (-767.116) (-768.111) * (-767.407) [-771.534] (-764.794) (-770.817) -- 0:00:27
      583500 -- [-765.145] (-766.589) (-768.569) (-765.967) * (-769.379) [-766.417] (-766.256) (-768.140) -- 0:00:27
      584000 -- (-765.963) (-768.082) (-767.119) [-765.876] * (-764.773) (-767.813) (-767.130) [-765.419] -- 0:00:27
      584500 -- (-768.157) [-765.418] (-767.032) (-768.429) * (-769.169) (-768.978) (-766.564) [-765.367] -- 0:00:27
      585000 -- (-765.673) (-765.536) [-771.485] (-766.564) * (-771.234) (-765.950) (-767.183) [-766.962] -- 0:00:27

      Average standard deviation of split frequencies: 0.008470

      585500 -- (-767.529) (-765.306) (-769.418) [-765.881] * (-768.717) (-765.838) (-766.540) [-766.859] -- 0:00:27
      586000 -- (-768.860) (-765.850) [-768.291] (-766.001) * (-767.203) (-766.481) [-766.129] (-767.239) -- 0:00:27
      586500 -- (-766.562) (-765.752) (-768.561) [-765.070] * (-768.369) [-766.481] (-765.971) (-766.367) -- 0:00:27
      587000 -- (-765.025) (-764.938) [-768.331] (-766.494) * (-767.779) (-765.638) [-765.418] (-767.218) -- 0:00:27
      587500 -- [-767.642] (-764.935) (-769.368) (-770.119) * (-766.608) [-765.051] (-768.539) (-767.090) -- 0:00:27
      588000 -- (-766.669) (-767.875) [-767.270] (-765.160) * (-766.057) (-767.286) (-766.584) [-765.887] -- 0:00:27
      588500 -- (-766.718) (-768.928) [-765.230] (-764.660) * (-765.418) [-765.753] (-767.520) (-768.128) -- 0:00:27
      589000 -- [-766.234] (-766.615) (-767.539) (-765.296) * (-768.488) (-765.552) (-767.461) [-766.385] -- 0:00:27
      589500 -- [-766.388] (-767.780) (-766.279) (-765.104) * (-768.645) (-770.536) [-769.050] (-765.334) -- 0:00:27
      590000 -- (-765.813) (-766.117) (-765.004) [-766.378] * [-765.845] (-769.747) (-770.044) (-766.574) -- 0:00:27

      Average standard deviation of split frequencies: 0.008829

      590500 -- (-764.862) (-765.207) (-765.527) [-767.003] * (-766.376) (-769.373) (-770.773) [-766.297] -- 0:00:27
      591000 -- [-765.892] (-765.521) (-765.246) (-768.054) * (-767.594) (-767.385) [-765.589] (-766.784) -- 0:00:26
      591500 -- (-765.054) (-765.302) [-770.259] (-768.766) * [-765.192] (-767.606) (-764.789) (-768.142) -- 0:00:26
      592000 -- (-766.673) (-767.182) [-766.604] (-768.933) * (-767.595) [-768.165] (-768.913) (-766.985) -- 0:00:26
      592500 -- (-766.579) [-765.878] (-768.730) (-767.656) * (-767.451) [-767.424] (-765.503) (-765.806) -- 0:00:26
      593000 -- (-767.032) [-767.711] (-768.150) (-767.328) * (-767.203) (-767.920) (-768.168) [-764.732] -- 0:00:26
      593500 -- [-764.612] (-765.974) (-770.253) (-766.903) * (-767.603) (-764.942) [-769.322] (-765.725) -- 0:00:26
      594000 -- [-764.945] (-768.346) (-768.817) (-764.987) * (-765.107) (-766.686) [-770.292] (-764.830) -- 0:00:26
      594500 -- (-765.647) (-765.814) [-764.888] (-766.938) * (-765.880) (-767.504) (-767.613) [-765.312] -- 0:00:26
      595000 -- [-765.177] (-768.676) (-767.788) (-768.102) * (-766.893) (-767.109) [-769.068] (-766.301) -- 0:00:26

      Average standard deviation of split frequencies: 0.008602

      595500 -- [-765.389] (-766.587) (-765.401) (-766.087) * (-764.716) (-765.099) (-767.273) [-765.353] -- 0:00:26
      596000 -- [-767.024] (-767.498) (-766.387) (-766.801) * (-772.913) (-765.116) (-767.574) [-767.700] -- 0:00:26
      596500 -- (-766.357) (-766.830) (-765.415) [-766.542] * (-768.053) (-765.083) (-769.292) [-765.018] -- 0:00:26
      597000 -- (-770.623) (-766.108) [-764.980] (-769.001) * (-767.539) [-765.120] (-770.439) (-764.998) -- 0:00:26
      597500 -- (-766.915) [-765.593] (-770.597) (-765.246) * (-770.723) (-767.972) [-765.256] (-765.115) -- 0:00:26
      598000 -- (-765.103) (-766.609) (-766.548) [-769.478] * (-766.251) [-765.232] (-766.516) (-765.790) -- 0:00:26
      598500 -- (-769.804) (-765.742) (-768.526) [-766.275] * (-765.591) (-766.707) [-769.633] (-766.243) -- 0:00:26
      599000 -- (-768.040) (-765.852) (-766.853) [-766.994] * (-767.666) (-765.334) (-766.658) [-765.262] -- 0:00:26
      599500 -- (-765.740) (-765.028) [-766.705] (-767.514) * (-773.301) (-765.938) [-772.395] (-764.697) -- 0:00:26
      600000 -- [-767.463] (-767.970) (-770.828) (-766.005) * (-773.120) (-766.312) [-769.443] (-768.841) -- 0:00:26

      Average standard deviation of split frequencies: 0.008731

      600500 -- (-767.057) (-769.231) [-765.876] (-767.452) * (-768.098) (-765.926) (-770.883) [-766.414] -- 0:00:26
      601000 -- (-766.510) (-765.578) [-765.112] (-766.494) * (-767.115) [-765.652] (-773.380) (-765.538) -- 0:00:26
      601500 -- (-767.565) [-768.308] (-768.782) (-766.254) * [-767.045] (-767.265) (-772.148) (-767.606) -- 0:00:26
      602000 -- (-768.940) (-767.198) [-765.986] (-766.543) * (-765.882) (-768.635) (-766.057) [-767.220] -- 0:00:26
      602500 -- (-768.046) (-771.592) (-766.512) [-766.948] * [-767.876] (-765.961) (-767.375) (-771.220) -- 0:00:26
      603000 -- [-765.996] (-771.119) (-767.778) (-767.599) * (-768.846) (-765.470) (-766.792) [-765.523] -- 0:00:26
      603500 -- (-768.686) [-766.357] (-765.719) (-766.807) * (-766.723) [-766.969] (-766.785) (-766.406) -- 0:00:26
      604000 -- [-768.356] (-768.313) (-767.391) (-770.250) * (-765.615) (-767.629) [-767.531] (-768.079) -- 0:00:26
      604500 -- (-766.952) (-770.098) [-766.110] (-768.375) * (-768.721) [-765.535] (-769.456) (-767.581) -- 0:00:26
      605000 -- (-767.753) (-765.672) (-766.109) [-769.031] * (-766.124) (-766.557) [-765.714] (-765.441) -- 0:00:26

      Average standard deviation of split frequencies: 0.008328

      605500 -- (-769.477) (-765.159) [-767.533] (-766.412) * (-768.987) (-767.961) (-765.858) [-768.048] -- 0:00:26
      606000 -- (-766.096) (-766.253) [-767.925] (-767.776) * (-768.093) (-768.740) [-766.902] (-768.114) -- 0:00:26
      606500 -- [-766.295] (-766.039) (-767.054) (-765.631) * (-767.886) (-768.757) [-765.823] (-766.572) -- 0:00:25
      607000 -- (-765.800) (-764.659) (-765.984) [-764.647] * (-767.268) (-767.293) [-767.148] (-766.927) -- 0:00:25
      607500 -- (-765.633) (-766.266) (-765.232) [-765.397] * (-767.404) (-766.952) (-768.568) [-766.580] -- 0:00:25
      608000 -- (-769.180) (-766.101) (-764.895) [-769.493] * [-765.033] (-767.379) (-768.497) (-771.108) -- 0:00:25
      608500 -- (-765.974) [-769.536] (-765.369) (-765.574) * (-765.442) [-766.983] (-769.005) (-766.419) -- 0:00:25
      609000 -- (-766.990) (-770.020) [-768.131] (-766.067) * (-765.298) (-767.508) (-765.108) [-768.455] -- 0:00:25
      609500 -- (-766.722) [-765.922] (-767.344) (-765.919) * [-765.790] (-765.551) (-766.917) (-766.622) -- 0:00:25
      610000 -- (-765.935) (-771.339) (-765.595) [-765.461] * (-767.021) [-767.776] (-766.468) (-767.291) -- 0:00:25

      Average standard deviation of split frequencies: 0.008446

      610500 -- [-765.806] (-766.833) (-765.612) (-768.763) * (-770.737) [-767.374] (-764.720) (-766.268) -- 0:00:25
      611000 -- (-769.032) [-764.677] (-768.823) (-765.358) * (-771.794) (-773.360) (-765.043) [-770.122] -- 0:00:25
      611500 -- (-766.568) [-764.819] (-766.766) (-768.902) * (-766.464) (-773.213) [-765.370] (-766.691) -- 0:00:25
      612000 -- (-766.990) (-765.686) [-767.971] (-768.687) * (-765.976) (-772.076) (-766.065) [-765.574] -- 0:00:25
      612500 -- (-766.856) (-767.927) [-768.396] (-765.849) * [-769.249] (-775.665) (-767.473) (-767.645) -- 0:00:25
      613000 -- (-766.407) (-765.883) (-767.947) [-766.595] * (-766.401) (-769.002) (-766.289) [-764.944] -- 0:00:25
      613500 -- (-768.767) (-769.174) [-766.838] (-765.884) * (-768.857) (-767.271) (-765.478) [-766.460] -- 0:00:25
      614000 -- (-767.689) [-767.850] (-767.452) (-770.098) * (-765.512) (-765.674) (-765.758) [-765.625] -- 0:00:25
      614500 -- (-767.635) [-766.113] (-765.416) (-772.115) * [-768.385] (-765.587) (-767.756) (-768.021) -- 0:00:25
      615000 -- (-768.477) (-769.408) [-765.977] (-768.079) * [-767.038] (-771.247) (-765.388) (-767.755) -- 0:00:25

      Average standard deviation of split frequencies: 0.008463

      615500 -- (-766.455) (-768.333) [-764.469] (-766.266) * [-765.725] (-767.165) (-772.109) (-767.726) -- 0:00:25
      616000 -- [-766.075] (-765.480) (-767.836) (-767.151) * (-766.250) (-766.819) (-768.593) [-765.342] -- 0:00:25
      616500 -- (-766.101) [-766.955] (-765.394) (-766.103) * (-765.523) (-768.283) (-765.683) [-766.243] -- 0:00:25
      617000 -- (-765.574) (-767.536) [-768.981] (-765.347) * [-765.219] (-765.963) (-765.619) (-765.249) -- 0:00:25
      617500 -- [-766.610] (-766.192) (-766.957) (-765.359) * (-764.937) (-765.707) [-767.070] (-765.305) -- 0:00:25
      618000 -- (-768.707) (-770.291) (-769.954) [-765.307] * (-767.198) [-765.333] (-766.490) (-765.979) -- 0:00:25
      618500 -- (-769.472) [-767.931] (-767.094) (-765.716) * (-765.565) (-767.432) [-766.120] (-767.366) -- 0:00:25
      619000 -- (-766.770) (-769.413) [-765.279] (-767.085) * (-770.992) (-771.430) [-765.804] (-764.641) -- 0:00:25
      619500 -- (-766.395) [-764.709] (-766.418) (-769.815) * (-768.653) (-768.716) (-768.347) [-765.955] -- 0:00:25
      620000 -- (-767.236) (-765.830) [-765.436] (-766.794) * (-766.552) [-766.039] (-766.327) (-766.974) -- 0:00:25

      Average standard deviation of split frequencies: 0.008757

      620500 -- (-766.176) [-768.534] (-767.599) (-765.809) * [-769.365] (-767.359) (-764.730) (-768.628) -- 0:00:25
      621000 -- (-769.348) [-767.135] (-766.157) (-766.030) * (-766.015) (-765.797) [-764.995] (-771.734) -- 0:00:25
      621500 -- (-765.734) (-767.069) (-770.715) [-766.839] * (-765.970) (-766.523) [-765.505] (-767.874) -- 0:00:24
      622000 -- (-765.673) (-765.665) (-771.046) [-766.563] * (-766.814) (-766.227) (-766.818) [-766.760] -- 0:00:24
      622500 -- (-767.193) (-768.656) (-771.505) [-765.502] * (-771.910) [-767.454] (-767.854) (-765.120) -- 0:00:24
      623000 -- (-770.021) [-768.777] (-767.248) (-765.314) * (-765.669) (-765.256) [-767.580] (-767.964) -- 0:00:24
      623500 -- (-770.433) [-765.763] (-767.690) (-766.189) * (-767.594) (-767.202) (-766.598) [-770.715] -- 0:00:24
      624000 -- (-766.617) (-764.859) (-769.721) [-767.582] * (-770.500) (-765.241) (-766.591) [-765.113] -- 0:00:24
      624500 -- [-766.879] (-766.154) (-768.913) (-767.431) * [-767.424] (-767.860) (-765.209) (-767.293) -- 0:00:24
      625000 -- (-766.562) [-767.088] (-773.057) (-766.841) * (-765.986) (-766.448) [-766.420] (-766.594) -- 0:00:24

      Average standard deviation of split frequencies: 0.008682

      625500 -- (-764.948) [-766.950] (-766.737) (-766.528) * (-766.370) (-766.248) [-768.304] (-766.439) -- 0:00:24
      626000 -- (-767.991) (-768.310) (-767.901) [-766.539] * [-767.318] (-766.828) (-766.576) (-766.822) -- 0:00:24
      626500 -- (-769.070) (-768.336) [-769.186] (-768.376) * (-769.793) (-772.629) (-767.945) [-767.610] -- 0:00:24
      627000 -- [-767.194] (-769.260) (-768.023) (-771.091) * (-766.142) (-770.352) (-765.860) [-768.451] -- 0:00:24
      627500 -- (-766.809) (-771.007) (-767.871) [-766.222] * [-765.138] (-769.496) (-766.771) (-769.358) -- 0:00:24
      628000 -- [-766.185] (-768.204) (-767.571) (-765.988) * (-767.232) (-768.410) (-765.758) [-767.320] -- 0:00:24
      628500 -- (-766.722) (-768.473) (-767.016) [-765.062] * (-767.494) (-770.897) (-764.711) [-766.668] -- 0:00:24
      629000 -- (-764.797) (-769.946) [-765.505] (-765.683) * (-768.867) [-764.836] (-765.416) (-766.283) -- 0:00:24
      629500 -- (-765.223) (-768.057) (-766.286) [-765.963] * (-768.526) [-765.210] (-766.236) (-769.932) -- 0:00:24
      630000 -- (-766.491) [-767.394] (-766.024) (-765.537) * (-766.777) (-765.166) [-767.009] (-767.190) -- 0:00:24

      Average standard deviation of split frequencies: 0.008926

      630500 -- (-765.392) (-768.507) (-765.988) [-765.491] * [-770.363] (-765.278) (-766.623) (-765.599) -- 0:00:24
      631000 -- (-765.079) (-767.172) (-771.686) [-766.964] * (-769.436) (-769.392) (-767.081) [-766.545] -- 0:00:24
      631500 -- (-766.465) [-765.836] (-766.764) (-767.648) * (-768.268) [-766.630] (-765.879) (-766.249) -- 0:00:24
      632000 -- (-765.354) (-770.757) (-765.718) [-770.602] * [-767.454] (-766.288) (-766.260) (-769.819) -- 0:00:24
      632500 -- (-766.995) (-768.954) [-766.001] (-766.975) * (-769.445) (-766.659) [-765.853] (-768.523) -- 0:00:24
      633000 -- [-767.140] (-766.238) (-767.798) (-769.135) * (-768.645) [-770.649] (-765.276) (-766.932) -- 0:00:24
      633500 -- (-765.252) (-766.067) [-766.903] (-766.922) * [-769.043] (-767.701) (-772.125) (-766.994) -- 0:00:24
      634000 -- (-767.920) (-765.688) [-768.328] (-768.532) * [-765.101] (-768.866) (-774.857) (-765.292) -- 0:00:24
      634500 -- [-767.047] (-768.060) (-767.825) (-768.021) * [-765.514] (-766.488) (-765.932) (-764.720) -- 0:00:24
      635000 -- [-766.284] (-768.327) (-769.041) (-770.678) * [-767.426] (-765.641) (-772.455) (-767.652) -- 0:00:24

      Average standard deviation of split frequencies: 0.008851

      635500 -- (-766.732) (-766.891) [-767.333] (-771.977) * (-767.445) (-768.713) [-766.742] (-769.441) -- 0:00:24
      636000 -- (-765.329) (-766.970) (-768.267) [-769.992] * (-769.545) (-766.504) (-768.593) [-767.202] -- 0:00:24
      636500 -- (-767.320) (-765.679) [-765.784] (-765.090) * (-766.879) [-765.364] (-766.012) (-768.104) -- 0:00:23
      637000 -- [-765.136] (-770.971) (-766.139) (-766.688) * (-771.407) [-767.383] (-764.823) (-768.270) -- 0:00:23
      637500 -- [-771.231] (-764.969) (-768.778) (-767.474) * [-766.911] (-766.195) (-767.130) (-765.872) -- 0:00:23
      638000 -- (-768.853) (-767.322) (-769.688) [-765.844] * (-770.437) (-767.535) (-765.806) [-764.785] -- 0:00:23
      638500 -- (-767.718) (-767.737) (-768.770) [-767.516] * (-766.296) [-764.956] (-766.226) (-764.892) -- 0:00:23
      639000 -- (-768.616) [-767.592] (-766.071) (-766.383) * (-766.159) (-768.954) [-767.258] (-765.745) -- 0:00:23
      639500 -- (-766.783) (-767.000) [-769.370] (-764.920) * (-770.481) (-765.319) [-768.655] (-771.250) -- 0:00:23
      640000 -- (-766.728) [-765.853] (-769.263) (-766.288) * (-764.944) (-769.265) (-765.778) [-769.870] -- 0:00:23

      Average standard deviation of split frequencies: 0.008692

      640500 -- (-771.506) [-766.855] (-767.268) (-771.169) * [-765.051] (-766.686) (-765.874) (-766.038) -- 0:00:23
      641000 -- [-765.603] (-766.727) (-765.520) (-767.911) * (-769.063) [-767.006] (-764.844) (-767.620) -- 0:00:23
      641500 -- (-765.541) (-766.186) [-767.074] (-765.789) * [-766.113] (-764.737) (-767.198) (-768.609) -- 0:00:23
      642000 -- (-766.355) (-770.292) [-767.272] (-768.709) * [-766.729] (-766.987) (-770.882) (-768.063) -- 0:00:23
      642500 -- [-766.663] (-766.572) (-767.415) (-767.221) * [-767.090] (-767.687) (-766.496) (-767.784) -- 0:00:23
      643000 -- [-766.453] (-766.868) (-765.074) (-767.384) * (-767.402) [-765.601] (-767.002) (-771.034) -- 0:00:23
      643500 -- [-769.603] (-767.984) (-766.332) (-768.496) * (-765.946) (-768.150) [-768.878] (-770.324) -- 0:00:23
      644000 -- (-768.231) [-767.003] (-766.440) (-766.478) * (-765.432) (-766.223) [-768.613] (-765.724) -- 0:00:23
      644500 -- (-767.557) (-766.873) (-766.446) [-766.603] * (-765.156) [-767.146] (-769.112) (-769.124) -- 0:00:23
      645000 -- (-765.565) [-767.251] (-766.392) (-764.731) * [-765.884] (-766.500) (-771.381) (-765.612) -- 0:00:23

      Average standard deviation of split frequencies: 0.008456

      645500 -- (-765.590) (-769.624) [-766.596] (-773.364) * [-765.800] (-765.935) (-765.811) (-767.457) -- 0:00:23
      646000 -- (-765.451) (-769.532) (-768.215) [-766.824] * [-771.647] (-765.584) (-765.286) (-769.447) -- 0:00:23
      646500 -- (-766.565) (-767.694) (-765.917) [-765.769] * (-766.038) (-765.628) [-768.523] (-770.539) -- 0:00:23
      647000 -- (-766.837) (-764.759) [-767.663] (-767.665) * (-767.150) [-765.603] (-765.374) (-768.490) -- 0:00:23
      647500 -- [-766.544] (-767.956) (-767.470) (-769.763) * (-765.465) [-765.833] (-765.145) (-765.468) -- 0:00:23
      648000 -- [-766.656] (-768.319) (-767.548) (-766.542) * (-765.096) [-767.427] (-767.513) (-765.099) -- 0:00:23
      648500 -- [-764.732] (-771.753) (-768.504) (-767.375) * (-764.806) (-768.282) (-767.892) [-765.548] -- 0:00:23
      649000 -- (-765.272) [-770.083] (-773.502) (-767.375) * (-766.464) (-765.385) [-768.098] (-766.357) -- 0:00:23
      649500 -- (-765.985) [-766.222] (-772.258) (-765.784) * (-768.822) (-765.758) (-765.690) [-767.460] -- 0:00:23
      650000 -- (-767.090) (-766.810) (-770.744) [-765.939] * (-770.673) [-765.093] (-765.372) (-767.786) -- 0:00:23

      Average standard deviation of split frequencies: 0.008694

      650500 -- [-766.158] (-768.376) (-766.333) (-769.708) * (-765.622) (-768.252) (-769.317) [-767.569] -- 0:00:23
      651000 -- [-765.201] (-768.157) (-766.419) (-769.046) * [-765.723] (-770.802) (-771.053) (-765.408) -- 0:00:23
      651500 -- (-768.421) (-767.073) [-770.136] (-767.509) * (-766.179) [-768.116] (-767.347) (-768.154) -- 0:00:23
      652000 -- (-767.781) (-766.217) [-767.473] (-767.495) * (-765.737) (-767.117) (-766.922) [-766.309] -- 0:00:22
      652500 -- (-765.827) (-768.933) [-765.735] (-766.094) * (-767.383) [-766.740] (-768.097) (-766.497) -- 0:00:22
      653000 -- (-767.510) (-768.526) (-766.474) [-765.285] * (-765.475) [-766.330] (-769.016) (-765.870) -- 0:00:22
      653500 -- (-766.457) (-768.725) [-766.667] (-766.976) * (-765.048) [-771.068] (-767.753) (-765.661) -- 0:00:22
      654000 -- [-766.212] (-767.489) (-765.744) (-767.378) * [-765.497] (-767.417) (-767.309) (-765.793) -- 0:00:22
      654500 -- (-765.677) (-764.873) [-770.348] (-767.599) * (-766.398) [-766.111] (-767.137) (-766.013) -- 0:00:22
      655000 -- (-766.043) [-767.293] (-771.003) (-769.141) * (-765.042) [-767.928] (-768.085) (-767.100) -- 0:00:22

      Average standard deviation of split frequencies: 0.008412

      655500 -- (-769.808) (-765.812) [-767.780] (-772.357) * (-765.626) [-766.190] (-766.909) (-770.401) -- 0:00:22
      656000 -- [-765.361] (-768.271) (-767.079) (-768.982) * (-768.706) (-769.942) (-769.599) [-767.294] -- 0:00:22
      656500 -- (-766.703) (-768.233) (-765.737) [-764.815] * (-769.071) [-768.008] (-766.844) (-767.954) -- 0:00:22
      657000 -- (-766.312) (-767.699) (-767.791) [-765.057] * (-768.555) (-766.157) [-765.536] (-766.845) -- 0:00:22
      657500 -- (-766.533) [-764.986] (-768.391) (-765.044) * (-766.754) [-766.923] (-766.157) (-767.937) -- 0:00:22
      658000 -- [-765.783] (-774.146) (-766.590) (-765.639) * [-766.535] (-767.549) (-766.771) (-767.646) -- 0:00:22
      658500 -- (-765.890) [-768.320] (-771.054) (-767.897) * (-765.744) [-768.542] (-767.671) (-767.098) -- 0:00:22
      659000 -- [-766.205] (-767.257) (-766.954) (-770.157) * (-772.913) [-766.388] (-767.772) (-767.302) -- 0:00:22
      659500 -- (-767.694) [-766.495] (-768.157) (-768.118) * [-769.564] (-765.934) (-774.347) (-768.587) -- 0:00:22
      660000 -- (-767.600) [-768.879] (-769.363) (-766.691) * (-771.829) (-765.300) (-766.803) [-767.084] -- 0:00:22

      Average standard deviation of split frequencies: 0.007723

      660500 -- [-766.073] (-765.856) (-768.664) (-766.270) * (-767.908) [-767.154] (-766.862) (-768.329) -- 0:00:22
      661000 -- [-766.570] (-767.946) (-766.218) (-767.244) * [-765.757] (-765.253) (-768.618) (-767.102) -- 0:00:22
      661500 -- (-765.148) (-770.460) [-765.434] (-764.899) * [-770.974] (-766.944) (-766.397) (-771.090) -- 0:00:22
      662000 -- (-765.599) (-767.908) (-769.751) [-766.362] * [-768.531] (-768.919) (-769.053) (-768.750) -- 0:00:22
      662500 -- [-766.992] (-766.680) (-767.439) (-766.444) * [-766.417] (-765.773) (-766.389) (-765.095) -- 0:00:22
      663000 -- (-766.441) [-765.874] (-766.549) (-766.359) * [-765.867] (-765.575) (-768.724) (-767.517) -- 0:00:22
      663500 -- [-767.057] (-767.364) (-771.470) (-767.434) * [-768.251] (-768.529) (-766.604) (-766.168) -- 0:00:22
      664000 -- [-766.263] (-766.658) (-768.096) (-767.775) * [-768.076] (-769.068) (-768.946) (-766.773) -- 0:00:22
      664500 -- (-766.961) [-766.462] (-766.611) (-766.435) * (-765.455) (-766.945) (-766.117) [-766.712] -- 0:00:22
      665000 -- (-766.438) (-765.428) (-767.380) [-766.080] * (-766.599) (-766.235) (-768.170) [-767.709] -- 0:00:22

      Average standard deviation of split frequencies: 0.007536

      665500 -- (-766.883) [-766.630] (-767.200) (-764.870) * (-766.269) (-768.261) [-766.821] (-768.309) -- 0:00:22
      666000 -- (-771.086) (-771.569) (-767.935) [-766.362] * (-766.329) (-767.352) (-765.377) [-769.964] -- 0:00:22
      666500 -- (-765.901) [-768.143] (-769.551) (-765.880) * (-766.105) (-766.841) (-778.522) [-768.641] -- 0:00:22
      667000 -- [-766.937] (-767.415) (-771.151) (-765.926) * (-766.860) (-768.131) (-769.809) [-764.621] -- 0:00:21
      667500 -- (-767.172) (-766.764) [-767.212] (-770.849) * (-768.924) (-767.179) [-766.803] (-768.059) -- 0:00:21
      668000 -- (-768.643) (-768.507) [-765.981] (-766.662) * [-770.141] (-767.757) (-766.739) (-765.728) -- 0:00:21
      668500 -- (-766.458) (-769.380) (-765.255) [-768.769] * (-769.114) (-770.886) [-765.242] (-765.792) -- 0:00:21
      669000 -- (-771.800) [-767.812] (-765.220) (-767.194) * [-765.495] (-768.323) (-768.973) (-769.241) -- 0:00:21
      669500 -- (-766.396) (-765.663) [-768.620] (-768.035) * (-766.749) (-769.470) [-766.661] (-766.135) -- 0:00:21
      670000 -- [-765.955] (-765.495) (-767.347) (-770.261) * [-765.838] (-767.035) (-767.274) (-768.811) -- 0:00:21

      Average standard deviation of split frequencies: 0.007908

      670500 -- (-767.776) (-765.104) [-765.371] (-770.572) * (-766.461) (-768.861) (-765.141) [-766.828] -- 0:00:21
      671000 -- (-766.886) (-766.279) [-766.348] (-769.911) * (-765.888) [-767.552] (-765.323) (-772.094) -- 0:00:21
      671500 -- (-765.813) [-765.959] (-765.445) (-768.043) * (-767.724) [-768.349] (-765.595) (-768.566) -- 0:00:21
      672000 -- (-769.472) (-765.668) [-765.777] (-771.500) * [-768.121] (-766.129) (-768.014) (-766.174) -- 0:00:21
      672500 -- (-766.620) (-766.745) [-772.575] (-771.833) * (-766.948) (-770.439) (-767.351) [-765.208] -- 0:00:21
      673000 -- (-769.068) [-765.076] (-773.130) (-773.281) * [-768.300] (-766.843) (-767.840) (-767.901) -- 0:00:21
      673500 -- (-766.250) (-765.041) (-767.832) [-766.890] * [-766.395] (-768.903) (-765.555) (-764.786) -- 0:00:21
      674000 -- (-765.520) [-765.903] (-767.348) (-767.235) * (-766.161) (-766.321) (-766.160) [-769.087] -- 0:00:21
      674500 -- (-777.816) [-767.829] (-769.494) (-768.841) * [-766.729] (-765.946) (-767.907) (-768.088) -- 0:00:21
      675000 -- (-768.042) (-769.705) (-767.128) [-767.946] * (-768.054) (-765.409) (-766.559) [-765.541] -- 0:00:21

      Average standard deviation of split frequencies: 0.007627

      675500 -- (-770.519) (-766.171) [-767.087] (-764.677) * [-767.051] (-767.138) (-766.721) (-768.401) -- 0:00:21
      676000 -- [-768.696] (-768.911) (-767.735) (-766.256) * (-770.609) (-770.706) [-765.922] (-767.468) -- 0:00:21
      676500 -- (-764.546) [-764.933] (-766.950) (-769.916) * (-767.758) (-765.838) [-768.979] (-767.863) -- 0:00:21
      677000 -- (-770.813) (-765.009) (-766.477) [-766.164] * (-769.265) [-767.240] (-768.505) (-769.275) -- 0:00:21
      677500 -- (-769.584) [-764.764] (-764.882) (-766.837) * (-765.991) (-768.800) [-765.611] (-766.472) -- 0:00:21
      678000 -- [-765.078] (-767.729) (-767.227) (-767.085) * (-765.194) (-766.879) [-766.368] (-766.862) -- 0:00:21
      678500 -- (-768.309) (-765.910) [-766.430] (-765.426) * (-765.650) [-767.394] (-766.074) (-766.684) -- 0:00:21
      679000 -- (-767.487) (-766.326) [-768.192] (-765.001) * [-765.618] (-767.164) (-766.659) (-767.118) -- 0:00:21
      679500 -- [-766.139] (-768.858) (-766.233) (-765.280) * [-766.623] (-766.737) (-765.776) (-767.037) -- 0:00:21
      680000 -- [-766.248] (-766.251) (-767.752) (-766.142) * (-766.378) [-766.271] (-765.732) (-768.631) -- 0:00:21

      Average standard deviation of split frequencies: 0.007272

      680500 -- (-770.179) (-766.695) [-764.918] (-767.902) * (-765.586) [-767.052] (-767.391) (-766.177) -- 0:00:21
      681000 -- (-766.952) (-769.497) [-768.323] (-766.129) * (-765.798) (-766.376) [-765.781] (-771.080) -- 0:00:21
      681500 -- (-768.286) [-766.286] (-768.543) (-767.632) * [-766.266] (-765.391) (-766.530) (-769.297) -- 0:00:21
      682000 -- [-767.557] (-765.938) (-768.362) (-768.412) * [-766.978] (-769.525) (-765.553) (-766.970) -- 0:00:20
      682500 -- (-768.145) [-766.066] (-767.364) (-766.773) * (-766.894) [-769.451] (-766.147) (-771.341) -- 0:00:20
      683000 -- (-765.345) (-766.112) (-769.128) [-765.799] * (-766.220) (-767.873) (-765.942) [-768.585] -- 0:00:20
      683500 -- (-764.993) (-766.680) (-766.404) [-765.170] * (-768.631) (-771.205) [-765.970] (-770.120) -- 0:00:20
      684000 -- (-766.154) [-766.192] (-766.170) (-766.401) * (-765.124) (-766.692) [-765.421] (-766.714) -- 0:00:20
      684500 -- (-765.772) [-765.528] (-769.965) (-767.035) * (-770.253) (-769.823) [-769.519] (-769.509) -- 0:00:20
      685000 -- (-765.791) [-767.044] (-767.289) (-769.155) * [-764.486] (-767.521) (-769.606) (-766.876) -- 0:00:20

      Average standard deviation of split frequencies: 0.006872

      685500 -- (-766.318) (-766.315) [-765.486] (-767.355) * [-766.649] (-766.972) (-767.391) (-771.992) -- 0:00:20
      686000 -- (-764.852) (-767.067) [-765.548] (-766.865) * (-765.851) [-766.401] (